254780502

254780502

ribonucleotide-diphosphate reductase subunit alpha

GeneID in NCBI database:8209497Locus tag:CLIBASIA_01945
Protein GI in NCBI database:254780502Protein Accession:YP_003064915.1
Gene range:-(775016, 777880)Protein Length:954aa
Gene description:ribonucleotide-diphosphate reductase subunit alpha
COG prediction:[F] Ribonucleotide reductase, alpha subunit
KEGG prediction:ribonucleotide-diphosphate reductase subunit alpha (EC:1.17.4.1); K00525 ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
SEED prediction:Ribonucleotide reductase of class Ia (aerobic), alpha subunit (EC 1.17.4.1)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Pyrimidine metabolism [PATH:las00240]
Subsystem involved in SEED:Ribonucleotide reduction
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950----
MHPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ
cccccccccccccccHHHHHccccccccEEEEEcccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHcccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHcccEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHcccccEEEccccccHHHHccHHHHHHHHHHHHHHcccccccEEEEEEHHHHHHHHHHHHHHcccccEEEEccccccccccccccEEEEccccccccccccccEEEEEHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccEEEEHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHHcccccccHHHHHHcccccccccccHHEEEEEEcccccEEEcHHHHHHHHHcccccHHHHHHHHHccccccccccccHHHHHHcccHHcccHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEccccccccHHHHcccccccHHcccccccccccccccccccccccccccccc
cccccccccHccccHHHHccccccccccEEEEEEcccEEcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEHHHHHHHHHHHHHHcccHHHHHHHEEcHHHHHHHHHHHHHHHHHHcccccEEEEEEcccEEcccHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccccccccHHHHHccHHHHHHHHcccHcccccccccccHHHHHHHHccccEEccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccHcccccccccccccEEEcccccHHHHHHHHHHHHHHHHcccccccccccccccccEEccccccccccEEEEEEEcccEEEEccccccccEEEEEEcccHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHHHHHHHccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHHHHHHccccEEEEEccccccccccccEEEEEcccHHHHHEccccccEEEEEHHHEccHHHHccccccHHHHHHHHHHHHHHHHHHEcccccccHHHHHHcccccccEHcHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHcHHHcccEEEcccccccHHHHHHHHHHcccccccEEEccccccHHHHcccccccccccccEEEEEccccEEEEEcHHHHHHHHHcccccHHHHHHHHHccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHcHEEEccccccHHHHHHHHHHHccccEEEEEEcccccccHHHccccccccHccccccccccccccccccccccccccHHHcc
mhpskdvnkgdedafpslaypfpekikgVQVIkrnggvtsfdpsKISRAIMKAFMAVEgkgasrsiRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSlmqsghhkitrEYVLYREERSDvraaqshsksdapiapklkimmddgtlisFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRtliekepnYAKVTARFLLEKLRREVLTTVykkpqkathhemqclyPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFlhingsriempQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFhfmcstptlfnsgtrhpqlsscflttvpdDLYGIFGALQENAMLAKYsgglgndwtpvrglgahihgtngksqgviPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRkntgddrrrthdmntanwipdLFMKRVtqnagwtlfspdevsdlhdlYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFEtghpwitfkdpcnirspqqhvgvvhssnlcteitlnsssEETAVCNLGSINLLAHfannqfdydKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHllhipyaspeaveiADESMEFISFHAISASVELAQERgayssfkgslwdqgvfpidsiGLLAEVRDELAmnrtsrlpwdeLKKRVKTIGmrnsncmaiaptaTIANIcgvsqsidpsyqnlyvksnmsgdftVVNSFLVNELKQRDLWDEAMISDlkyhdgsignieriPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLnlyldepsgkklDFIYRQAWLMGLKTTYYlrsrsatsvekstlkgvdgklnavpvtdpnssthslgipssctsdtecevcq
mhpskdvnkgdedafpslaYPFPEKIKGVQVIKrnggvtsfdpskiSRAIMKAFMAVegkgasrsiRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDvraaqshsksdapiapklkiMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSrtliekepnyaKVTARFLLEKLRREVLTTvykkpqkathhemQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLrkntgddrrrthdmntanwipdlfMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYerqadrgeikVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELamnrtsrlpwdelkKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLnlyldepsgkKLDFIYRQAWLMGLKTTYYLRSRSatsvekstlkgvdgklnavpvtdpnssthslgipssctsdtecevcq
MHPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ
**************************KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEG**********DIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE*********************KIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK***************************TSDTECEVCQ
**********DEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREE*************DAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIP*************
*HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK******************************TEC**C*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ
MHPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ
MHPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target954 ribonucleotide-diphosphate reductase subunit alpha [Can
315122311934 ribonucleotide-diphosphate reductase subunit alpha [Can 1 0.0
110635037954 ribonucleotide-diphosphate reductase subunit alpha [Mes 1 0.0
209885873969 ribonucleoside-diphosphate reductase alpha subunit [Oli 1 0.0
90425008960 ribonucleotide-diphosphate reductase subunit alpha [Rho 1 0.0
75677069969 ribonucleotide-diphosphate reductase subunit alpha [Nit 1 0.0
299134881967 ribonucleoside-diphosphate reductase, alpha subunit [Af 1 0.0
85714831956 ribonucleotide-diphosphate reductase alpha subunit [Nit 1 0.0
300022336956 ribonucleoside-diphosphate reductase, subunit alpha [Hy 1 0.0
92119122966 ribonucleotide-diphosphate reductase subunit alpha [Nit 1 0.0
192291020974 ribonucleotide-diphosphate reductase subunit alpha [Rho 1 0.0
>gi|315122311|ref|YP_004062800.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 934 Back     alignment and organism information
 Score = 1511 bits (3912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/937 (75%), Positives = 812/937 (86%), Gaps = 3/937 (0%)

