254780503

254780503

putative glutamine synthetase

GeneID in NCBI database:8209498Locus tag:CLIBASIA_01950
Protein GI in NCBI database:254780503Protein Accession:YP_003064916.1
Gene range:-(772575, 773960)Protein Length:461aa
Gene description:putative glutamine synthetase
COG prediction:[E] Glutamine synthetase
KEGG prediction:glnA; putative glutamine synthetase; K01915 glutamine synthetase [EC:6.3.1.2]
SEED prediction:glutamine synthetase family protein
Pathway involved in KEGG:Nitrogen metabolism [PATH:las00910]
Alanine, aspartate and glutamate metabolism [PATH:las00250]
Arginine and proline metabolism [PATH:las00330]
Two-component system [PATH:las02020]
Subsystem involved in SEED:Glutamine synthetases;
Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-
MNKNDQSPMNVRGVKNWEQAAKWLKDNRIEDVECITPDLAGIPRGKMMPSSKFISNIPLTVPSAIYRHTISGESLHSPYLFHNERDGDLRLSPDLSTLSIVPWEMDPTAQIVCDVVDYNGKEVTYTPRNVLKRVLNFYAQNELKPIIAPEIEFYLIAKNEDPDYPLQPPKGRSGRSILGGQSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEEGPAQFEINIRHGDPLKLADQVFLFKRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNPDGSETDNFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIPFSDAKTKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSANQEAINLPRGLLEAVTLLENTSHFKDIFGSQFIDMYANLKRNEFETFMQVISPWEREFLLLNV
ccccccccccHHccccHHHHHHHHHcccccEEEEEEEcccccEEEEEEEHHHHHHHHcccccccccccccccccccccccccccccccEEEEEcccccEEcccccccEEEEEEEEEccccccccccHHHHHHHHHHHHHHcccEEEEEccccEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEcccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccccccEEEEcccccccEEEcccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcc
ccccccccccccccccHHHHHHHHHHcccEEEEEEEEccccEEEEEEEEHHHHHHHHHHcHHHHHccccccccccccccccEEEcccccEEccccccEEEcccccccEEEEEEEEEccccccccccHHHHHHHHHHHHHHcccccccccccEEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEccccccccEEEEccccEEHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccccccEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHcccccccccEEEEEEccccccEEEEcccccccccEEEccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccHHHHHHHHHcccHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcc
mnkndqspmnvrgvKNWEQAAKWLKdnriedvecitpdlagiprgkmmpsskfisnipltvpsaiyrhtisgeslhspylfhnerdgdlrlspdlstlsivpwemdptaqiVCDVvdyngkevtytpRNVLKRVLNFYAqnelkpiiapeIEFYLIaknedpdyplqppkgrsgrsilggqsysimgiNEFDEIIDDIWKFSekqgleidtliheegpaqfeinirhgdplklaDQVFLFKRTIREAAFKHDIYatfmakpmqnypgsamhIHQSVLdiksnqnifsnpdgsetdnfRYFIGGLQKYIPNALVMLapygnsyrRLVLDmgcpvnnawgydnrttafripfsdaktkrienrlpssdtnpyLVLAASLACGLLGilqkieptpptmksaNQEAINLPRGLLEAVTLLentshfkdifGSQFIDMYANLKRNEFETFMQVISPWEREFLLLNV
mnkndqspmnvrgvknWEQAAKWlkdnriedvecitpdlagiprgKMMPSSKFISNIPLTVPSAIYRHTISGESLHSPYLFHNERDGDLRLSPDLSTLSIVPWEMDPTAQIVCDVVDYNGKEVTYTPRNVLKRVLNFYAQNELKPIIAPEIEFYLIAKNEDPDYPLQPPKGRSGRSILGGQSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEEGPAQFEINIRHGDPLKLADQVFLFKRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNPDGSETDNFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNawgydnrttafripfsdaktkrienrlpssdtnpYLVLAASLACGLLGILQKIEPTPPTMKSANQEAINLPRGLLEAVTLLENTSHFKDIFGSQFIDMYANLKRNEFETFMQVISPWEREFLLLNV
MNKNDQSPMNVRGVKNWEQAAKWLKDNRIEDVECITPDLAGIPRGKMMPSSKFISNIPLTVPSAIYRHTISGESLHSPYLFHNERDGDLRLSPDLSTLSIVPWEMDPTAQIVCDVVDYNGKEVTYTPRNVLKRVLNFYAQNELKPIIAPEIEFYLIAKNEDPDYPLQPPKGRSGRSILGGQSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEEGPAQFEINIRHGDPLKLADQVFLFKRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNPDGSETDNFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIPFSDAKTKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSANQEAINLPRGLLEAVTLLENTSHFKDIFGSQFIDMYANLKRNEFETFMQVISPWEREFLLLNV
*******************AAKWLKDNRIEDVECITPDLAGIPRGKMMPSSKFISNIPLTVPSAIYRHTISGESLHSPYLFHNERDGDLRLSPDLSTLSIVPWEMDPTAQIVCDVVDYNGKEVTYTPRNVLKRVLNFYAQNELKPIIAPEIEFYLIAKNEDPDYPLQ***********GGQSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEEGPAQFEINIRHGDPLKLADQVFLFKRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNPDGSETDNFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIPFSDAKTKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSANQEAINLPRGLLEAVTLLENTSHFKDIFGSQFIDMYANLKRNEFETFMQVISPWEREFLLLNV
**********VRGVKNWEQAAKWLKDNRIEDVECITPDLAGIPRGKMMPSSKFISNIPLTVPSAIYRHTISGESLHSPYLFHNERDGDLRLSPDLSTLSIVPWEMDPTAQIVCDVVDYNGKEVTYTPRNVLKRVLNFYAQNELKPIIAPEIEFYLIAKNEDPDYPLQPPKGRSGRSILGGQSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEEGPAQFEINIRHGDPLKLADQVFLFKRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNPDGSETDNFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIPFSDAKTKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSANQEAINLPRGLLEAVTLLENTSHFKDIFGSQFIDMYANLKRNEFETFMQVISPWEREFLLLNV
********MNVRGVKNWEQAAKWLKDNRIEDVECITPDLAGIPRGKMMPSSKFISNIPLTVPSAIYRHTISGESLHSPYLFHNERDGDLRLSPDLSTLSIVPWEMDPTAQIVCDVVDYNGKEVTYTPRNVLKRVLNFYAQNELKPIIAPEIEFYLIAKNEDPDYPLQPPKGRSGRSILGGQSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEEGPAQFEINIRHGDPLKLADQVFLFKRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNPDGSETDNFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIPFSDAKTKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSANQEAINLPRGLLEAVTLLENTSHFKDIFGSQFIDMYANLKRNEFETFMQVISPWEREFLLLNV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKNDQSPMNVRGVKNWEQAAKWLKDNRIEDVECITPDLAGIPRGKMMPSSKFISNIPLTVPSAIYRHTISGESLHSPYLFHNERDGDLRLSPDLSTLSIVPWEMDPTAQIVCDVVDYNGKEVTYTPRNVLKRVLNFYAQNELKPIIAPEIEFYLIAKNEDPDYPLQPPKGRSGRSILGGQSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEEGPAQFEINIRHGDPLKLADQVFLFKRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNPDGSETDNFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIPFSDAKTKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSANQEAINLPRGLLEAVTLLENTSHFKDIFGSQFIDMYANLKRNEFETFMQVISPWEREFLLLNV
MNKNDQSPMNVRGVKNWEQAAKWLKDNRIEDVECITPDLAGIPRGKMMPSSKFISNIPLTVPSAIYRHTISGESLHSPYLFHNERDGDLRLSPDLSTLSIVPWEMDPTAQIVCDVVDYNGKEVTYTPRNVLKRVLNFYAQNELKPIIAPEIEFYLIAKNEDPDYPLQPPKGRSGRSILGGQSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEEGPAQFEINIRHGDPLKLADQVFLFKRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNPDGSETDNFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIPFSDAKTKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSANQEAINLPRGLLEAVTLLENTSHFKDIFGSQFIDMYANLKRNEFETFMQVISPWEREFLLLNV
MNKNDQSPMNVRGVKNWEQAAKWLKDNRIEDVECITPDLAGIPRGKMMPSSKFISNIPLTVPSAIYRHTISGESLHSPYLFHNERDGDLRLSPDLSTLSIVPWEMDPTAQIVCDVVDYNGKEVTYTPRNVLKRVLNFYAQNELKPIIAPEIEFYLIAKNEDPDYPLQPPKGRSGRSILGGQSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEEGPAQFEINIRHGDPLKLADQVFLFKRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNPDGSETDNFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIPFSDAKTKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSANQEAINLPRGLLEAVTLLENTSHFKDIFGSQFIDMYANLKRNEFETFMQVISPWEREFLLLNV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target461 putative glutamine synthetase [Candidatus Liberibacter
254780185458 glutamine synthetase protein [Candidatus Liberibac 4e-24
>gi|254780185|ref|YP_003064598.1| glutamine synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Back     alignment
 Score =  103 bits (258), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 94/394 (23%), Positives = 171/394 (43%), Gaps = 30/394 (7%)

