254780494

254780494

cation diffusion facilitator family transporter, putative

GeneID in NCBI database:8209489Locus tag:CLIBASIA_01905
Protein GI in NCBI database:254780494Protein Accession:YP_003064907.1
Gene range:+(783013, 783957)Protein Length:314aa
Gene description:cation diffusion facilitator family transporter, putative
COG prediction:[P] Predicted Co/Zn/Cd cation transporters
KEGG prediction:cation diffusion facilitator family transporter, putative
SEED prediction:Cobalt-zinc-cadmium resistance protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Cobalt-zinc-cadmium resistance;
Glutathione-regulated potassium-efflux system and associated functions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM6 TM-Helix
TOPPRED6 TM-Helix
HMMTOP7 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM5 TM-Helix
PHOBIUS6 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MQNYKARSKSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQKKWAI
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccc
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccEEEEEccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHccccccEEEEEEEcccccccc
mqnykarsKSEESLLKLSICMTIFMASVNLIIGTitnsssivfDGFYSYLEAGMTALSLLVAKLIARdvskvdyrERERYFqfgfwhfepmvLAFNSVILICVALYEFLISILNIIsgghdinfEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRdsaydwiiPYVDSMVLMFICLFILpsaictmkSATFEIFqmtspdldsqVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLivpahypikrIASLDAIRHEIGNAIgglgeerwLTISFTTQKKWAI
mqnykarskseeSLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAigglgeerwltisfttqkkwai
MQNYKARskseesllklsICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQKKWAI
**************LKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIA*************YFQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQKKWAI
************SLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQKKWAI
*****ARSKSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQKKW**
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQNYKARSKSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQKKWAI
MQNYKARSKSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQKKWAI
MQNYKARSKSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQKKWAI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target314 cation diffusion facilitator family transporter, putati
315122319314 cation diffusion facilitator family transporter, putati 1 1e-145
209965859308 cation diffusion facilitator family transporter,putativ 1 5e-73
239833460347 cation diffusion facilitator family transporter [Ochrob 1 2e-71
153010261308 cation diffusion facilitator family transporter [Ochrob 1 5e-71
170723146319 cation efflux protein [Pseudomonas putida W619] Length 1 1e-68
150377312341 cation efflux protein [Sinorhizobium medicae WSM419] Le 1 3e-67
325274612319 cation efflux protein [Pseudomonas sp. TJI-51] Length = 1 4e-67
193782596308 Cation efflux protein [Sinorhizobium meliloti 1021] Len 1 4e-67
26987962319 cation efflux protein [Pseudomonas putida KT2440] Lengt 1 5e-67
307309737308 cation efflux protein [Sinorhizobium meliloti BL225C] L 1 5e-67
>gi|315122319|ref|YP_004062808.1| cation diffusion facilitator family transporter, putative [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 314 Back     alignment and organism information
 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 248/314 (78%), Positives = 281/314 (89%)

Query: 1   MQNYKARSKSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLL 60
           MQ+YKARSKSEE LLKLSI +TI MAS NLI+G IT+SSSIVFDGFYSYL+AGMT LSLL
Sbjct: 1   MQDYKARSKSEERLLKLSIGVTILMASANLIVGIITDSSSIVFDGFYSYLDAGMTTLSLL 60

Query: 61  VAKLIARDVSKVDYRERERYFQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGH 120
           V +LI+RD  +VD  ER+RYFQFGFWHFEPMVLAFNS++LICV  YEF+ISILNIISGGH
Sbjct: 61  VVRLISRDTLEVDNGERKRYFQFGFWHFEPMVLAFNSIVLICVTFYEFIISILNIISGGH 120

Query: 121 DINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLC 180
           +I+FEKAV+YS VAS IC +MG+YE RCN+ IKSDFIALDAK+WIVAG LLLA+V AF+C
Sbjct: 121 NIDFEKAVLYSIVASIICFIMGLYERRCNKHIKSDFIALDAKAWIVAGLLLLAIVFAFIC 180

Query: 181 AMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLDSQVREALY 240
            +LL+ SAY WI+ YVDS+VLM ICLFI+PSAI TMK ATFEIFQMT P+LD QVRE LY
Sbjct: 181 GILLKSSAYHWIVFYVDSIVLMGICLFIIPSAIYTMKCATFEIFQMTPPELDLQVREVLY 240