Query: 18  LAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTE 77
           + YPFPEK+KG++VI+RNG  T FDPSKIS AIMKAF+AVEGK AS S RV++I+  LTE
Sbjct: 1   MTYPFPEKVKGIKVIRRNGKTTPFDPSKISWAIMKAFIAVEGKSASSSSRVRNIVNVLTE 60

Query: 78  QTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKS 137
           +TV +LL    S LI+HIE IQDQVE SLM++ HHK+ REYVLYREERS +R A++HSKS
Sbjct: 61  ETVLKLLHEYSSNLIIHIEAIQDQVEASLMRNDHHKVAREYVLYREERSGIRTAKAHSKS 120

Query: 138 DAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESD 197
           D P    LKI MDD T +  +SKRL+MI+EE+C+GLQDVS +++LSET KNMYDG+SE +
Sbjct: 121 DTP---HLKIRMDDDTFVPLDSKRLKMIIEESCAGLQDVSLELILSETIKNMYDGMSEVE 177

Query: 198 LETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFC 257
           LE AL+F+SR LIE+EPNYAKVT R LL+KLRREVLT +YK P+KATH EM  LY  YF 
Sbjct: 178 LELALVFASRALIEREPNYAKVTTRLLLDKLRREVLTAIYKTPKKATHQEMSNLYKNYFL 237

Query: 258 RYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMP 317
           +YIEEG+KA LL ESM +FDL YLAN LK +RD  FEYLGLQ LYDRYFLH++GSR EMP
Sbjct: 238 QYIEEGIKAHLLAESMKEFDLSYLANALKPDRDLMFEYLGLQTLYDRYFLHVDGSRFEMP 297

Query: 318 QAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVP 377
           QAFFMRVAMG+ALKE EKEKRAVEFYNL+SSFHFMCSTPTLFN+GTRHPQLSSCFLTTVP
Sbjct: 298 QAFFMRVAMGIALKEPEKEKRAVEFYNLISSFHFMCSTPTLFNAGTRHPQLSSCFLTTVP 357

Query: 378 DDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVA 437
           DDL  IF A+++NA+LAKYSGGLGNDWT VRGLG+HI GTNGKSQGVIPFLKVANDTAVA
Sbjct: 358 DDLGDIFEAIKDNALLAKYSGGLGNDWTSVRGLGSHIQGTNGKSQGVIPFLKVANDTAVA 417

Query: 438 VNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNA 497
           VNQGGKRKGAVCAYLETWHID+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKRV +N 
Sbjct: 418 VNQGGKRKGAVCAYLETWHIDIEEFLNLRKNTGDDRRRTHDMNTANWVPDLFMKRVEKNE 477

Query: 498 GWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETG 557
            WTLFSPDEV DLH LYG +FE AY NYE++A+RGEIK+FRKI+AV+LWRKMLTM+FETG
Sbjct: 478 QWTLFSPDEVGDLHHLYGHDFEKAYSNYEKKAERGEIKLFRKIAAVSLWRKMLTMVFETG 537

Query: 558 HPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFD 617
           HPWITFKDPCNIRSPQQHVG V  SNLCTEITLN S +E AVCNLGSINL AH   N  D
Sbjct: 538 HPWITFKDPCNIRSPQQHVGNVLCSNLCTEITLNISKDEVAVCNLGSINLAAHLTENGLD 597

