254780499

254780499

hypothetical protein CLIBASIA_01930

GeneID in NCBI database:8209494Locus tag:CLIBASIA_01930
Protein GI in NCBI database:254780499Protein Accession:YP_003064912.1
Gene range:+(778647, 779150)Protein Length:167aa
Gene description:hypothetical protein
COG prediction:[J] Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit (PET112 homolog)
KEGG prediction:hypothetical protein
SEED prediction:Functional role page for Conserved hypothetical protein, gene in Ubiquinol-cytochrome C chaperone locus
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
MRNHSNYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCADVKLSVWKKVGVRMSGNLYATIIQSCVITLEPLLSEVEDTLGCIFVPSSSKFLYPNGDTSGKKNVVVIREPDILPFSEDGVIDIGAVIADFTAIAINPYPKKEGITFSNIYDTDQLKN
cccccccEEEEEHHHccccccEEEEEccHHHHHHHHHHcccccHHEEEEEEEEEEcccccEEEEEEEEEEEEccEEEEEccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccc
ccccccccEEEEEccccccccEEEEcccHHHHHHHHHHcccccHccEEEEEEEcccccccEEEEEEEEEEEEEEEEEEcccccccccccEEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccEccccccccHccc
mrnhsnysypvsvqavfstpmnlklkadSLDCKKLAEQLGVMSVESWCADVKLSVWKKVGVRMSGNLYATIIQSCVITLEpllsevedtlgcifvpssskflypngdtsgkknvvvirepdilpfsedgvidIGAVIADFtaiainpypkkegitfsniydtdqlkn
mrnhsnysypvsVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCADVKLSVWKKVGVRMSGNLYATIIQSCVITLEPLLSEVEDTLGCIFVpssskflypngdtsgkknVVVIREPDILPFSEDGVIDIGAVIADFTAIAinpypkkegitfsniydtdqlkn
MRNHSNYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCADVKLSVWKKVGVRMSGNLYATIIQSCVITLEPLLSEVEDTLGCIFVPSSSKFLYPNGDTSGKKNVVVIREPDILPFSEDGVIDIGAVIADFTAIAINPYPKKEGITFSNIYDTDQLKN
*****NY***VSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCADVKLSVWKKVGVRMSGNLYATIIQSCVITLEPLLSEVEDTLGCIFVPSS******************IREPDILPFSEDGVIDIGAVIADFTAIAINPYPKKEGIT************
********YPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCADVKLSVWKKVGVRMSGNLYATIIQSCVITLEPLLSEVEDTLGCIFVPSSSKFLYPNGDTSGKKNVVVIREPDILPFSEDGVIDIGAVIADFTAIAINPYPKKEGITFSNIYDTDQLKN
****SNYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCADVKLSVWKKVGVRMSGNLYATIIQSCVITLEPLLSEVEDTLGCIFVPSSS************KNVVVIREPDILPFSEDGVIDIGAVIADFTAIAINPYPKKEG**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRNHSNYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCADVKLSVWKKVGVRMSGNLYATIIQSCVITLEPLLSEVEDTLGCIFVPSSSKFLYPNGDTSGKKNVVVIREPDILPFSEDGVIDIGAVIADFTAIAINPYPKKEGITFSNIYDTDQLKN
MRNHSNYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCADVKLSVWKKVGVRMSGNLYATIIQSCVITLEPLLSEVEDTLGCIFVPSSSKFLYPNGDTSGKKNVVVIREPDILPFSEDGVIDIGAVIADFTAIAINPYPKKEGITFSNIYDTDQLKN
MRNHSNYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCADVKLSVWKKVGVRMSGNLYATIIQSCVITLEPLLSEVEDTLGCIFVPSSSKFLYPNGDTSGKKNVVVIREPDILPFSEDGVIDIGAVIADFTAIAINPYPKKEGITFSNIYDTDQLKN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target167 hypothetical protein CLIBASIA_01930 [Candidatus Liberib
315122314162 hypothetical protein CKC_02830 [Candidatus Liberibacter 1 6e-58
218671995184 hypothetical protein RetlG_10270 [Rhizobium etli GR56] 1 3e-26
218682068184 hypothetical protein RetlC8_24540 [Rhizobium etli CIAT 1 4e-26
241204019184 hypothetical protein Rleg_1284 [Rhizobium leguminosarum 1 5e-26
116251403184 hypothetical protein RL1637 [Rhizobium leguminosarum bv 1 6e-26
190891215184 hypothetical protein RHECIAT_CH0001601 [Rhizobium etli 1 1e-25
86357168184 hypothetical protein RHE_CH01530 [Rhizobium etli CFN 42 1 2e-25
209548798184 hypothetical protein Rleg2_1195 [Rhizobium leguminosaru 1 3e-25
327189791184 hypothetical protein RHECNPAF_54003 [Rhizobium etli CNP 1 1e-24
150396051183 hypothetical protein Smed_0827 [Sinorhizobium medicae W 1 1e-23
>gi|315122314|ref|YP_004062803.1| hypothetical protein CKC_02830 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 162 Back     alignment and organism information
 Score =  226 bits (577), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 140/161 (86%), Gaps = 3/161 (1%)