Query: 241 PIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEER 300
           PIVIRHGFLDFYTYVTK GR+R+IEIYLIVP HYPIKRI+SLDAIR+EIG AIGGLGEER
Sbjct: 241 PIVIRHGFLDFYTYVTKTGRARVIEIYLIVPLHYPIKRISSLDAIRYEIGEAIGGLGEER 300

Query: 301 WLTISFTTQKKWAI 314
           WLTISFT+QK+WAI
Sbjct: 301 WLTISFTSQKRWAI 314


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209965859|ref|YP_002298774.1| cation diffusion facilitator family transporter,putative [Rhodospirillum centenum SW] Length = 308 Back     alignment and organism information
>gi|239833460|ref|ZP_04681788.1| cation diffusion facilitator family transporter [Ochrobactrum intermedium LMG 3301] Length = 347 Back     alignment and organism information
>gi|153010261|ref|YP_001371475.1| cation diffusion facilitator family transporter [Ochrobactrum anthropi ATCC 49188] Length = 308 Back     alignment and organism information
>gi|170723146|ref|YP_001750834.1| cation efflux protein [Pseudomonas putida W619] Length = 319 Back     alignment and organism information
>gi|150377312|ref|YP_001313907.1| cation efflux protein [Sinorhizobium medicae WSM419] Length = 341 Back     alignment and organism information
>gi|325274612|ref|ZP_08140668.1| cation efflux protein [Pseudomonas sp. TJI-51] Length = 319 Back     alignment and organism information
>gi|193782596|ref|NP_435608.2| Cation efflux protein [Sinorhizobium meliloti 1021] Length = 308 Back     alignment and organism information
>gi|26987962|ref|NP_743387.1| cation efflux protein [Pseudomonas putida KT2440] Length = 319 Back     alignment and organism information
>gi|307309737|ref|ZP_07589388.1| cation efflux protein [Sinorhizobium meliloti BL225C] Length = 308 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target314 cation diffusion facilitator family transporter, putati
pfam01545273 pfam01545, Cation_efflux, Cation efflux family 1e-23
COG0053304 COG0053, MMT1, Predicted Co/Zn/Cd cation transporters [ 4e-13
COG3965314 COG3965, COG3965, Predicted Co/Zn/Cd cation transporter 7e-73
COG1230296 COG1230, CzcD, Co/Zn/Cd efflux system component [Inorga 6e-08
TIGR01297268 TIGR01297, CDF, cation diffusion facilitator family tra 1e-07
KOG1482379 KOG1482, KOG1482, KOG1482, Zn2+ transporter [Inorganic 0.002
>gnl|CDD|144949 pfam01545, Cation_efflux, Cation efflux family Back     alignment and domain information
>gnl|CDD|30402 COG0053, MMT1, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|33746 COG3965, COG3965, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31423 COG1230, CzcD, Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|162291 TIGR01297, CDF, cation diffusion facilitator family transporter Back     alignment and domain information
>gnl|CDD|36695 KOG1482, KOG1482, KOG1482, Zn2+ transporter [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 314 cation diffusion facilitator family transporter, putati
PRK09509300 fieF ferrous iron efflux protein F; Reviewed 100.0
COG0053304 MMT1 Predicted Co/Zn/Cd cation transporters [Inorganic 100.0
COG3965314 Predicted Co/Zn/Cd cation transporters [Inorganic ion t 100.0
PRK03557312 zinc transporter ZitB; Provisional 100.0
pfam01545273 Cation_efflux Cation efflux family. Members of this fam 100.0
COG1230296 CzcD Co/Zn/Cd efflux system component [Inorganic ion tr 100.0
KOG1485412 consensus 100.0
TIGR01297294 CDF cation diffusion facilitator family transporter; In 100.0
KOG1482379 consensus 100.0
KOG1484354 consensus 100.0
KOG1483404 consensus 100.0
KOG2802503 consensus 99.83
COG0053304 MMT1 Predicted Co/Zn/Cd cation transporters [Inorganic 98.42
TIGR01297294 CDF cation diffusion facilitator family transporter; In 95.83
PRK09509300 fieF ferrous iron efflux protein F; Reviewed 98.3
PRK03557312 zinc transporter ZitB; Provisional 97.6
pfam01545273 Cation_efflux Cation efflux family. Members of this fam 97.42
KOG1485 412 consensus 96.95
KOG1484 354 consensus 94.66
COG4956 356 Integral membrane protein (PIN domain superfamily) [Gen 93.51
COG1230296 CzcD Co/Zn/Cd efflux system component [Inorganic ion tr 96.86
PRK08676 486 hydrogenase membrane subunit; Validated 93.36
>PRK09509 fieF ferrous iron efflux protein F; Reviewed Back     alignment and domain information
>COG0053 MMT1 Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3965 Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03557 zinc transporter ZitB; Provisional Back     alignment and domain information
>pfam01545 Cation_efflux Cation efflux family Back     alignment and domain information
>COG1230 CzcD Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1485 consensus Back     alignment and domain information
>TIGR01297 CDF cation diffusion facilitator family transporter; InterPro: IPR002524 Members of this family are integral membrane proteins, that are found to increase tolerance to divalent metal ions such as cadmium, zinc, and cobalt Back     alignment and domain information
>KOG1482 consensus Back     alignment and domain information
>KOG1484 consensus Back     alignment and domain information
>KOG1483 consensus Back     alignment and domain information
>KOG2802 consensus Back     alignment and domain information
>COG0053 MMT1 Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01297 CDF cation diffusion facilitator family transporter; InterPro: IPR002524 Members of this family are integral membrane proteins, that are found to increase tolerance to divalent metal ions such as cadmium, zinc, and cobalt Back     alignment and domain information
>PRK09509 fieF ferrous iron efflux protein F; Reviewed Back     alignment and domain information
>PRK03557 zinc transporter ZitB; Provisional Back     alignment and domain information
>pfam01545 Cation_efflux Cation efflux family Back     alignment and domain information
>KOG1485 consensus Back     alignment and domain information
>KOG1484 consensus Back     alignment and domain information
>COG4956 Integral membrane protein (PIN domain superfamily) [General function prediction only] Back     alignment and domain information
>COG1230 CzcD Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08676 hydrogenase membrane subunit; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target314 cation diffusion facilitator family transporter, putati
2qfi_A300 Structure Of The Zinc Transporter Yiip Length = 300 4e-38
3h90_A283 Structural Basis For The Autoregulation Of The Zinc 8e-37
3byp_A94 Mode Of Action Of A Putative Zinc Transporter Czrb 5e-11
2zzt_A107 Crystal Structure Of The Cytosolic Domain Of The Ca 3e-04
gi|158430180|pdb|2QFI|A Chain A, Structure Of The Zinc Transporter Yiip Length = 300 Back     alignment and structure
 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 47/283 (16%), Positives = 102/283 (36%), Gaps = 22/283 (7%)