Query: 618 YDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASP 677
           YDKLA+TI TAVR+LDNVID+N + I+KA+ SN  HR IGLGLMGFQSALH L IPY S 
Sbjct: 598 YDKLANTIHTAVRMLDNVIDVNRYAIKKAENSNRKHRPIGLGLMGFQSALHALRIPYESV 657

Query: 678 EAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELA 737
           EAV+ AD+SMEFISFHAISAS  LA+ERG YS+FKGSLW +G+ PIDS+ LL EVRD+  
Sbjct: 658 EAVDFADQSMEFISFHAISASTNLAEERGPYSTFKGSLWSKGILPIDSLQLLEEVRDKCE 717

Query: 738 MNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSG 797
           ++++SRL WD L++RVK++GMRNSNCMAIAPTATI+NICGVSQSI+PSYQNL+VKSNMSG
Sbjct: 718 IDKSSRLGWDVLRERVKSVGMRNSNCMAIAPTATISNICGVSQSIEPSYQNLFVKSNMSG 777

Query: 798 DFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLI 857
           DFT+VNS LVN+LK R LWDE MISDLK++DGSIGNIERIP+DLKK+HATAFEIDP+WLI
Sbjct: 778 DFTIVNSCLVNDLKARGLWDEVMISDLKHYDGSIGNIERIPEDLKKLHATAFEIDPIWLI 837

Query: 858 ESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           ++ASRRQKWIDQAQSLNLYL +PSGKKLDFIYRQ+WLMGLKTTYYLRSRSAT VEKSTLK
Sbjct: 838 KAASRRQKWIDQAQSLNLYLSDPSGKKLDFIYRQSWLMGLKTTYYLRSRSATHVEKSTLK 897

Query: 918 GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
            VDGKLN+VP+ D NSS       SSC S  ECEVCQ
Sbjct: 898 EVDGKLNSVPIMDHNSSELLSTPQSSCDSGVECEVCQ 934