Query: 88  DLRLSPDLSTLSIVPWEMDPTAQIVCDVVD-YNGKEVTYTPRNVLKRVLNFYAQNELKP- 145
           +L L PD+ T+ + P+    T   +C+V D    +     PR   ++ +++    ++   
Sbjct: 66  NLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDT 125

Query: 146 -IIAPEIEFYLIAKNEDPDYPLQPPKGRSGRSIL-----------GGQSYSIMGINEFDE 193
            ++    EF++         P++          L              SY++   ++  +
Sbjct: 126 LLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGNNKGYDSHAKSSYTLPPQDKLHD 185

Query: 194 IIDDIWKFSEKQGLEIDTLIHEEGPAQFEINIRHGDPLKLADQVFLFKRTIREAAFKHDI 253
           +  +I       G++I    ++   AQ    ++    L  +D +  +K ++ + A  +  
Sbjct: 186 MRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVANSYCK 245

Query: 254 YATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNPDGSETDNFR----YFIGGLQKYIP 309
            ATFM KP+ ++ GS M+++ S+   K  + IF+   G++ D       Y++GG+ K+  
Sbjct: 246 IATFMPKPIASHNGSGMYLNMSIH--KGEKAIFT---GNQHDRVSLKGLYYLGGIIKHAK 300

Query: 310 NALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIPFSD-AKTKRIENRLPSSDTN 368
           +   +     NSY+RL+ D   P    +   N + + RIP+ + +  K IE R P    N
Sbjct: 301 SLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIPYENKSDNKSIEIRFPDLSAN 360

Query: 369 PYLVLAASLACGLLGILQKIEPTPPTMKSANQEAINLPR---GLLEAVTLLENTSHF--- 422
           PYL  AA L  GL GI +KI P     + + +E   +PR    L E++  L+    F   
Sbjct: 361 PYLAPAAILMAGLDGIAKKIHPGKNIDELSLEEQNTIPRICISLRESLENLDKDREFLKV 420

Query: 423 KDIFGSQFIDMYANLKRNEFETFMQVISPWEREF 456
            ++F    ID + NLK  E        SP E E 
Sbjct: 421 GNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEM 454

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target461 putative glutamine synthetase [Candidatus Liberibacter
315122300461 putative glutamine synthetase [Candidatus Liberibacter 1 0.0
116250527478 glutamine synthetase [Rhizobium leguminosarum bv. vicia 1 0.0
241203151478 glutamate--putrescine ligase [Rhizobium leguminosarum b 1 0.0
327192181478 glutamine synthetase protein [Rhizobium etli CNPAF512] 1 0.0
86356357478 glutamine synthetase protein [Rhizobium etli CFN 42] Le 1 0.0
190890412478 glutamine synthetase [Rhizobium etli CIAT 652] Length = 1 0.0
222084914478 glutamine synthetase protein [Agrobacterium radiobacter 1 0.0
222147618478 glutamine synthetase [Agrobacterium vitis S4] Length = 1 0.0
209547973478 glutamate--putrescine ligase [Rhizobium leguminosarum b 1 0.0
150395529478 glutamate--putrescine ligase [Sinorhizobium medicae WSM 1 0.0
>gi|315122300|ref|YP_004062789.1| putative glutamine synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 461 Back     alignment and organism information
 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/461 (92%), Positives = 438/461 (95%)

Query: 1   MNKNDQSPMNVRGVKNWEQAAKWLKDNRIEDVECITPDLAGIPRGKMMPSSKFISNIPLT 60
           M KN+QSP+NVRGV+NW+QAA+WLKD  IEDVECITPDLAGIPRGKMM SSKFISNIPL 
Sbjct: 1   MKKNNQSPLNVRGVENWDQAAQWLKDRGIEDVECITPDLAGIPRGKMMSSSKFISNIPLA 60