Query: 24  FMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQF 83
            +  + +     T S SI+     S ++ G +  +LLV +           +  +    F
Sbjct: 22  LLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYSL--------QPADDNHSF 73

Query: 84  GFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGV 143
           G    E +     S+ +   AL+ FL  I ++IS     +    VI + VA    +++  
Sbjct: 74  GHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALICTIILVS 133

Query: 144 YENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMF 203
           ++    R  +S  +  D   +     +  A+++A   +         +     D++  + 
Sbjct: 134 FQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSW--------YGWHRADALFALG 185

Query: 204 ICLFILPSAICTMKSATFEIFQMT-SPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSR 262
           I ++IL SA+     A   +       +   ++ + +       G  D      + G +R
Sbjct: 186 IGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDIVTSWPGVSGAHD--LRTRQSGPTR 243

Query: 263 IIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTIS 305
            I+I+L +    P   +     +  ++  AI        + I 
Sbjct: 244 FIQIHLEMEDSLP---LVQAHMVADQVEQAILRRFPGSDVIIH 283


>gi|257471895|pdb|3H90|A Chain A, Structural Basis For The Autoregulation Of The Zinc Transporter Yiip Length = 283 Back     alignment and structure
>gi|206581889|pdb|3BYP|A Chain A, Mode Of Action Of A Putative Zinc Transporter Czrb Length = 94 Back     alignment and structure
>gi|256032320|pdb|2ZZT|A Chain A, Crystal Structure Of The Cytosolic Domain Of The Cation Diffusion Facilitator Family Protein Length = 107 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target314 cation diffusion facilitator family transporter, putati
3h90_A283 Ferrous-iron efflux pump FIEF; membrane protein, zinc t 4e-12
>3h90_A Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_A Length = 283 Back     alignment and structure
 Score = 67.2 bits (163), Expect = 4e-12
 Identities = 51/281 (18%), Positives = 106/281 (37%), Gaps = 20/281 (7%)