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|110635037|ref|YP_675245.1| ribonucleotide-diphosphate reductase subunit alpha [Mesorhizobium sp. BNC1] Length = 954 Back     alignment and organism information
>gi|209885873|ref|YP_002289729.1| ribonucleoside-diphosphate reductase alpha subunit [Oligotropha carboxidovorans OM5] Length = 969 Back     alignment and organism information
>gi|90425008|ref|YP_533378.1| ribonucleotide-diphosphate reductase subunit alpha [Rhodopseudomonas palustris BisB18] Length = 960 Back     alignment and organism information
>gi|75677069|ref|YP_319490.1| ribonucleotide-diphosphate reductase subunit alpha [Nitrobacter winogradskyi Nb-255] Length = 969 Back     alignment and organism information
>gi|299134881|ref|ZP_07028073.1| ribonucleoside-diphosphate reductase, alpha subunit [Afipia sp. 1NLS2] Length = 967 Back     alignment and organism information
>gi|85714831|ref|ZP_01045817.1| ribonucleotide-diphosphate reductase alpha subunit [Nitrobacter sp. Nb-311A] Length = 956 Back     alignment and organism information
>gi|300022336|ref|YP_003754947.1| ribonucleoside-diphosphate reductase, subunit alpha [Hyphomicrobium denitrificans ATCC 51888] Length = 956 Back     alignment and organism information
>gi|92119122|ref|YP_578851.1| ribonucleotide-diphosphate reductase subunit alpha [Nitrobacter hamburgensis X14] Length = 966 Back     alignment and organism information
>gi|192291020|ref|YP_001991625.1| ribonucleotide-diphosphate reductase subunit alpha [Rhodopseudomonas palustris TIE-1] Length = 974 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target954 ribonucleotide-diphosphate reductase subunit alpha [Can
cd01679460 cd01679, RNR_I, Class I ribonucleotide reductase 0.0
TIGR02506617 TIGR02506, NrdE_NrdA, ribonucleoside-diphosphate reduct 0.0
TIGR02504586 TIGR02504, NrdJ_Z, ribonucleoside-diphosphate reductase 1e-106
PRK08665 752 PRK08665, PRK08665, ribonucleotide-diphosphate reductas 9e-86
PRK06406771 PRK06406, PRK06406, ribonucleotide-diphosphate reductas 1e-77
TIGR02510571 TIGR02510, NrdE-prime, ribonucleoside-diphosphate reduc 6e-60
PRK08188714 PRK08188, PRK08188, ribonucleotide-diphosphate reductas 5e-54
PRK06948595 PRK06948, PRK06948, ribonucleotide reductase-like prote 1e-27
PRK07207965 PRK07207, PRK07207, ribonucleotide-diphosphate reductas 0.0
PRK123651046 PRK12365, PRK12365, ribonucleotide-diphosphate reductas 0.0
PRK06539822 PRK06539, PRK06539, ribonucleotide-diphosphate reductas 0.0
PRK08447789 PRK08447, PRK08447, ribonucleotide-diphosphate reductas 1e-177
PRK07088764 PRK07088, PRK07088, ribonucleotide-diphosphate reductas 1e-129
PRK09209761 PRK09209, PRK09209, ribonucleotide-diphosphate reductas 1e-125
PHA02572753 PHA02572, nrdA, ribonucleoside-diphosphate reductase su 3e-85
PRK09103758 PRK09103, PRK09103, ribonucleotide-diphosphate reductas 3e-61
KOG1112796 KOG1112, KOG1112, KOG1112, Ribonucleotide reductase, al 1e-170
PLN02437813 PLN02437, PLN02437, ribonucleoside--diphosphate reducta 1e-168
COG0209651 COG0209, NrdA, Ribonucleotide reductase, alpha subunit 1e-162
PRK12364842 PRK12364, PRK12364, ribonucleotide-diphosphate reductas 1e-137
PRK09102601 PRK09102, PRK09102, ribonucleotide-diphosphate reductas 1e-115
cd02888464 cd02888, RNR_II_dimer, Class II ribonucleotide reductas 1e-87
PRK07187721 PRK07187, PRK07187, ribonucleotide-diphosphate reductas 4e-58
PRK07632699 PRK07632, PRK07632, ribonucleotide-diphosphate reductas 2e-54
PRK07306720 PRK07306, PRK07306, ribonucleotide-diphosphate reductas 4e-52
PRK06556 953 PRK06556, PRK06556, vitamin B12-dependent ribonucleotid 4e-23
pfam02867516 pfam02867, Ribonuc_red_lgC, Ribonucleotide reductase, b 0.0
PRK083321740 PRK08332, PRK08332, ribonucleotide-diphosphate reductas 1e-38
PRK08115858 PRK08115, PRK08115, ribonucleotide-diphosphate reductas 4e-33
PRK08270656 PRK08270, PRK08270, anaerobic ribonucleoside triphospha 5e-20
PRK07111735 PRK07111, PRK07111, anaerobic ribonucleoside triphospha 4e-17
PRK09263711 PRK09263, PRK09263, anaerobic ribonucleoside triphospha 5e-17
pfam0347789 pfam03477, ATP-cone, ATP cone domain 2e-13
PRK06406771 PRK06406, PRK06406, ribonucleotide-diphosphate reductas 4e-10
COG1328700 COG1328, NrdD, Oxygen-sensitive ribonucleoside-triphosp 8e-10
PRK08332 1740 PRK08332, PRK08332, ribonucleotide-diphosphate reductas 2e-09
pfam0031779 pfam00317, Ribonuc_red_lgN, Ribonucleotide reductase, a 1e-19
PRK12365 1046 PRK12365, PRK12365, ribonucleotide-diphosphate reductas 1e-12
PRK07562 1220 PRK07562, PRK07562, ribonucleotide-diphosphate reductas 1e-08
PRK08115858 PRK08115, PRK08115, ribonucleotide-diphosphate reductas 3e-08
cd00576401 cd00576, RNR_PFL, Ribonucleotide reductase and Pyruvate 1e-07
PRK08332 1740 PRK08332, PRK08332, ribonucleotide-diphosphate reductas 4e-07
PRK08332 1740 PRK08332, PRK08332, ribonucleotide-diphosphate reductas 1e-06
PRK07562 1220 PRK07562, PRK07562, ribonucleotide-diphosphate reductas 7e-06
TIGR02505713 TIGR02505, RTPR, ribonucleoside-triphosphate reductase, 0.002
>gnl|CDD|153088 cd01679, RNR_I, Class I ribonucleotide reductase Back     alignment and domain information
>gnl|CDD|162894 TIGR02506, NrdE_NrdA, ribonucleoside-diphosphate reductase, alpha subunit Back     alignment and domain information