Query: 61  VPSAIYRHTISGESLHSPYLFHNERDGDLRLSPDLSTLSIVPWEMDPTAQIVCDVVDYNG 120
           VPSAIYRHTISGESLHSP LF    DGDLRLSPDLSTLS+VPWE DPTAQIVCDVVDYNG
Sbjct: 61  VPSAIYRHTISGESLHSPNLFRYGPDGDLRLSPDLSTLSVVPWEEDPTAQIVCDVVDYNG 120

Query: 121 KEVTYTPRNVLKRVLNFYAQNELKPIIAPEIEFYLIAKNEDPDYPLQPPKGRSGRSILGG 180
           +EVTYTPRNVLKRVL+FY QN LKPIIAPEIEFYLIAKNEDPDYPL PPKGRSGRSILGG
Sbjct: 121 EEVTYTPRNVLKRVLDFYVQNGLKPIIAPEIEFYLIAKNEDPDYPLHPPKGRSGRSILGG 180

Query: 181 QSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEEGPAQFEINIRHGDPLKLADQVFLF 240
           QSYSIMGINEFDEIIDDIW FSEKQGLEIDTLIHEEGPAQFEINIRHGDPL LADQVFLF
Sbjct: 181 QSYSIMGINEFDEIIDDIWDFSEKQGLEIDTLIHEEGPAQFEINIRHGDPLNLADQVFLF 240

Query: 241 KRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNPDGSETDNFRYF 300
           KRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSN+NIFSN DGSETD FRYF
Sbjct: 241 KRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNKNIFSNQDGSETDFFRYF 300

Query: 301 IGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIPFSDAKTKRIEN 360
           IGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIPFSDAKTKRIEN
Sbjct: 301 IGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIPFSDAKTKRIEN 360

Query: 361 RLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSANQEAINLPRGLLEAVTLLENTS 420
           RLPSSDTNPYL LAASLACGLLGILQKIEPTPPT  SANQ+AINLPRGLLEAVTLLENTS
Sbjct: 361 RLPSSDTNPYLALAASLACGLLGILQKIEPTPPTTNSANQKAINLPRGLLEAVTLLENTS 420

Query: 421 HFKDIFGSQFIDMYANLKRNEFETFMQVISPWEREFLLLNV 461
           HFKDIFGSQFID+Y  LKRNEFETFMQVISPWEREFLLLNV
Sbjct: 421 HFKDIFGSQFIDIYTTLKRNEFETFMQVISPWEREFLLLNV 461


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116250527|ref|YP_766365.1| glutamine synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 478 Back     alignment and organism information
>gi|241203151|ref|YP_002974247.1| glutamate--putrescine ligase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 478 Back     alignment and organism information
>gi|327192181|gb|EGE59154.1| glutamine synthetase protein [Rhizobium etli CNPAF512] Length = 478 Back     alignment and organism information
>gi|86356357|ref|YP_468249.1| glutamine synthetase protein [Rhizobium etli CFN 42] Length = 478 Back     alignment and organism information
>gi|190890412|ref|YP_001976954.1| glutamine synthetase [Rhizobium etli CIAT 652] Length = 478 Back     alignment and organism information
>gi|222084914|ref|YP_002543443.1| glutamine synthetase protein [Agrobacterium radiobacter K84] Length = 478 Back     alignment and organism information
>gi|222147618|ref|YP_002548575.1| glutamine synthetase [Agrobacterium vitis S4] Length = 478 Back     alignment and organism information
>gi|209547973|ref|YP_002279890.1| glutamate--putrescine ligase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 478 Back     alignment and organism information
>gi|150395529|ref|YP_001325996.1| glutamate--putrescine ligase [Sinorhizobium medicae WSM419] Length = 478 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target461 putative glutamine synthetase [Candidatus Liberibacter
pfam00120257 pfam00120, Gln-synt_C, Glutamine synthetase, catalytic 5e-77
TIGR00653460 TIGR00653, GlnA, glutamine synthetase, type I 3e-69
COG0174443 COG0174, GlnA, Glutamine synthetase [Amino acid transpo 1e-118
TIGR03105435 TIGR03105, gln_synth_III, glutamine synthetase, type II 9e-56
PRK09469469 PRK09469, glnA, glutamine synthetase; Provisional 8e-33
KOG0683380 KOG0683, KOG0683, KOG0683, Glutamine synthetase [Amino 1e-08
COG3968 724 COG3968, COG3968, Uncharacterized protein related to gl 2e-04
>gnl|CDD|143894 pfam00120, Gln-synt_C, Glutamine synthetase, catalytic domain Back     alignment and domain information
>gnl|CDD|161979 TIGR00653, GlnA, glutamine synthetase, type I Back     alignment and domain information
>gnl|CDD|30523 COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163137 TIGR03105, gln_synth_III, glutamine synthetase, type III Back     alignment and domain information
>gnl|CDD|181884 PRK09469, glnA, glutamine synthetase; Provisional Back     alignment and domain information
>gnl|CDD|35902 KOG0683, KOG0683, KOG0683, Glutamine synthetase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33749 COG3968, COG3968, Uncharacterized protein related to glutamine synthetase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 461 putative glutamine synthetase [Candidatus Liberibacter
TIGR00653486 GlnA glutamine synthetase, type I; InterPro: IPR004809 100.0
TIGR03105435 gln_synth_III glutamine synthetase, type III. This fami 100.0
COG0174443 GlnA Glutamine synthetase [Amino acid transport and met 100.0
PRK09469469 glnA glutamine synthetase; Provisional 100.0
pfam00120257 Gln-synt_C Glutamine synthetase, catalytic domain. 100.0
PRK13517371 carboxylate-amine ligase; Provisional 98.66
PRK13516372 carboxylate-amine ligase; Provisional 98.6
TIGR02050297 gshA_cyan_rel uncharacterized enzyme; InterPro: IPR0117 98.59
PRK13515381 carboxylate-amine ligase; Provisional 98.51
PRK13518357 carboxylate-amine ligase; Provisional 98.4
pfam04107291 GCS2 Glutamate-cysteine ligase family 2(GCS2). Also kno 98.1
COG2170369 Uncharacterized conserved protein [Function unknown] 98.02
KOG0683380 consensus 100.0
COG3968 724 Uncharacterized protein related to glutamine synthetase 99.91
pfam0395184 Gln-synt_N Glutamine synthetase, beta-Grasp domain. 99.43
KOG0683380 consensus 97.55
COG3572456 GshA Gamma-glutamylcysteine synthetase [Coenzyme metabo 95.71
TIGR03444390 gshA_related glutamate--cysteine ligase family protein. 91.42
>TIGR00653 GlnA glutamine synthetase, type I; InterPro: IPR004809 Glutamine synthetase type I (or glutamate-ammonia ligase) has a dodecameric form, which can be subdivided into 1-alpha and 1-beta forms Back     alignment and domain information
>TIGR03105 gln_synth_III glutamine synthetase, type III Back     alignment and domain information
>COG0174 GlnA Glutamine synthetase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09469 glnA glutamine synthetase; Provisional Back     alignment and domain information
>pfam00120 Gln-synt_C Glutamine synthetase, catalytic domain Back     alignment and domain information
>PRK13517 carboxylate-amine ligase; Provisional Back     alignment and domain information
>PRK13516 carboxylate-amine ligase; Provisional Back     alignment and domain information
>TIGR02050 gshA_cyan_rel uncharacterized enzyme; InterPro: IPR011793 This family represents a division of a larger family, the other branch of which is predicted to act as glutamate--cysteine ligase (the first of two enzymes in glutathione biosynthesis) in the cyanobacteria Back     alignment and domain information
>PRK13515 carboxylate-amine ligase; Provisional Back     alignment and domain information
>PRK13518 carboxylate-amine ligase; Provisional Back     alignment and domain information
>pfam04107 GCS2 Glutamate-cysteine ligase family 2(GCS2) Back     alignment and domain information
>COG2170 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0683 consensus Back     alignment and domain information
>COG3968 Uncharacterized protein related to glutamine synthetase [General function prediction only] Back     alignment and domain information
>pfam03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain Back     alignment and domain information
>KOG0683 consensus Back     alignment and domain information
>COG3572 GshA Gamma-glutamylcysteine synthetase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03444 gshA_related glutamate--cysteine ligase family protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target461 putative glutamine synthetase [Candidatus Liberibacter
1hto_A477 Crystallographic Structure Of A Relaxed Glutamine S 2e-78
2bvc_A486 Crystal Structure Of Mycobacterium Tuberculosis Glu 2e-78
1f52_A468 Crystal Structure Of Glutamine Synthetase From Salm 2e-77
2gls_A469 Refined Atomic Model Of Glutamine Synthetase At 3.5 2e-77
2lgs_B446 Feedback Inhibition Of Fully Unadenylylated Glutami 3e-69
2ojw_A384 Crystal Structure Of Human Glutamine Synthetase In 1e-15
2uu7_A381 Crystal Structure Of Apo Glutamine Synthetase From 3e-15
2d3a_A356 Crystal Structure Of The Maize Glutamine Synthetase 1e-12
3fky_A370 Crystal Structure Of The Glutamine Synthetase Gln1d 2e-13
2j9i_A421 Lengsin Is A Survivor Of An Ancient Family Of Class 8e-09
>gi|22218713|pdb|1HTO|A Chain A, Crystallographic Structure Of A Relaxed Glutamine Synthetase From Mycobacterium Tuberculosis Length = 477 Back     alignment and structure
 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 121/482 (25%), Positives = 189/482 (39%), Gaps = 47/482 (9%)