Query: 17  LSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRE 76
            +  M   +  + +     T S SI+     S ++ G +  +LLV +           + 
Sbjct: 8   AATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYSL--------QP 59

Query: 77  RERYFQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASF 136
            +    FG    E +     S+ +   AL+ FL  I ++IS     +    VI + VA  
Sbjct: 60  ADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALI 119

Query: 137 ICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYV 196
             +++  ++    R  +S  +  D   +     +  A+++A   +         +     
Sbjct: 120 CTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSW--------YGWHRA 171

Query: 197 DSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLD-SQVREALYPIVIRHGFLDFYTYV 255
           D++  + I ++IL SA+     A   +     PD +  ++ + +       G  D  T  
Sbjct: 172 DALFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDIVTSWPGVSGAHDLRTR- 230

Query: 256 TKVGRSRIIEIYLIVPAHYPIKRIASL-DAIRHEIGNAIGG 295
            + G +R I+I+L +    P+ +   + D +   I     G
Sbjct: 231 -QSGPTRFIQIHLEMEDSLPLVQAHMVADQVEQAILRRFPG 270


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target314 cation diffusion facilitator family transporter, putati
3h90_A283 Ferrous-iron efflux pump FIEF; membrane protein, zinc t 100.0
3byp_A94 CZRB protein; membrane protein, zinc transporter, trans 99.3
2zzt_A107 Putative uncharacterized protein; cation diffusion faci 99.1
3cq1_A103 Putative uncharacterized protein TTHB138; DTDP-4-keto-L 92.74
3h90_A283 Ferrous-iron efflux pump FIEF; membrane protein, zinc t 96.93
>3h90_A Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_A Back     alignment and structure
Probab=100.00  E-value=0  Score=361.40  Aligned_cols=278  Identities=18%  Similarity=0.158  Sum_probs=256.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCHHHHHHH
Q ss_conf             89999999999999999999999983799999999999999999999999999820000120378964375204568999
Q gi|254780494|r   12 ESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEPM   91 (314)
Q Consensus        12 ~~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G~~r~E~l   91 (314)
                      +|++..++..|.+++++|+++|+++||.||++||+||+.|++++++++++.+++        +||||++|||||+|+|++
T Consensus         3 ~r~~~~~~~~n~~l~~~k~~~g~~tgS~allaDa~hs~~D~~~~~i~l~~~~~s--------~r~~d~~~pyG~~r~E~l   74 (283)
T 3h90_A            3 SRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYS--------LQPADDNHSFGHGKAESL   74 (283)
T ss_dssp             CTHHHHHHHHHHTTHHHHHHSSCSSSSSCCCSTTTHHHHHHHHHHHHHHHHHHH--------TCCCCSSCSSCSTTHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------CCCCCCCCCCCCHHHHHH
T ss_conf             789999999999999999999999807999999999999999999999999982--------699875699840345079


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999998514798765117999999999986688998764103577799999998757887421
Q gi|254780494|r   92 VLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLL  171 (314)
Q Consensus        92 ~~l~~~~~l~~~~~~i~~~si~~l~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~~~~~s~~l~~~~~~~~~D~~~s  171 (314)
                      +++++++++++.++++++++++++++|+++..+.+++.+..++.+.+..++++.++.+|+.+|+.+++++.|++.|.++|
T Consensus        75 ~~l~~~~~l~~~~~~~~~~ai~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~a~~~~~~~D~~~s  154 (283)
T 3h90_A           75 AALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMN  154 (283)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTSSSSCCCCCCCCCTHHHHHHHHHHHHHHHHHHHHHHHSCCHHHHHHHHHHHHHHCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999852334667764447876422326899998876521357866777788875369877