>gnl|CDD|162892 TIGR02504, NrdJ_Z, ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent Back     alignment and domain information
>gnl|CDD|181531 PRK08665, PRK08665, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|180555 PRK06406, PRK06406, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|162895 TIGR02510, NrdE-prime, ribonucleoside-diphosphate reductase, alpha chain Back     alignment and domain information
>gnl|CDD|181278 PRK08188, PRK08188, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|180772 PRK06948, PRK06948, ribonucleotide reductase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|180884 PRK07207, PRK07207, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|171440 PRK12365, PRK12365, ribonucleotide-diphosphate reductase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|180610 PRK06539, PRK06539, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|181429 PRK08447, PRK08447, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|180831 PRK07088, PRK07088, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|181700 PRK09209, PRK09209, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|177401 PHA02572, nrdA, ribonucleoside-diphosphate reductase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|181649 PRK09103, PRK09103, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|36328 KOG1112, KOG1112, KOG1112, Ribonucleotide reductase, alpha subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178056 PLN02437, PLN02437, ribonucleoside--diphosphate reductase large subunit Back     alignment and domain information
>gnl|CDD|73173 COG0209, NrdA, Ribonucleotide reductase, alpha subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|183475 PRK12364, PRK12364, ribonucleotide-diphosphate reductase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|181648 PRK09102, PRK09102, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|153089 cd02888, RNR_II_dimer, Class II ribonucleotide reductase, dimeric form Back     alignment and domain information
>gnl|CDD|180867 PRK07187, PRK07187, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|181062 PRK07632, PRK07632, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|180921 PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|180621 PRK06556, PRK06556, vitamin B12-dependent ribonucleotide reductase; Validated Back     alignment and domain information
>gnl|CDD|145819 pfam02867, Ribonuc_red_lgC, Ribonucleotide reductase, barrel domain Back     alignment and domain information
>gnl|CDD|181392 PRK08332, PRK08332, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|181232 PRK08115, PRK08115, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|181341 PRK08270, PRK08270, anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|180846 PRK07111, PRK07111, anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|181736 PRK09263, PRK09263, anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|146230 pfam03477, ATP-cone, ATP cone domain Back     alignment and domain information
>gnl|CDD|180555 PRK06406, PRK06406, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|31519 COG1328, NrdD, Oxygen-sensitive ribonucleoside-triphosphate reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|181392 PRK08332, PRK08332, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|144053 pfam00317, Ribonuc_red_lgN, Ribonucleotide reductase, all-alpha domain Back     alignment and domain information
>gnl|CDD|171440 PRK12365, PRK12365, ribonucleotide-diphosphate reductase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|181031 PRK07562, PRK07562, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|181232 PRK08115, PRK08115, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|153083 cd00576, RNR_PFL, Ribonucleotide reductase and Pyruvate formate lyase Back     alignment and domain information
>gnl|CDD|181392 PRK08332, PRK08332, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|181392 PRK08332, PRK08332, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|181031 PRK07562, PRK07562, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|162893 TIGR02505, RTPR, ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 954 ribonucleotide-diphosphate reductase subunit alpha [Can
PRK07207964 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
PRK123651046 ribonucleotide-diphosphate reductase subunit alpha; Pro 100.0
PRK06406770 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
PRK12364842 ribonucleotide-diphosphate reductase subunit alpha; Pro 100.0
PRK06539822 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
KOG1112796 consensus 100.0
PRK08447788 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
PRK09209785 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
PRK09103761 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
PRK07088743 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
PRK08188714 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
PRK07187722 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
COG0209651 NrdA Ribonucleotide reductase, alpha subunit [Nucleotid 100.0
TIGR02506685 NrdE_NrdA ribonucleoside-diphosphate reductase, alpha s 100.0
PRK08665 733 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
TIGR02504792 NrdJ_Z ribonucleoside-diphosphate reductase, adenosylco 100.0
