254780500

254780500

hypothetical protein CLIBASIA_01935

GeneID in NCBI database:8209495Locus tag:CLIBASIA_01935
Protein GI in NCBI database:254780500Protein Accession:YP_003064913.1
Gene range:-(777962, 778441)Protein Length:159aa
Gene description:hypothetical protein
COG prediction:[J] Small protein A (tmRNA-binding)
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MKKILFLNNFFFGKLSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVVSSVSMERLPNRRFNPNPHTIPAPIQTADGFLRRLLNPNGRSA
ccEEEEEccccHHHHHccHHHHHHHHHHHHHccccccccccccccHHHHHHccccccHHHHHHHHcccccEEEEcccccccEEEEEEEEEEcccccccccEEEEEEEEEEEcccccEEHHHHcccccccEEEccccccccccccHHHHHHHHHcccccc
ccEEEEEccHHHcHccHHHHHHHHHHHHHHHHHEEEccccccEEcHHHHHcccccccHHHHHHHccccccccccccccccEEEHEHHHHHHHHHHHcccHHEHHHHHEEEcccccEEEEEEEEEcccccccccccccccccccccHHHHHHcccccccc
mkkilflnnfffgklsfNKALFIIVIGLVVDYHVSygsisgaslDMSAISLVSqgssrshvieslgspsfsilhngnrsqsFYYVSqkkkwfpvkflspKIMEYIVLKITFGEKGVVSSvsmerlpnrrfnpnphtipapiqTADGFLRRLLNPNGRSA
MKKILFLNNFFFGKLSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVVSSVSMERLPNrrfnpnphtipapiqtadGFLRRLLNPNGRSA
MKKILFLNNFFFGKLSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVVSSVSMERLPNRRFNPNPHTIPAPIQTADGFLRRLLNPNGRSA
********NFFFGKLSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISL*S***SRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVVSSVSMERLPNRRFNPNPHTIPAPIQTADGFLRRLLNPN****
MKKILFLNNFFFGKLSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISL*********VIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVVSSVSMERLPNRRFNPNPHTIPAPIQTADGFLRRLLNPNGRSA
MKKILFLNNFFFGKLSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISLVSQGSSRSHV*ESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVVSSVSMERLPNRRFNPNPHTIPAPIQTADGFLRRLLN******
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKILFLNNFFFGKLSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVVSSVSMERLPNRRFNPNPHTIPAPIQTADGFLRRLLNPNGRSA
MKKILFLNNFFFGKLSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVVSSVSMERLPNRRFNPNPHTIPAPIQTADGFLRRLLNPNGRSA
MKKILFLNNFFFGKLSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVVSSVSMERLPNRRFNPNPHTIPAPIQTADGFLRRLLNPNGRSA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target159 hypothetical protein CLIBASIA_01935 [Candidatus Liberib
315122313166 hypothetical protein CKC_02825 [Candidatus Liberibacter 1 2e-32
227821541168 putative outer membrane protein [Sinorhizobium fredii N 1 5e-08
15964972168 hypothetical protein SMc01781 [Sinorhizobium meliloti 1 1 1e-07
150396049168 SmpA/OmlA domain-containing protein [Sinorhizobium medi 1 2e-07
319784149170 SmpA/OmlA domain-containing protein [Mesorhizobium cice 1 1e-06
222085518169 hypothetical protein Arad_1765 [Agrobacterium radiobact 1 3e-06
239831598171 SmpA/OmlA domain-containing protein [Ochrobactrum inter 1 7e-06
260460939171 SmpA/OmlA domain protein [Mesorhizobium opportunistum W 1 8e-06
153009850174 SmpA/OmlA domain-containing protein [Ochrobactrum anthr 1 1e-05
265983875172 SmpA/OmlA domain-containing protein [Brucella sp. 83/13 1 1e-05
>gi|315122313|ref|YP_004062802.1| hypothetical protein CKC_02825 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 166 Back     alignment and organism information
 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 101/160 (63%), Gaps = 6/160 (3%)

Query: 4   ILFLNNFFFGKLSFNKALFIIVIGLVV--DYHVSYG---SISGASLDMSAISLVSQGSSR 58
           +L LNNF F  L  NK + I ++  +   + HVS+G   S+ G  LD + +SL+ + SSR
Sbjct: 1   MLLLNNFLFKHLFLNKVILIALLLTISMGNLHVSHGEDNSVGGVVLDQALLSLIHRQSSR 60