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCH-HHHHHHHHHHHHCCCCCCCEE
Q ss_conf             3579999999983013444204679989999999999998899999999999530997-899999999971576115100
Q gi|254780494|r  172 LAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSP-DLDSQVREALYPIVIRHGFLD  250 (314)
Q Consensus       172 ~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~~~~~~~~~~~~Ll~~~~~-~~~~~I~~~i~~~~~v~~v~~  250 (314)
                      +++++|+++.++        +++|+||++++++++++++.+++++|++.++|+|.+|+ +..+++++.+++.+++.++|+
T Consensus       155 ~~vl~~~~~~~~--------~~~~~D~i~~l~i~l~i~~~~~~~~~~~~~~Ll~~s~~~~~~~~i~~~i~~~~~v~~v~~  226 (283)
T 3h90_A          155 GAILLALGLSWY--------GWHRADALFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDIVTSWPGVSGAHD  226 (283)
T ss_dssp             SCSCSSSCSCST--------TSCCSTHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHSSSCSEEEE
T ss_pred             HHHHHHHHHHHH--------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             599999999994--------952000899999999999999999999999981789986789999999976899730588


Q ss_pred             EEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCC
Q ss_conf             016787046769999999988899861099999999999999865489219999985476
Q gi|254780494|r  251 FYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQK  310 (314)
Q Consensus       251 ~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~~~~i~F~~~~  310 (314)
                      .++|  +.|++.++|+|+++|+++   +++|.|++++++|+++++++|..+++||+++..
T Consensus       227 l~~~--~~G~~~~v~v~i~v~~~~---~~~~~~~i~~~ie~~l~~~~~~~~v~Ih~eP~~  281 (283)
T 3h90_A          227 LRTR--QSGPTRFIQIHLEMEDSL---PLVQAHMVADQVEQAILRRFPGSDVIIHQDPCS  281 (283)
T ss_dssp             EEEE--EETTEEEEEEEEECCTTC---BHHHHHHHHHHHHHHHHHHSTTCEEEEEEECSC
T ss_pred             EEEE--EECCCEEEEEEEEECCCC---CHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             9999--988969999999989899---899999999999999997679986999947864



>3byp_A CZRB protein; membrane protein, zinc transporter, transport protein; 1.70A {Thermus thermophilus} SCOP: d.52.9.1 PDB: 3byr_A Back     alignment and structure
>2zzt_A Putative uncharacterized protein; cation diffusion facilitator (CDF), transporter, zinc, membrane protein, cytosolic domain; 2.84A {Thermotoga maritima} Back     alignment and structure
>3cq1_A Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A* Back     alignment and structure
>3h90_A Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 314 cation diffusion facilitator family transporter, putati
d2qfia2204 f.59.1.1 (A:5-208) Ferrous-iron efflux pump FieF {Esche 6e-10
>d2qfia2 f.59.1.1 (A:5-208) Ferrous-iron efflux pump FieF {Escherichia coli [TaxId: 562]} Length = 204 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Cation efflux protein transmembrane domain-like
superfamily: Cation efflux protein transmembrane domain-like
family: Cation efflux protein transmembrane domain-like
domain: Ferrous-iron efflux pump FieF
species: Escherichia coli [TaxId: 562]
 Score = 58.6 bits (141), Expect = 6e-10
 Identities = 37/216 (17%), Positives = 79/216 (36%), Gaps = 16/216 (7%)

Query: 8   SKSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIAR 67
            +        +  M   +  + +     T S SI+     S ++ G +  +LLV +    
Sbjct: 2   GRLVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYS-- 59

Query: 68  DVSKVDYRERERYFQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKA 127
                  +  +    FG    E +     S+ +   AL+ FL  I ++IS     +    
Sbjct: 60  ------LQPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVG 113

Query: 128 VIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDS 187
           VI + VA    +++  ++    R  +S  +  D   +     +  A+++A   +      
Sbjct: 114 VIVTIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSW----- 168

Query: 188 AYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEI 223
              +     D++  + I ++IL SA+     A   +
Sbjct: 169 ---YGWHRADALFALGIGIYILYSALRMGYEAVQSL 201