PRK06948602 hypothetical protein; Provisional 100.0
cd01679460 RNR_I Class I ribonucleotide reductase. Ribonucleotide 100.0
PRK08115857 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
PRK07562 1177 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
TIGR02510560 NrdE-prime ribonucleoside-diphosphate reductase, alpha 100.0
PRK09102600 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
PRK07632696 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
PRK07306720 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
pfam02867516 Ribonuc_red_lgC Ribonucleotide reductase, barrel domain 100.0
cd01676658 RNR_II_monomer Class II ribonucleotide reductase, monom 100.0
TIGR02505827 RTPR ribonucleoside-triphosphate reductase, adenosylcob 100.0
PRK083321748 ribonucleotide-diphosphate reductase subunit alpha; Val 100.0
cd02888464 RNR_II_dimer Class II ribonucleotide reductase, dimeric 100.0
PRK06556 957 vitamin B12-dependent ribonucleotide reductase; Validat 100.0
cd00576401 RNR_PFL Ribonucleotide reductase and Pyruvate formate l 100.0
PRK07111703 anaerobic ribonucleoside triphosphate reductase; Provis 100.0
PRK08270681 anaerobic ribonucleoside triphosphate reductase; Provis 99.97
PRK09263711 anaerobic ribonucleoside triphosphate reductase; Provis 99.97
pfam0347789 ATP-cone ATP cone domain. 99.77
LOAD_ATP_cone89 consensus 99.76
COG1328700 NrdD Oxygen-sensitive ribonucleoside-triphosphate reduc 99.45
PRK06539822 ribonucleotide-diphosphate reductase subunit alpha; Val 98.79
PRK08447788 ribonucleotide-diphosphate reductase subunit alpha; Val 98.33
PRK09103761 ribonucleotide-diphosphate reductase subunit alpha; Val 97.53
PRK00464149 nrdR transcriptional regulator NrdR; Validated 97.4
COG1327156 Predicted transcriptional regulator, consists of a Zn-r 96.6
PRK09209785 ribonucleotide-diphosphate reductase subunit alpha; Val 94.6
PRK12365 1046 ribonucleotide-diphosphate reductase subunit alpha; Pro 99.79
PRK12337492 2-phosphoglycerate kinase; Provisional 93.22
pfam0031779 Ribonuc_red_lgN Ribonucleotide reductase, all-alpha dom 99.72
PRK06406770 ribonucleotide-diphosphate reductase subunit alpha; Val 99.64
cd01675555 RNR_III Class III ribonucleotide reductase. Ribonucleot 98.64
TIGR02487655 NrdD anaerobic ribonucleoside-triphosphate reductase; I 97.04
COG1328700 NrdD Oxygen-sensitive ribonucleoside-triphosphate reduc 96.65
PRK09263711 anaerobic ribonucleoside triphosphate reductase; Provis 96.59
PRK08270681 anaerobic ribonucleoside triphosphate reductase; Provis 96.24
PRK10977510 hypothetical protein; Provisional 95.39
pfam11230487 DUF3029 Protein of unknown function (DUF3029). Some mem 91.86
pfam0347789 ATP-cone ATP cone domain. 98.47
LOAD_ATP_cone89 consensus 98.44
PRK00464149 nrdR transcriptional regulator NrdR; Validated 96.23
PRK12364842 ribonucleotide-diphosphate reductase subunit alpha; Pro 95.74
COG1327156 Predicted transcriptional regulator, consists of a Zn-r 94.77
PRK08332 1748 ribonucleotide-diphosphate reductase subunit alpha; Val 97.99
PRK08271625 anaerobic ribonucleoside triphosphate reductase; Provis 97.41
PRK08579623 anaerobic ribonucleoside triphosphate reductase; Provis 97.1
PRK07111703 anaerobic ribonucleoside triphosphate reductase; Provis 96.4
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 94.16
>PRK07207 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK12365 ribonucleotide-diphosphate reductase subunit alpha; Provisional Back     alignment and domain information
>PRK06406 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK12364 ribonucleotide-diphosphate reductase subunit alpha; Provisional Back     alignment and domain information
>PRK06539 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>KOG1112 consensus Back     alignment and domain information
>PRK08447 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK09209 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK09103 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07088 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08188 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07187 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>COG0209 NrdA Ribonucleotide reductase, alpha subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02506 NrdE_NrdA ribonucleoside-diphosphate reductase, alpha subunit; InterPro: IPR013346 This entry represents the alpha (large) chain of the class I ribonucleotide reductase (RNR) Back     alignment and domain information
>PRK08665 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>TIGR02504 NrdJ_Z ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent; InterPro: IPR013344 This entry represents a group of adenosylcobalamin (AdoCbl or coenzymeB12)-dependent ribonucleotide reductases (Class II RNRs) related to the characterised species from Pyrococcus , Thermoplasma , Corynebacterium and Deinococcus Back     alignment and domain information
>PRK06948 hypothetical protein; Provisional Back     alignment and domain information
>cd01679 RNR_I Class I ribonucleotide reductase Back     alignment and domain information