Query: 15  KNWEQAAKWLKDNRIEDVECITPDLAGIPRGKMMPSSKFISNIPLTVPSAIYRHTISGES 74
           K  +   K  KD ++E V+    DL GI +   +P+S F  ++              G S
Sbjct: 3   KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSV------FDDGLAFDGSS 56

Query: 75  LHSPYLFHNERDGDLRLSPDLSTLSIVPWEMDPTAQIVCD-VVDYNGKEVTYTPRNVLKR 133
           +     F +  + D+ L PD  T  I P+    T  I       +  +  +  PRN+ ++
Sbjct: 57  IRG---FQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARK 113

Query: 134 VLNFYAQNE--LKPIIAPEIEFYLIA---------------------KNEDPDYPLQPPK 170
             N+              E EFY+                        N           
Sbjct: 114 AENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSP 173

Query: 171 GRSGRSILGGQSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEEGPAQF-EINIRHGD 229
            R  +    G  + +   +++ ++ D +       G  ++   HE G     EIN +   
Sbjct: 174 NRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNS 233

Query: 230 PLKLADQVFLFKRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNP 289
            L  AD + L+K  I+  A+++    TFM KP+    GS MH HQS+    +        
Sbjct: 234 LLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETG 293

Query: 290 DGSETDNFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTA--FR 347
               +D  R++IGGL  + P+ L    P  NSY+RLV     P+N  +   NR+      
Sbjct: 294 YAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIP 353

Query: 348 IPFSDAKTKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSAN----QEAI 403
           I  S+ K KR+E R P S  NPYL  +A L  GL GI  KIEP  P  K       +EA 
Sbjct: 354 ITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAA 413

Query: 404 NLPRG---LLEAVTLLENTSHF---KDIFGSQFIDMYANLKRN-EFETFMQVISPWEREF 456
           ++P+    L + +  LE    +     +F +  I+ + + KR  E E       P+E   
Sbjct: 414 SIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFAL 473

Query: 457 LL 458
             
Sbjct: 474 YY 475


>gi|73536298|pdb|2BVC|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Glutamine Synthetase In Complex With A Transition State Mimic Length = 486 Back     alignment and structure
>gi|9256961|pdb|1F52|A Chain A, Crystal Structure Of Glutamine Synthetase From Salmonella Typhimurium Co-Crystallized With Adp Length = 468 Back     alignment and structure
>gi|21730903|pdb|2GLS|A Chain A, Refined Atomic Model Of Glutamine Synthetase At 3.5 Angstroms Resolution Length = 469 Back     alignment and structure
>gi|145580062|pdb|2OJW|A Chain A, Crystal Structure Of Human Glutamine Synthetase In Complex With Adp And Phosphate Length = 384 Back     alignment and structure
>gi|158430851|pdb|2UU7|A Chain A, Crystal Structure Of Apo Glutamine Synthetase From Dog ( Canis Familiaris) Length = 381 Back     alignment and structure
>gi|112490284|pdb|2D3A|A Chain A, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate Length = 356 Back     alignment and structure
gi|260656232|pdb|3FKY|A Chain A, Crystal Structure Of The Glutamine Synthetase Gln1deltan18 From The Yeast Saccharomyces Cerevisiae Length = 370 Back     alignment and structure
>gi|122920859|pdb|2J9I|A Chain A, Lengsin Is A Survivor Of An Ancient Family Of Class I Glutamine Synthetases In Eukaryotes That Has Undergone Evolutionary Re-Engineering For A Tissue-Specific Role In The Vertebrate Eye Lens. Length = 421 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target461 putative glutamine synthetase [Candidatus Liberibacter
1f52_A468 Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A 5e-97
2bvc_A486 Glutamine synthetase 1; ligase, transition state mimic; 6e-72
2j9i_A421 Glutamate-ammonia ligase domain-containing protein 1; 1 4e-67
2ojw_A384 Glutamine synthetase; amino-acid biosynthesis, ligase, 7e-45
2d3a_A356 Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea 4e-44
3fky_A370 Glutamine synthetase; beta-grAsp, catalytic domain, ace 2e-43
>1f52_A Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A {Salmonella typhimurium} SCOP: d.15.9.1 d.128.1.1 PDB: 1f1h_A* 1fpy_A* 1lgr_A* 2lgs_A* 2gls_A Length = 468 Back     alignment and structure
 Score =  350 bits (898), Expect = 5e-97
 Identities = 121/471 (25%), Positives = 191/471 (40%), Gaps = 43/471 (9%)