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target314 cation diffusion facilitator family transporter, putati
d2qfia2204 Ferrous-iron efflux pump FieF {Escherichia coli [TaxId: 99.97
d3bypa182 Putative Zinc transporter CzrB {Thermus thermophilus [T 99.19
d2qfia182 Ferrous-iron efflux pump FieF (YiiP) {Escherichia coli 98.83
>d2qfia2 f.59.1.1 (A:5-208) Ferrous-iron efflux pump FieF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Cation efflux protein transmembrane domain-like
superfamily: Cation efflux protein transmembrane domain-like
family: Cation efflux protein transmembrane domain-like
domain: Ferrous-iron efflux pump FieF
species: Escherichia coli [TaxId: 562]
Probab=99.97  E-value=4.1e-41  Score=269.21  Aligned_cols=202  Identities=18%  Similarity=0.174  Sum_probs=186.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCHHHH
Q ss_conf             99889999999999999999999999983799999999999999999999999999820000120378964375204568
Q gi|254780494|r    9 KSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHF   88 (314)
Q Consensus         9 ~~e~~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G~~r~   88 (314)
                      |.+||++++++..|+.+++.|+++|+++||+++++||+||+.|++++++++++.+.        ++||||++|||||+|+
T Consensus         3 r~~~r~~~~~~~~n~~l~i~~~~~~~~t~S~allada~~s~~D~~~~~~~l~~~~~--------s~k~~d~~~pyG~~r~   74 (204)
T d2qfia2           3 RLVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRY--------SLQPADDNHSFGHGKA   74 (204)
T ss_dssp             SSSSTTSHHHHGGGTTTTTBTTBCCCCTTSSCCCCCCCTTHHHHHHHHHHHHHHTT--------SSSSCSTTSSCSCCTH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HCCCCCCCCCCCHHHH
T ss_conf             99999999999999999999999999955299999999999999999999999876--------0799986688642678


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999998514798765117999999999986688998764103577799999998757887
Q gi|254780494|r   89 EPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAG  168 (314)
Q Consensus        89 E~l~~l~~~~~l~~~~~~i~~~si~~l~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~~~~~s~~l~~~~~~~~~D~  168 (314)
                      |++++++++++++++++++++|+++++.+|+++.+...++++.+++.+.+..++++.++.+|+.+|+.++++++|++.|.
T Consensus        75 E~l~~l~~~~~l~~~~~~~~~~si~~l~~~~~~~~~~~~~~v~~~~~~~~~~l~~~~~~~~~~~~s~~~~a~~~~~~~D~  154 (204)
T d2qfia2          75 ESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDV  154 (204)
T ss_dssp             HHHHHHTTTTTTSSSTTGGGSSCTTSSTTTSSSSTTTSCCCCCGGGSSCGGGGTTTHHHHGGGCCSTTSGGGGGGHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH
T ss_conf             79999998999999999999999999972011346099999999999999999999887220021452699999999789


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             4213579999999983013444204679989999999999998899999999999530
Q gi|254780494|r  169 YLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQM  226 (314)
Q Consensus       169 ~~s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~~~~~~~~~~~~Ll~~  226 (314)
                      +.|.++++++++.++        +.+|+||++++++++++++.+++++||+.++|+|.
T Consensus       155 ~~s~~vii~~~~~~~--------~~~~~D~i~aiii~~~i~~~~~~~~~~~~~~Lld~  204 (204)
T d2qfia2         155 MMNGAILLALGLSWY--------GWHRADALFALGIGIYILYSALRMGYEAVQSLLDR  204 (204)
T ss_dssp             CCSSTTCCCTTSSCS--------STTSSSSSSHHHHTTTTTTTTTTHHHHTGGGSSCC
T ss_pred             HHHHHHHHHHHHHHH--------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             987999999999993--------84032699999999999999999999999987294



>d3bypa1 d.52.9.1 (A:6-87) Putative Zinc transporter CzrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qfia1 d.52.9.1 (A:209-290) Ferrous-iron efflux pump FieF (YiiP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 314 cation diffusion facilitator family transporter, p
3h90_A_1-202202 (A:1-202) Ferrous-iron efflux pump FIEF; membrane 3e-10
>3h90_A (A:1-202) Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_ALength = 202 Back     alignment and structure
 Score = 60.2 bits (145), Expect = 3e-10
 Identities = 37/216 (17%), Positives = 78/216 (36%), Gaps = 16/216 (7%)

Query: 11  EESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVS 70
                  +  M   +  + +     T S SI+     S ++ G +  +LLV +       
Sbjct: 2   VSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYSL---- 57

Query: 71  KVDYRERERYFQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIY 130
               +  +    FG    E +     S+ +   AL+ FL  I ++IS     +    VI 
Sbjct: 58  ----QPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIV 113