Query: 59  SHVIESLGSPSFSILHNGNRS-QSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVV 117
            HVI++LGSPSF+I    N   QSFYYVSQKKK FP  FL P I    VLKI FG++G+V
Sbjct: 61  EHVIQTLGSPSFTIFDPHNYGMQSFYYVSQKKKIFPFHFLRPTITNRTVLKIVFGKEGLV 120

Query: 118 SSVSMERLPNRRFNPNPHTIPAPIQTADGFLRRLLNPNGR 157
           S +S++ L +RRFNPN H    PI     F  RLLNP+ +
Sbjct: 121 SKISIQSLKDRRFNPNQHETTVPITKESDFFDRLLNPDKK 160


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821541|ref|YP_002825511.1| putative outer membrane protein [Sinorhizobium fredii NGR234] Length = 168 Back     alignment and organism information
>gi|15964972|ref|NP_385325.1| hypothetical protein SMc01781 [Sinorhizobium meliloti 1021] Length = 168 Back     alignment and organism information
>gi|150396049|ref|YP_001326516.1| SmpA/OmlA domain-containing protein [Sinorhizobium medicae WSM419] Length = 168 Back     alignment and organism information
>gi|319784149|ref|YP_004143625.1| SmpA/OmlA domain-containing protein [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 170 Back     alignment and organism information
>gi|222085518|ref|YP_002544048.1| hypothetical protein Arad_1765 [Agrobacterium radiobacter K84] Length = 169 Back     alignment and organism information
>gi|239831598|ref|ZP_04679927.1| SmpA/OmlA domain-containing protein [Ochrobactrum intermedium LMG 3301] Length = 171 Back     alignment and organism information
>gi|260460939|ref|ZP_05809189.1| SmpA/OmlA domain protein [Mesorhizobium opportunistum WSM2075] Length = 171 Back     alignment and organism information
>gi|153009850|ref|YP_001371065.1| SmpA/OmlA domain-containing protein [Ochrobactrum anthropi ATCC 49188] Length = 174 Back     alignment and organism information
>gi|265983875|ref|ZP_06096610.1| SmpA/OmlA domain-containing protein [Brucella sp. 83/13] Length = 172 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target159 hypothetical protein CLIBASIA_01935 [Candidatus Liberib
pfam0435571 pfam04355, SmpA_OmlA, SmpA / OmlA family 1e-04
COG2913147 COG2913, SmpA, Small protein A (tmRNA-binding) [Transla 2e-06
>gnl|CDD|146803 pfam04355, SmpA_OmlA, SmpA / OmlA family Back     alignment and domain information
>gnl|CDD|32737 COG2913, SmpA, Small protein A (tmRNA-binding) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 159 hypothetical protein CLIBASIA_01935 [Candidatus Liberib
COG2913147 OlmA Outer membrane lipoprotein OmlA (small protein A) 99.91
PRK11548113 hypothetical protein; Provisional 99.76
pfam0435571 SmpA_OmlA SmpA / OmlA family. Lipoprotein Bacterial out 99.62
PRK11251109 DNA-binding transcriptional activator OsmE; Provisional 97.48
pfam11399102 DUF3192 Protein of unknown function (DUF3192). Some mem 93.72
>COG2913 OlmA Outer membrane lipoprotein OmlA (small protein A) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11548 hypothetical protein; Provisional Back     alignment and domain information
>pfam04355 SmpA_OmlA SmpA / OmlA family Back     alignment and domain information
>PRK11251 DNA-binding transcriptional activator OsmE; Provisional Back     alignment and domain information
>pfam11399 DUF3192 Protein of unknown function (DUF3192) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target159 hypothetical protein CLIBASIA_01935 [Candidatus Liberib
2kxx_A97 Nmr Structure Of Escherichia Coli Bame, A Lipoprote 2e-07
2km7_A102 Solution Structure Of Bame, A Component Of The Oute 2e-07
2pxg_A118 Nmr Solution Structure Of Omla Length = 118 4e-05
>gi|317454991|pdb|2KXX|A Chain A, Nmr Structure Of Escherichia Coli Bame, A Lipoprotein Component Of The Beta-Barrel Assembly Machinery Complex Length = 97 Back     alignment and structure
 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 30/86 (34%), Gaps = 10/86 (11%)