Query: 18  EQAAKWLKDNRIEDVECITPDLAGIPRGKMMPSSKFISNIPLTVPSAIYRHTISGESLHS 77
           E     L ++ ++ V+    D  G  +   +P+ +  +             +I G     
Sbjct: 3   EHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEF-FEEGKMFDGSSIGG----- 56

Query: 78  PYLFHNERDGDLRLSPDLSTLSIVPWEMDPTAQIVCDVVDYNGKE-VTYTPRNVLKRVLN 136
              +    + D+ L PD ST  I P+  D T  I CD+++    +     PR++ KR  +
Sbjct: 57  ---WKGINESDMVLMPDASTAVIDPFFADSTLIIRCDILEPGTLQGYDRDPRSIAKRAED 113

Query: 137 FYAQNELKP--IIAPEIEFYLIAKNED-----------------PDYPLQPPKGRSG-RS 176
           +     +    +  PE EF+L                        +   +   G  G R 
Sbjct: 114 YLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNSSTKYEGGNKGHRP 173

Query: 177 ILGGQSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEEGPA-QFEINIRHGDPLKLAD 235
            + G  + +  ++   +I  ++    E+ GL ++   HE   A Q E+  R     K AD
Sbjct: 174 GVKGGYFPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKAD 233

Query: 236 QVFLFKRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNPDGSETD 295
           ++ ++K  +   A +    ATFM KPM    GS MH H S+    +N     +     ++
Sbjct: 234 EIQIYKYVVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLAKNGTN-LFSGDKYAGLSE 292

Query: 296 NFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIP-FSDAK 354
              Y+IGG+ K+      +  P  NSY+RLV     PV  A+   NR+ + RIP  +  K
Sbjct: 293 QALYYIGGVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNRSASIRIPVVASPK 352

Query: 355 TKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSA-------NQEAINLPR 407
            +RIE R P    NPYL  AA L  GL GI  KI P  P  K+         +E   +  
Sbjct: 353 ARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYDLPPEEAKEIPQVAG 412

Query: 408 GLLEAVTLLENTSHFK---DIFGSQFIDMYANLKRNEFETFMQVISPWERE 455
            L EA+  L+    F     +F  + ID Y  L+R E +       P E E
Sbjct: 413 SLEEALNALDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFE 463


>2bvc_A Glutamine synthetase 1; ligase, transition state mimic; HET: P3S ADP; 2.1A {Mycobacterium tuberculosis} SCOP: d.15.9.1 d.128.1.1 PDB: 2wgs_A* 2whi_A* 1hto_A* 1htq_A* Length = 486 Back     alignment and structure
>2j9i_A Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus} Length = 421 Back     alignment and structure
>2ojw_A Glutamine synthetase; amino-acid biosynthesis, ligase, structural genomics, structural genomics consortium, SGC; HET: ADP; 2.05A {Homo sapiens} PDB: 2qc8_A* 2uu7_A Length = 384 Back     alignment and structure
>2d3a_A Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea mays} PDB: 2d3b_A* 2d3c_A* Length = 356 Back     alignment and structure
>3fky_A Glutamine synthetase; beta-grAsp, catalytic domain, acetylation, cytoplasm, ligase, UBL conjugation; HET: FLC; 2.95A {Saccharomyces cerevisiae} Length = 370 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target461 putative glutamine synthetase [Candidatus Liberibacter
1f52_A468 Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A 100.0
2bvc_A486 Glutamine synthetase 1; ligase, transition state mimic; 100.0
2j9i_A421 Glutamate-ammonia ligase domain-containing protein 1; 1 100.0
3fky_A370 Glutamine synthetase; beta-grAsp, catalytic domain, ace 100.0
2ojw_A384 Glutamine synthetase; amino-acid biosynthesis, ligase, 100.0
2d3a_A356 Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea 100.0
1r8g_A372 Hypothetical protein YBDK; structural genomics, unknown 98.46
2gwd_A 449 Glutamate cysteine ligase; disulfide bridges, glutathio 97.13
>1f52_A Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A {Salmonella typhimurium} SCOP: d.15.9.1 d.128.1.1 PDB: 1f1h_A* 1fpy_A* 1lgr_A* 2lgs_A* 2gls_A Back     alignment and structure
Probab=100.00  E-value=0  Score=888.96  Aligned_cols=432  Identities=28%  Similarity=0.422  Sum_probs=384.6

Q ss_pred             CHHHHHHHHHHCCCCEEEEEEECCCCCEEEEEEEHHHHHHC-CCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEEE
Q ss_conf             98999999971798399999978898331267619887301-56773610000024277434665557788877899960
Q gi|254780503|r   16 NWEQAAKWLKDNRIEDVECITPDLAGIPRGKMMPSSKFISN-IPLTVPSAIYRHTISGESLHSPYLFHNERDGDLRLSPD   94 (461)
Q Consensus        16 ~~~~v~~~l~~~~I~~V~v~~~Dl~G~~RgK~vp~~~f~~~-~~~g~~~~~~~~~~~g~~~~~~~~~~~~~~~D~~l~PD   94 (461)
                      +.++|+++|++++|+||+++|+|++|++|||.||+++|.+. ...|+       .++|+++.+   +...+++|++++||
T Consensus         1 s~e~v~~~l~~~~i~~V~~~~~Dl~G~~R~k~ip~~~~~~~~~~~G~-------~fdgssi~g---~~~~~~sD~~l~PD   70 (468)
T 1f52_A            1 SAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEFFEEGK-------MFDGSSIGG---WKGINESDMVLMPD   70 (468)
T ss_dssp             CHHHHHHHHHHTTCCEEEEEEECTTSCEEEEEEEGGGCCHHHHHHCE-------EEEGGGSTT---SCCSSCCEEEEEEC
T ss_pred             CHHHHHHHHHHCCCEEEEEEEECCCCCEEEEEEEHHHHHHHHHHCCC-------CCCCCCCCC---CCCCCCCCEEEEEC
T ss_conf             97999999998898399999999999878999829997699985898-------656225257---67799889899982