Query: 131 SCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYD 190
           + VA    +++  ++    R  +S  +  D   +     +  A+++A   +         
Sbjct: 114 TIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSW-------- 165

Query: 191 WIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQM 226
           +     D++  + I ++IL SA+     A   +   
Sbjct: 166 YGWHRADALFALGIGIYILYSALRMGYEAVQSLLDR 201


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target314 cation diffusion facilitator family transporter, putati
3h90_A_1-202202 Ferrous-iron efflux pump FIEF; membrane protein, z 100.0
3byp_A_94 CZRB protein; membrane protein, zinc transporter, 99.18
3h90_A_203-28381 Ferrous-iron efflux pump FIEF; membrane protein, z 99.15
2zzt_A_107 Putative uncharacterized protein; cation diffusion 99.12
3h90_A_1-202202 Ferrous-iron efflux pump FIEF; membrane protein, z 96.27
>3h90_A (A:1-202) Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_A Back     alignment and structure
Probab=100.00  E-value=2.1e-37  Score=248.73  Aligned_cols=201  Identities=18%  Similarity=0.175  Sum_probs=189.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCHHHHHH
Q ss_conf             88999999999999999999999998379999999999999999999999999982000012037896437520456899
Q gi|254780494|r   11 EESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEP   90 (314)
Q Consensus        11 e~~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G~~r~E~   90 (314)
                      |||.+++++..|+.+++.|+.+|+++||.++++|++||+.|+.+.++++++.++        ++||||++|||||+|.|+
T Consensus         2 ~~r~~~i~l~~~~~~~v~~~~~g~~t~S~allada~~sl~d~~~~~~~l~~~~~--------~~k~~~~~~pyG~~r~E~   73 (202)
T 3h90_A            2 VSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRY--------SLQPADDNHSFGHGKAES   73 (202)
T ss_dssp             CCTHHHHHHHHHHTTHHHHHHSSCSSSSSCCCSTTTHHHHHHHHHHHHHHHHHH--------HTCCCCSSCSSCSTTHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HCCCCCCCCCCCHHHHHH
T ss_conf             878999999999999999999999980899999999999999999999999998--------279998889960666407


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999851479876511799999999998668899876410357779999999875788742
Q gi|254780494|r   91 MVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYL  170 (314)
Q Consensus        91 l~~l~~~~~l~~~~~~i~~~si~~l~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~~~~~s~~l~~~~~~~~~D~~~  170 (314)
                      +++++.++++++.++++.+++++++++|++++.....+...+++.+++...++..++.+++.+|...+++..+++.|.+.
T Consensus        74 l~~~~~~~~l~~~~~~~~~~ai~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~d~l~  153 (202)
T 3h90_A           74 LAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMM  153 (202)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTSSSSCCCCCCCCCTHHHHHHHHHHHHHHHHHHHHHHHSCCHHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCHHH
T ss_conf             98877899899999999999999984357666776542002333234799999987630345776676423454133212


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             135799999999830134442046799899999999999988999999999995309
Q gi|254780494|r  171 LLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMT  227 (314)
Q Consensus       171 s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~~~~~~~~~~~~Ll~~~  227 (314)
                      |.++++++++.++        +.+|+||++++++++++++.+++++|++.++|+|.+
T Consensus       154 s~~vii~~l~~~~--------~~~~~D~i~~iii~~~i~~~~~~~~~~s~~~Ll~~a  202 (202)
T 3h90_A          154 NGAILLALGLSWY--------GWHRADALFALGIGIYILYSALRMGYEAVQSLLDRA  202 (202)
T ss_dssp             CSCSCSSSCSCST--------TSCCSTHHHHHHHHHHHHHHHHHHHHHHHHHHTTCC
T ss_pred             HHHHHHHHHHHHH--------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             3388999999994--------816675898999999999999999999977653677



>3byp_A (A:) CZRB protein; membrane protein, zinc transporter, transport protein; 1.70A {Thermus thermophilus} Back     alignment and structure
>3h90_A (A:203-283) Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_A Back     alignment and structure
>2zzt_A (A:) Putative uncharacterized protein; cation diffusion facilitator (CDF), transporter, zinc, membrane protein, cytosolic domain; 2.84A {Thermotoga maritima} Back     alignment and structure
>3h90_A (A:1-202) Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_A Back     alignment and structure