Query: 37  GSISGASLDMSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKF 96
               G  L  + +S +  G ++  V  +LG+P  S     N     +      +      
Sbjct: 15  DINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEG----- 69

Query: 97  LSPKIMEYIVLKITFGEKGVVSSVSM 122
                +    L +TF   GV++++  
Sbjct: 70  -----VTQQTLTLTFNSSGVLTNIDN 90


>gi|321159573|pdb|2KM7|A Chain A, Solution Structure Of Bame, A Component Of The Outer Membrane Protein Assembly Machinery In Escherichia Coli Length = 102 Back     alignment and structure
>gi|166235374|pdb|2PXG|A Chain A, Nmr Solution Structure Of Omla Length = 118 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target159 hypothetical protein CLIBASIA_01935 [Candidatus Liberib
2pxg_A118 Outer membrane protein; two layer alpha/beta plait, two 2e-04
>2pxg_A Outer membrane protein; two layer alpha/beta plait, two layer sandwich architecture; NMR {Xanthomonas axonopodis PV} Length = 118 Back     alignment and structure
 Score = 40.2 bits (94), Expect = 2e-04
 Identities = 17/87 (19%), Positives = 30/87 (34%), Gaps = 10/87 (11%)

Query: 41  GASLDMSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPK 100
           G  +  +A+  +  G S+  V   LG+PS     +  R   + Y S ++           
Sbjct: 15  GNLIKQNAVEQLQVGQSKQQVSALLGTPSIPDPFHAQR---WDYTSTQRV------DRLA 65

Query: 101 IMEYIVLKITFGEKGVVSSVSMERLPN 127
             E     + F E   V     +  P+
Sbjct: 66  RTEIKNFTVFF-ENEQVVRWEGDYFPS 91


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target159 hypothetical protein CLIBASIA_01935 [Candidatus Liberib
2pxg_A118 Outer membrane protein; two layer alpha/beta plait, two 99.66
2g2u_B165 BLIP, beta-lactamase inhibitory protein; protein-protei 93.78
3gmv_X156 Beta-lactamase inhibitory protein BLIP-I; 2-layer alpha 93.62
3gmv_X156 Beta-lactamase inhibitory protein BLIP-I; 2-layer alpha 92.4
3gmx_B154 BLP; 2-layer alpha/beta sandwich, protein binding; 1.05 94.7
3d4e_A179 Putative beta-lactamase inhibitor protein; NP_721579.1, 93.36
>2pxg_A Outer membrane protein; two layer alpha/beta plait, two layer sandwich architecture; NMR {Xanthomonas axonopodis PV} Back     alignment and structure
Probab=99.66  E-value=2.1e-16  Score=117.92  Aligned_cols=87  Identities=18%  Similarity=0.183  Sum_probs=68.1

Q ss_pred             HCCCCC---CCEECCCCCCHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCCCCCCEEEEEEEEEECCCHHCCCCEEEEEEE
Q ss_conf             435554---21013500387888640489999999998378521224467753048887210000000101211113578
Q gi|254780500|r   30 VDYHVS---YGSISGASLDMSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIV  106 (159)
Q Consensus        30 ~~~c~~---~~~~~G~~id~~~i~~i~~g~tk~~V~~~LG~Ps~~~~f~~n~~~~~YYi~~k~~~~~~af~~pkvier~V  106 (159)
                      |++|..   ....|||+++++++++|++||||+||.++||+|++.++|++|+|   ||+.+...      ..++++++++
T Consensus         1 L~gC~~iYk~~v~QGn~i~~~~l~~L~~Gmtk~QV~~lLGtP~~~~~f~~~~W---~Yi~~~~~------~~~~~~e~~~   71 (118)
T 2pxg_A            1 MAGSGIIYKQPIYQGNLIKQNAVEQLQVGQSKQQVSALLGTPSIPDPFHAQRW---DYTSTQRV------DRLARTEIKN   71 (118)
T ss_dssp             CCCCCCCCCCCCCTTSTTTSSSTTTTCCCSCHHHHHHHHTSCCCCCTTTCCCE---EEEEEETT------CSSSSCEEEE
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCCCCE---EEEEEEEC------CCCCEEEEEE
T ss_conf             97546400466676673899999861489999999998589864488678707---99999975------9986368999