Q ss_pred             CCCCEECCCCCCCEEEEEEECCCCCC-CCCCCCHHHHHHHHHHHHHCCCCC--EEECCCCCEEEEECCCCCCC-------
Q ss_conf             01245387888770999974033575-212342577789999986102764--02322441799821678888-------
Q gi|254780503|r   95 LSTLSIVPWEMDPTAQIVCDVVDYNG-KEVTYTPRNVLKRVLNFYAQNELK--PIIAPEIEFYLIAKNEDPDY-------  164 (461)
Q Consensus        95 ~~Tl~~lPw~~~~~a~vl~~~~~~dG-~p~~~~PR~iLkr~i~~l~~~G~~--~~~g~E~EF~L~~~~~~~~~-------  164 (461)
                      ++|++++||..+.++.|+|++++.++ .|+..|||++|++++++++++|+.  +.+|+|+|||+|+.......       
T Consensus        71 ~sT~~~~Pw~~~~~~~v~cd~~~~~~~~p~~~~PR~~l~~~~~~~~~~G~~~~~~~~~E~ef~l~~~~~~~~~~~~~~~~  150 (468)
T 1f52_A           71 ASTAVIDPFFADSTLIIRCDILEPGTLQGYDRDPRSIAKRAEDYLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVA  150 (468)
T ss_dssp             GGGCEECSSCSSCEEEEEEEEECTTTCCCCTTCHHHHHHHHHHHHHHHTSCSEEEEEEEEEEEEESEEEEEEETTEEEEE
T ss_pred             CCCEEECCCCCCCEEEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCC
T ss_conf             78408898689862899999863676788778855899999999987599642341455699963143346787887454


Q ss_pred             ------C----CCCCCC-CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHCCCC-CCCCCEEECCCCCHH
Q ss_conf             ------7----778778-8887766787777665442899999899767863110221010127-864201112665211
Q gi|254780503|r  165 ------P----LQPPKG-RSGRSILGGQSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEEG-PAQFEINIRHGDPLK  232 (461)
Q Consensus       165 ------~----~~~~~~-~~~~~~~~~~~y~~~~~~~~~~~l~~i~~~l~~~Gi~ve~~~~E~g-pGQ~Ei~~~~~~~l~  232 (461)
                            +    .....+ ...++...+++|++...+...++++++++.|+++||+||++|+|+| +||+||++.|+++|+
T Consensus       151 ~~~~e~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~~gi~ve~~~~E~~~~GQ~Ei~~~~~d~L~  230 (468)
T 1f52_A          151 IDDIEGAWNSSTKYEGGNKGHRPGVKGGYFPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTK  230 (468)
T ss_dssp             EECTTCGGGGGCCCTTCCCCCCCCTTCCSSBCTTSSCCHHHHHHHHHHHHHTTCCEEEEEECSSTTTEEEEEECCEEHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCEEEEECCCCCHHH
T ss_conf             57622245778766678867510478871232664206779999999999739872110126567861887056775555


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCEEECCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCC-CCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             378999999999999863066033112321135662689998763136874233588-6552156665457776422321
Q gi|254780503|r  233 LADQVFLFKRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNP-DGSETDNFRYFIGGLQKYIPNA  311 (461)
Q Consensus       233 aaD~~~~~k~~ik~vA~~~G~~atFmpKP~~~~~GsG~H~h~SL~d~~~g~n~f~~~-~~~ls~~~~~fiaGil~h~~al  311 (461)
                      +||+++++|++||+||++||++|||||||+.+.+|||||+|+|||+  +|+|+|+++ .+++|+++++||||||+|+|++
T Consensus       231 aAD~~~~~K~~vk~iA~~~Gl~ATFmpKP~~~~~GsG~H~H~Sl~~--~g~n~f~~~~~~~lS~~~~~~iaGlL~h~~~l  308 (468)
T 1f52_A          231 KADEIQIYKYVVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLAK--NGTNLFSGDKYAGLSEQALYYIGGVIKHAKAI  308 (468)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCEEECCSCSSTTSCCCCEEEEEEEEE--TTEETTBCSSGGGBCHHHHHHHHHHHHTHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCEEEEEEECC--CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             4679999999999999961964688401268888874379998358--99606689887772899999999999863766


Q ss_pred             HHHCCCCCHHHHHHHCCCCCCCCCCCCCCCCCEEEEECC-CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             222076610134420465575433424334500365022-3886520353035877998999999999999989846888
Q gi|254780503|r  312 LVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIPF-SDAKTKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEP  390 (461)
Q Consensus       312 ~a~~~PtvNSYkRl~p~~~ap~~~~WG~~NR~~~iRip~-~~~~~~riE~R~~d~~aNPYL~laail~agl~Gi~~~l~p  390 (461)
                      ++|+|||+||||||+|++|||+++|||++||+++||||. ++++++|||+|+||++|||||++||+|+|||+||+++++|
T Consensus       309 ~a~~~PtvNSYkRl~p~~~AP~~~~WG~~NR~~~iRip~~~~~~~~riE~R~~da~aNPYL~lAa~laagl~Gi~~~l~p  388 (468)
T 1f52_A          309 NALANPTTNSYKRLVPGYEAPVMLAYSARNRSASIRIPVVASPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHP  388 (468)
T ss_dssp             HHHHSCSGGGGGTSSSCSSCCCEEEEESSCTTEEEECCCCSCGGGCCEEECCCCTTSCHHHHHHHHHHHHHHHHHTTCCC
T ss_pred             HHHHCCCCHHHCCCCCCCCCCCCCEECCCCCCEEEEECCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             60555881564167898758863352222584207815578987615784379987698999999999999999837999