>PRK08115 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07562 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>TIGR02510 NrdE-prime ribonucleoside-diphosphate reductase, alpha chain; InterPro: IPR013350 Proteins in this entry represent a small clade of ribonucleoside-diphosphate reductase alpha chains which are sufficiently divergent from the usual Class I ribonucleotide reductase (RNR) alpha chains (NrdE or NrdA, IPR013346 from INTERPRO) to form a distinct group Back     alignment and domain information
>PRK09102 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07632 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07306 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>pfam02867 Ribonuc_red_lgC Ribonucleotide reductase, barrel domain Back     alignment and domain information
>cd01676 RNR_II_monomer Class II ribonucleotide reductase, monomeric form Back     alignment and domain information
>TIGR02505 RTPR ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent; InterPro: IPR013345 This entry represents a group of adenosylcobalamin (AdoCbl or coenzymeB12)-dependent ribonucleotide reductases (RNR) related to the characterised species from Lactococcus leichmannii Back     alignment and domain information
>PRK08332 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>cd02888 RNR_II_dimer Class II ribonucleotide reductase, dimeric form Back     alignment and domain information
>PRK06556 vitamin B12-dependent ribonucleotide reductase; Validated Back     alignment and domain information
>cd00576 RNR_PFL Ribonucleotide reductase and Pyruvate formate lyase Back     alignment and domain information
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK09263 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>pfam03477 ATP-cone ATP cone domain Back     alignment and domain information
>LOAD_ATP_cone consensus Back     alignment and domain information
>COG1328 NrdD Oxygen-sensitive ribonucleoside-triphosphate reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06539 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08447 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK09103 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription] Back     alignment and domain information
>PRK09209 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK12365 ribonucleotide-diphosphate reductase subunit alpha; Provisional Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>pfam00317 Ribonuc_red_lgN Ribonucleotide reductase, all-alpha domain Back     alignment and domain information
>PRK06406 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>cd01675 RNR_III Class III ribonucleotide reductase Back     alignment and domain information
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase; InterPro: IPR012833 This entry is found in the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase Back     alignment and domain information
>COG1328 NrdD Oxygen-sensitive ribonucleoside-triphosphate reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09263 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK10977 hypothetical protein; Provisional Back     alignment and domain information
>pfam11230 DUF3029 Protein of unknown function (DUF3029) Back     alignment and domain information
>pfam03477 ATP-cone ATP cone domain Back     alignment and domain information
>LOAD_ATP_cone consensus Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PRK12364 ribonucleotide-diphosphate reductase subunit alpha; Provisional Back     alignment and domain information
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription] Back     alignment and domain information
>PRK08332 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK08579 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target954 ribonucleotide-diphosphate reductase subunit alpha [Can
3hnc_A792 Crystal Structure Of Human Ribonucleotide Reductase 0.0
1zyz_A888 Structures Of Yeast Ribonucloetide Reductase I Leng 0.0
2wgh_A676 Human Ribonucleotide Reductase R1 Subunit (Rrm1) In 1e-174
1pem_A714 Ribonucleotide Reductase Protein R1e From Salmonell 2e-81
3r1r_A761 Ribonucleotide Reductase R1 Protein With Amppnp Occ 1e-122
1rlr_A761 Structure Of Ribonucleotide Reductase Protein R1 Le 1e-122
4r1r_A761 Ribonucleotide Reductase R1 Protein With Substrate, 1e-122
6r1r_A761 Ribonucleotide Reductase E441d Mutant R1 Protein Fr 1e-122
5r1r_A761 Ribonucleotide Reductase E441a Mutant R1 Protein Fr 1e-122
7r1r_A761 Ribonucleotide Reductase E441q Mutant R1 Protein Fr 1e-122
1r1r_A761 Ribonucleotide Reductase R1 Protein Mutant Y730f Wi 1e-121
2x1y_B761 Ribonucleotide Reductase Y731no2y Modified R1 Subun 1e-121
2x0z_B761 Ribonucleotide Reductase Y730no2y Modified R1 Subun 1e-121
2x59_B761 Ribonucleotide Reductase Y730no2y And C439s Modifie 1e-121
2x3s_B761 Ribonucleotide Reductase Y730no2y And C439a Modifie 1e-121
2x5b_B761 Ribonucleotide Reductase Y730no2y And Y731f Modifie 1e-120
2x33_B761 Ribonucleotide Reductase Y731no2y And Y730f Modifie 1e-120
2x3i_B761 Ribonucleotide Reductase Y730no2y And Y731a Modifie 1e-120
1xje_A644 Structural Mechanism Of Allosteric Substrate Specif 5e-83
gi|323714413|pdb|3HNC|A Chain A, Crystal Structure Of Human Ribonucleotide Reductase 1 Bound To The Effector Ttp Length = 792 Back     alignment and structure
 Score =  709 bits (1829), Expect = 0.0,   Method: Composition-based stats.
 Identities = 290/816 (35%), Positives = 454/816 (55%), Gaps = 33/816 (4%)