Q ss_pred             EEEEECCCCCEEEEEECCCC
Q ss_conf             99999899868432110434
Q gi|254780500|r  107 LKITFGEKGVVSSVSMERLP  126 (159)
Q Consensus       107 l~I~FD~~g~V~nI~~~~L~  126 (159)
                      ++|+||++. |.+++-.-+.
T Consensus        72 l~v~Fd~~~-l~~i~gd~~p   90 (118)
T 2pxg_A           72 FTVFFENEQ-VVRWEGDYFP   90 (118)
T ss_dssp             EEEEESSSS-EEEEEECSSS
T ss_pred             EEEEECCCC-EEEEECCCCC
T ss_conf             999989997-9988888788



>2g2u_B BLIP, beta-lactamase inhibitory protein; protein-protein complex, SHV-1, hydrolase/hydrolase inhibitor complex; 1.60A {Streptomyces clavuligerus} SCOP: d.98.1.1 PDB: 1jtg_B 2b5r_C 2g2w_B 3e2k_C 3e2l_C* 3gmu_B 3c4p_B 3c7v_B 1s0w_C 3c7u_B 3c4o_B 1xxm_C Back     alignment and structure
>3gmv_X Beta-lactamase inhibitory protein BLIP-I; 2-layer alpha/beta sandwich, protein binding; HET: TAM; 1.80A {Streptomyces exfoliatus} PDB: 3gmw_B Back     alignment and structure
>3gmv_X Beta-lactamase inhibitory protein BLIP-I; 2-layer alpha/beta sandwich, protein binding; HET: TAM; 1.80A {Streptomyces exfoliatus} PDB: 3gmw_B Back     alignment and structure
>3gmx_B BLP; 2-layer alpha/beta sandwich, protein binding; 1.05A {Streptomyces clavuligerus} PDB: 3gmy_A Back     alignment and structure
>3d4e_A Putative beta-lactamase inhibitor protein; NP_721579.1, structural genomics, joint center for structural genomics, JCSG; 1.40A {Streptococcus mutans} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 159 hypothetical protein CLIBASIA_01935 [Candidatus Li
2pxg_A_118 (A:) Outer membrane protein; two layer alpha/beta 3e-06
>2pxg_A (A:) Outer membrane protein; two layer alpha/beta plait, two layer sandwich architecture; NMR {Xanthomonas axonopodis PV}Length = 118 Back     alignment and structure
 Score = 46.0 bits (109), Expect = 3e-06
 Identities = 16/90 (17%), Positives = 28/90 (31%), Gaps = 9/90 (10%)

Query: 41  GASLDMSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPK 100
           G  +  +A+  +  G S+  V   LG+PS     +  R   + Y S ++           
Sbjct: 15  GNLIKQNAVEQLQVGQSKQQVSALLGTPSIPDPFHAQR---WDYTSTQRV------DRLA 65

Query: 101 IMEYIVLKITFGEKGVVSSVSMERLPNRRF 130
             E     + F  + VV             
Sbjct: 66  RTEIKNFTVFFENEQVVRWEGDYFPSQDEQ 95


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target159 hypothetical protein CLIBASIA_01935 [Candidatus Liberib
2pxg_A_118 Outer membrane protein; two layer alpha/beta plait 99.78
3gmv_X_156 Beta-lactamase inhibitory protein BLIP-I; 2-layer 97.61
3gmv_X_156 Beta-lactamase inhibitory protein BLIP-I; 2-layer 96.03
3gmx_B_154 BLP; 2-layer alpha/beta sandwich, protein binding; 92.51
3d4e_A_179 Putative beta-lactamase inhibitor protein; NP_7215 97.73
3gmx_B_154 BLP; 2-layer alpha/beta sandwich, protein binding; 95.63
2g2u_B_165 BLIP, beta-lactamase inhibitory protein; protein-p 94.92
3d4e_A_179 Putative beta-lactamase inhibitor protein; NP_7215 93.07
>2pxg_A (A:) Outer membrane protein; two layer alpha/beta plait, two layer sandwich architecture; NMR {Xanthomonas axonopodis PV} Back     alignment and structure
Probab=99.78  E-value=2.1e-19  Score=136.84  Aligned_cols=108  Identities=16%  Similarity=0.090  Sum_probs=90.8