Query: 3   NHSNYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCADVKLSVWKKVGVR 62
           +  N+SY VS+Q+V   P+N+K++A+ LDC+KLAE+  V+SV++ CADVKL  WKK G+R
Sbjct: 5   DGKNFSYCVSIQSV---PINMKIEANRLDCQKLAEEWDVLSVDNLCADVKLFSWKKGGIR 61

Query: 63  MSGNLYATIIQSCVITLEPLLSEVEDTLGCIFVPSSSKFLYPNGDTSGKKNVVVIREPDI 122
           +SG + ATI+Q+CVITL+PLL ++E++LGCIFVPSSSKFLYPNGDTSGKK+VV +RE DI
Sbjct: 62  LSGKVCATIVQACVITLDPLLLKIEESLGCIFVPSSSKFLYPNGDTSGKKSVVEVRELDI 121

Query: 123 LPFSEDGVIDIGAVIADFTAIAINPYPKKEGITFSNIYDTD 163
           LPFS+DG+IDIGAV+ADF A+AI+PYPKKEGI FS+IYD +
Sbjct: 122 LPFSKDGIIDIGAVVADFIAVAIDPYPKKEGILFSDIYDNN 162


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218671995|ref|ZP_03521664.1| hypothetical protein RetlG_10270 [Rhizobium etli GR56] Length = 184 Back     alignment and organism information
>gi|218682068|ref|ZP_03529669.1| hypothetical protein RetlC8_24540 [Rhizobium etli CIAT 894] Length = 184 Back     alignment and organism information
>gi|241204019|ref|YP_002975115.1| hypothetical protein Rleg_1284 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 184 Back     alignment and organism information
>gi|116251403|ref|YP_767241.1| hypothetical protein RL1637 [Rhizobium leguminosarum bv. viciae 3841] Length = 184 Back     alignment and organism information
>gi|190891215|ref|YP_001977757.1| hypothetical protein RHECIAT_CH0001601 [Rhizobium etli CIAT 652] Length = 184 Back     alignment and organism information
>gi|86357168|ref|YP_469060.1| hypothetical protein RHE_CH01530 [Rhizobium etli CFN 42] Length = 184 Back     alignment and organism information
>gi|209548798|ref|YP_002280715.1| hypothetical protein Rleg2_1195 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 184 Back     alignment and organism information
>gi|327189791|gb|EGE56932.1| hypothetical protein RHECNPAF_54003 [Rhizobium etli CNPAF512] Length = 184 Back     alignment and organism information
>gi|150396051|ref|YP_001326518.1| hypothetical protein Smed_0827 [Sinorhizobium medicae WSM419] Length = 183 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target167 hypothetical protein CLIBASIA_01930 [Candidatus Liberib
pfam02620118 pfam02620, DUF177, Uncharacterized ACR, COG1399 3e-04
>gnl|CDD|145656 pfam02620, DUF177, Uncharacterized ACR, COG1399 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 167 hypothetical protein CLIBASIA_01930 [Candidatus Liberib
PRK11193173 hypothetical protein; Provisional 99.81
COG1399176 Predicted metal-binding, possibly nucleic acid-binding 99.62
pfam02620118 DUF177 Uncharacterized ACR, COG1399. 99.65
>PRK11193 hypothetical protein; Provisional Back     alignment and domain information
>COG1399 Predicted metal-binding, possibly nucleic acid-binding protein [General function prediction only] Back     alignment and domain information
>pfam02620 DUF177 Uncharacterized ACR, COG1399 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00