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGL--QDVSSKIVLSETYKNMYDGLSESDLETAL 202
           + ++  DG        ++   +++ C GL    V    +  +  + +Y G++  +L+T  
Sbjct: 1   MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA 60

Query: 203 IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
             ++ TL  K P+YA + AR  +  L +E         +K     M+ LY        + 
Sbjct: 61  AETAATLTTKHPDYAILAARIAVSNLHKET--------KKVFSDVMEDLYNYINPHNGKH 112

Query: 263 GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
                     ++  +   L + + Y+RDF++ Y G + L   Y L ING   E PQ   M
Sbjct: 113 SPMVAKSTLDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLM 172

Query: 323 RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDD-LY 381
           RV++G+     E    A+E YNLLS   F  ++PTLFN+GT  PQLSSCFL ++ DD + 
Sbjct: 173 RVSVGIH---KEDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIE 229

Query: 382 GIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQG 441
           GI+  L++ A+++K +GG+G   + +R  G++I GTNG S G++P L+V N+TA  V+QG
Sbjct: 230 GIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQG 289

Query: 442 -GKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWT 500
             KR GA   YLE WH+D+ EFLDL+KNTG + +R  D+  A WIPDLFMKRV  N  W+
Sbjct: 290 GNKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWS 349

Query: 501 LFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPW 560
           L  P+E   L +++G+EFE  Y +YE+Q      +V + + A  LW  ++    ETG P+
Sbjct: 350 LMCPNECPGLDEVWGEEFEKLYASYEKQ-----GRVRKVVKAQQLWYAIIESQTETGTPY 404

Query: 561 ITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAH-FANNQFDYD 619
           + +KD CN +S QQ++G +  SNLCTEI   +S +E AVCNL S+ L  +  + + +D+ 
Sbjct: 405 MLYKDSCNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFK 464

Query: 620 KLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEA 679
           KLA   +  VR L+ +IDIN + + +A  SN  HR IG+G+ G   A  L+  P+ S EA
Sbjct: 465 KLAEVTKVVVRNLNKIIDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEA 524

Query: 680 VEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMN 739
             +  +  E I + A+ AS +LA+E+G Y +++GS   +G+   D   +           
Sbjct: 525 QLLNKQIFETIYYGALEASCDLAKEQGPYETYEGSPVSKGILQYDMWNVTP--------- 575

Query: 740 RTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDF 799
            T    W  LK+++   G+RNS  +A  PTA+ A I G ++SI+P   N+Y +  +SG+F
Sbjct: 576 -TDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEF 634

Query: 800 TVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIES 859
            +VN  L+ +L +R LW E M + +   +GSI +I  IPDDLK+++ T +EI    +++ 
Sbjct: 635 QIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKM 694

Query: 860 ASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT-TYYLRSRSATSVEKSTLKG 918
           A+ R  +IDQ+QSLN+++ EP+  KL  ++   W  GLKT  YYLR+R A +  + TL  
Sbjct: 695 AAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNK 754

Query: 919 VD-GKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVC 953
                   V   +     ++  +  S  +  EC +C
Sbjct: 755 EKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMC 790


gi|93278634|pdb|1ZYZ|A Chain A, Structures Of Yeast Ribonucloetide Reductase I Length = 888 Back     alignment and structure
>gi|229597646|pdb|2WGH|A Chain A, Human Ribonucleotide Reductase R1 Subunit (Rrm1) In Complex With Datp And Mg. Length = 676 Back     alignment and structure
gi|49258467|pdb|1PEM|A Chain A, Ribonucleotide Reductase Protein R1e From Salmonella Typhimurium Length = 714 Back     alignment and structure
gi|2914218|pdb|3R1R|A Chain A, Ribonucleotide Reductase R1 Protein With Amppnp Occupying The Activity Site From Escherichia Coli Length = 761 Back     alignment and structure
>gi|157833699|pdb|1RLR|A Chain A, Structure Of Ribonucleotide Reductase Protein R1 Length = 761 Back     alignment and structure
>gi|2914234|pdb|4R1R|A Chain A, Ribonucleotide Reductase R1 Protein With Substrate, Gdp And Effector Dttp From Escherichia Coli Length = 761 Back     alignment and structure
>gi|2981919|pdb|6R1R|A Chain A, Ribonucleotide Reductase E441d Mutant R1 Protein From Escherichia Coli Length = 761 Back     alignment and structure
>gi|2981911|pdb|5R1R|A Chain A, Ribonucleotide Reductase E441a Mutant R1 Protein From Escherichia Coli Length = 761 Back     alignment and structure
>gi|2981928|pdb|7R1R|A Chain A, Ribonucleotide Reductase E441q Mutant R1 Protein From Escherichia Coli Length = 761 Back     alignment and structure
>gi|2914260|pdb|1R1R|A Chain A, Ribonucleotide Reductase R1 Protein Mutant Y730f With A Reduced Active Site From Escherichia Coli Length = 761 Back