Q ss_pred             HCCCCCC---CEECCCCCCHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCCCCCCEEEEEEEEEECCCHHCCCCEEEEEEE
Q ss_conf             4355542---1013500387888640489999999998378521224467753048887210000000101211113578
Q gi|254780500|r   30 VDYHVSY---GSISGASLDMSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIV  106 (159)
Q Consensus        30 ~~~c~~~---~~~~G~~id~~~i~~i~~g~tk~~V~~~LG~Ps~~~~f~~n~~~~~YYi~~k~~~~~~af~~pkvier~V  106 (159)
                      |++|...   ...|||.++++++++|++||||+||..+||+|++.+.|++++   |||+.+...      ..+++.++++
T Consensus         1 Ls~Cs~~y~~~~~qG~~~~~~~l~~i~~Gmtk~qV~~lLGtP~~~~~f~~~~---W~Yv~~~~~------~~~~~~~~~~   71 (118)
T 2pxg_A            1 MAGSGIIYKQPIYQGNLIKQNAVEQLQVGQSKQQVSALLGTPSIPDPFHAQR---WDYTSTQRV------DRLARTEIKN   71 (118)
T ss_dssp             CCCCCCCCCCCCCTTSTTTSSSTTTTCCCSCHHHHHHHHTSCCCCCTTTCCC---EEEEEEETT------CSSSSCEEEE
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCHHHHHHHHCCCCCCCCCCCCE---EEEEEEEEC------CCCCEEEEEE
T ss_conf             9755650146567677489999976058999999999848986337757861---799999964------8985258999


Q ss_pred             EEEEECCCCCEEEEEECCCCCCCEECCCCCCCCCCCCHHH
Q ss_conf             9999989986843211043456140345415888852243
Q gi|254780500|r  107 LKITFGEKGVVSSVSMERLPNRRFNPNPHTIPAPIQTADG  146 (159)
Q Consensus       107 l~I~FD~~g~V~nI~~~~L~dg~~~~~~~~~~~~~~~~~~  146 (159)
                      ++|+||++++|+....+.+++++.++..++.|..+.....
T Consensus        72 i~v~Fd~~~~v~~~~~~~~~~~~~i~~~~~~tp~~~~~~~  111 (118)
T 2pxg_A           72 FTVFFENEQVVRWEGDYFPSQDEQLAKAAPKQFGRNLARD  111 (118)
T ss_dssp             EEEEESSSSEEEEEECSSSCCCCCSSCSSCCCCSCCCSCC
T ss_pred             EEEEECCCCEEEEECCCCCCCHHHHHHCCHHHHHCCCCHH
T ss_conf             9999899989988788788712443011402210214123



>3gmv_X (X:) Beta-lactamase inhibitory protein BLIP-I; 2-layer alpha/beta sandwich, protein binding; HET: TAM; 1.80A {Streptomyces exfoliatus} PDB: 3gmw_B Back     alignment and structure
>3gmv_X (X:) Beta-lactamase inhibitory protein BLIP-I; 2-layer alpha/beta sandwich, protein binding; HET: TAM; 1.80A {Streptomyces exfoliatus} PDB: 3gmw_B Back     alignment and structure
>3gmx_B (B:) BLP; 2-layer alpha/beta sandwich, protein binding; 1.05A {Streptomyces clavuligerus} PDB: 3gmy_A Back     alignment and structure
>3d4e_A (A:) Putative beta-lactamase inhibitor protein; NP_721579.1, structural genomics, joint center for structural genomics, JCSG; 1.40A {Streptococcus mutans} Back     alignment and structure
>3gmx_B (B:) BLP; 2-layer alpha/beta sandwich, protein binding; 1.05A {Streptomyces clavuligerus} PDB: 3gmy_A Back     alignment and structure
>2g2u_B (B:) BLIP, beta-lactamase inhibitory protein; protein-protein complex, SHV-1, hydrolase/hydrolase inhibitor complex; 1.60A {Streptomyces clavuligerus} Back     alignment and structure
>3d4e_A (A:) Putative beta-lactamase inhibitor protein; NP_721579.1, structural genomics, joint center for structural genomics, JCSG; 1.40A {Streptococcus mutans} Back     alignment and structure