Q ss_pred             CCCCCCCCCC-------CHHCCCCCHHHHHHHHHCCHHHHH---HCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             7433453000-------311047898999999865989887---35589999999999999999863899789987631
Q gi|254780503|r  391 TPPTMKSANQ-------EAINLPRGLLEAVTLLENTSHFKD---IFGSQFIDMYANLKRNEFETFMQVISPWEREFLLL  459 (461)
Q Consensus       391 ~~~~~~~~~~-------~~~~LP~sL~eAl~~l~~d~~l~~---~lg~~~v~~~~~~k~~E~~~~~~~vt~wE~~~yl~  459 (461)
                      ++|+.+|+|+       +.++||+||.|||++|++|+.+++   +||++||++|+++||+||++|++.||+||+++||.
T Consensus       389 ~~p~~~~~~~~~~~~~~~~~~LP~sl~eAl~~l~~d~~~~~a~~~fg~~~v~~~~~~K~~E~~~~~~~vt~wE~~~Y~~  467 (468)
T 1f52_A          389 GEPMDKNLYDLPPEEAKEIPQVAGSLEEALNALDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYS  467 (468)
T ss_dssp             CSCCCSCCSSSCCSSTTCCCBCCSSHHHHHHHHHHTCHHHHGGGSSCHHHHHHHHHHHHHHHHHHHHSCCHHHHHHHTT
T ss_pred             CCCCCCCHHHCCHHHHHCHHCCCCCHHHHHHHHHCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCC
T ss_conf             9867788144998676131016137999999997396988865515699999999999999999977999999974068



>2bvc_A Glutamine synthetase 1; ligase, transition state mimic; HET: P3S ADP; 2.1A {Mycobacterium tuberculosis} SCOP: d.15.9.1 d.128.1.1 PDB: 2wgs_A* 2whi_A* 1hto_A* 1htq_A* Back     alignment and structure
>2j9i_A Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus} Back     alignment and structure
>3fky_A Glutamine synthetase; beta-grAsp, catalytic domain, acetylation, cytoplasm, ligase, UBL conjugation; HET: FLC; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojw_A Glutamine synthetase; amino-acid biosynthesis, ligase, structural genomics, structural genomics consortium, SGC; HET: ADP; 2.05A {Homo sapiens} PDB: 2qc8_A* 2uu7_A Back     alignment and structure
>2d3a_A Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea mays} PDB: 2d3b_A* 2d3c_A* Back     alignment and structure
>1r8g_A Hypothetical protein YBDK; structural genomics, unknown function, carboxylate-amine ligase, structure 2 function project, S2F; 2.15A {Escherichia coli} SCOP: d.128.1.3 PDB: 1tt4_A Back     alignment and structure
>2gwd_A Glutamate cysteine ligase; disulfide bridges, glutathione biosynthesis, beta-hairpin, redox regulation; HET: GLU; 2.09A {Brassica juncea} PDB: 2gwc_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 461 putative glutamine synthetase [Candidatus Liberibacter
d1f52a2368 d.128.1.1 (A:101-468) Glutamine synthetase, C-terminal 1e-61
d2bvca2374 d.128.1.1 (A:105-478) Glutamine synthetase, C-terminal 8e-59
d2bvca1100 d.15.9.1 (A:5-104) Glutamine synthetase, N-terminal dom 2e-12
d1f52a1100 d.15.9.1 (A:1-100) Glutamine synthetase, N-terminal dom 6e-12
>d1f52a2 d.128.1.1 (A:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 368 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Glutamine synthetase/guanido kinase
superfamily: Glutamine synthetase/guanido kinase
family: Glutamine synthetase catalytic domain
domain: Glutamine synthetase, C-terminal domain
species: Salmonella typhimurium [TaxId: 90371]
 Score =  231 bits (589), Expect = 1e-61
 Identities = 99/361 (27%), Positives = 151/361 (41%), Gaps = 33/361 (9%)

Query: 127 PRNVLKRVLNFYAQNELKP--IIAPEIEFYLI------AKNEDPDYPLQPPKG------- 171
           PR++ KR  ++     +    +  PE EF+L       A        +   +G       
Sbjct: 4   PRSIAKRAEDYLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNSSTK 63

Query: 172 -----RSGRSILGGQSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEE-GPAQFEINI 225
                +  R  + G  + +  ++   +I  ++    E+ GL ++   HE     Q E+  
Sbjct: 64  YEGGNKGHRPGVKGGYFPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVAT 123

Query: 226 RHGDPLKLADQVFLFKRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSNQNI 285
           R     K AD++ ++K  +   A +    ATFM KPM    GS MH H S+    +N   
Sbjct: 124 RFNTMTKKADEIQIYKYVVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLAKNGTN-LF 182

Query: 286 FSNPDGSETDNFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTA 345
             +     ++   Y+IGG+ K+      +  P  NSY+RLV     PV  A+   NR+ +
Sbjct: 183 SGDKYAGLSEQALYYIGGVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNRSAS 242

Query: 346 FRIP-FSDAKTKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSA------ 398
            RIP  +  K +RIE R P    NPYL  AA L  GL GI  KI P  P  K+       
Sbjct: 243 IRIPVVASPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYDLPPE 302

Query: 399 -NQEAINLPRGLLEAVTLLENTSHFK---DIFGSQFIDMYANLKRNEFETFMQVISPWER 454
             +E   +   L EA+  L+    F     +F  + ID Y  L+R E +       P E 
Sbjct: 303 EAKEIPQVAGSLEEALNALDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEF 362

Query: 455 E 455
           E
Sbjct: 363 E 363


>d2bvca2 d.128.1.1 (A:105-478) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 374 Back     information, alignment and structure
>d2bvca1 d.15.9.1 (A:5-104) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 100 Back     information, alignment and structure
>d1f52a1 d.15.9.1 (A:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 100 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target461 putative glutamine synthetase [Candidatus Liberibacter
d1f52a2368 Glutamine synthetase, C-terminal domain {Salmonella typ 100.0
d2bvca2374 Glutamine synthetase, C-terminal domain {Mycobacterium 100.0
d1f52a1100 Glutamine synthetase, N-terminal domain {Salmonella typ 99.82
d2bvca1100 Glutamine synthetase, N-terminal domain {Mycobacterium 99.82
d1r8ga_368 Carboxylate-amine ligase YbdK {Escherichia coli [TaxId: 98.16
>d1f52a2 d.128.1.1 (A:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Glutamine synthetase/guanido kinase
superfamily: Glutamine synthetase/guanido kinase
family: Glutamine synthetase catalytic domain
domain: Glutamine synthetase, C-terminal domain
species: Salmonella typhimurium [TaxId: 90371]
Probab=100.00  E-value=0  Score=733.82  Aligned_cols=334  Identities=30%  Similarity=0.455  Sum_probs=299.3

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCE--EECCCCCEEEEECCCCC-------------CCCC----CCCCC-CCCCCCCCCCCC
Q ss_conf             3425777899999861027640--23224417998216788-------------8877----78778-888776678777
Q gi|254780503|r  124 TYTPRNVLKRVLNFYAQNELKP--IIAPEIEFYLIAKNEDP-------------DYPL----QPPKG-RSGRSILGGQSY  183 (461)
Q Consensus       124 ~~~PR~iLkr~i~~l~~~G~~~--~~g~E~EF~L~~~~~~~-------------~~~~----~~~~~-~~~~~~~~~~~y  183 (461)
                      ..|||++|||++++++++|+++  .+|+|+|||||++....             ....    ....+ ........+.+|
T Consensus         1 ~~dPR~iLkr~~~~l~~~G~~~~~~~g~E~EF~Lf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (368)
T d1f52a2           1 DRDPRSIAKRAEDYLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNSSTKYEGGNKGHRPGVKGGYF   80 (368)
T ss_dssp             TTCHHHHHHHHHHHHHHHTSCSEEEEEEEEEEEEESEEEEEEETTEEEEEEECTTCGGGGGCCCTTCCCCCCCCTTCCSS
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEECEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEE
T ss_conf             98879999999999997699870378854288999421035576777565577322456887666887787655577615


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCCHHHHHCCCC-CCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCC
Q ss_conf             7665442899999899767863110221010127-864201112665211378999999999999863066033112321
Q gi|254780503|r  184 SIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEEG-PAQFEINIRHGDPLKLADQVFLFKRTIREAAFKHDIYATFMAKPM  262 (461)
Q Consensus       184 ~~~~~~~~~~~l~~i~~~l~~~Gi~ve~~~~E~g-pGQ~Ei~~~~~~~l~aaD~~~~~k~~ik~vA~~~G~~atFmpKP~  262 (461)
                      ++...+..++|+++|++.|+.+||+||++|+|+| ||||||++.|+++|+|||+++++|++||+||++||++|||||||+
T Consensus        81 ~~~~~~~~~~~~~~i~~~l~~~Gi~ve~~~~E~~~~gq~Ei~~~~~~~l~aAD~~~~~k~~ik~iA~~~Gl~atFmpKP~  160 (368)
T d1f52a2          81 PVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYKYVVHNVAHRFGKTATFMPKPM  160 (368)
T ss_dssp             BCTTSSCCHHHHHHHHHHHHHTTCCEEEEEECSSTTTEEEEEECCEEHHHHHHHHHHHHHHHHHHHHHTTCEEECCSCSS
T ss_pred             EEECCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCC
T ss_conf             53001107889999999888622570564223456784322078786577889999999999999997436334741568


Q ss_pred             CCCCCHHHHHHHHHHHCCCCCCCCCCC-CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             135662689998763136874233588-6552156665457776422321222076610134420465575433424334
Q gi|254780503|r  263 QNYPGSAMHIHQSVLDIKSNQNIFSNP-DGSETDNFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDN  341 (461)
Q Consensus       263 ~~~~GsG~H~h~SL~d~~~g~n~f~~~-~~~ls~~~~~fiaGil~h~~al~a~~~PtvNSYkRl~p~~~ap~~~~WG~~N  341 (461)
                      .+.+|||||+|+|||+  +|+|+|+++ .+++|+++++||||||+|++++++|+|||+||||||+|++|||++++||.+|
T Consensus       161 ~~~~GsG~HiH~Sl~~--~~~n~~~~~~~~~lS~~~~~fiaGll~~~~~~~al~~PtvNSYkRl~~~~~aP~~~~Wg~~N  238 (368)
T d1f52a2         161 FGDNGSGMHCHMSLAK--NGTNLFSGDKYAGLSEQALYYIGGVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARN  238 (368)
T ss_dssp             TTSCCCCEEEEEEEEE--TTEETTBCSSGGGBCHHHHHHHHHHHHTHHHHHHHHSCSGGGGGTSSSCSSCCCEEEEESSC
T ss_pred             CCCCCCCEEEEEEECC--CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEEECCCC
T ss_conf             8987753258987415--99856565555564899999999999866998999779960776524777687434523676


Q ss_pred             CCEEEEECC-CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC-------CHHCCCCCHHHHH
Q ss_conf             500365022-38865203530358779989999999999999898468887433453000-------3110478989999
Q gi|254780503|r  342 RTTAFRIPF-SDAKTKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSANQ-------EAINLPRGLLEAV  413 (461)
Q Consensus       342 R~~~iRip~-~~~~~~riE~R~~d~~aNPYL~laail~agl~Gi~~~l~p~~~~~~~~~~-------~~~~LP~sL~eAl  413 (461)
                      |+++||||. ++++++|||+|++|++|||||++||+|+|||+||+++++|++|+.+|+++       +.++||.||.|||
T Consensus       239 R~a~iRi~~~~~~~~~riE~R~~da~aNPYL~lAa~laagl~Gi~~~l~~~~~~~~~~~~~~~~~~~~~~~lP~sl~eAl  318 (368)
T d1f52a2         239 RSASIRIPVVASPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYDLPPEEAKEIPQVAGSLEEAL  318 (368)
T ss_dssp             TTEEEECCCCSCGGGCCEEECCCCTTSCHHHHHHHHHHHHHHHHHTTCCCCSCCCSCCSSSCCSSTTCCCBCCSSHHHHH
T ss_pred             CCCCEEECCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHCCHHHHHCHHCCCCCHHHHH
T ss_conf             55314640257886624784478801777899999999765424215899997778724489767623201513799999


Q ss_pred             HHHHCCHHHHH---HCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             99865989887---35589999999999999999863899789987631
Q gi|254780503|r  414 TLLENTSHFKD---IFGSQFIDMYANLKRNEFETFMQVISPWEREFLLL  459 (461)
Q Consensus       414 ~~l~~d~~l~~---~lg~~~v~~~~~~k~~E~~~~~~~vt~wE~~~yl~  459 (461)
                      ++|++|+.+++   +||++||+.|+++||+||++|+++||+||+++||.
T Consensus       319 ~al~~d~~~~~a~~~lGe~~v~~y~~~K~~E~~~~~~~vt~wE~~~Yl~  367 (368)
T d1f52a2         319 NALDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYS  367 (368)
T ss_dssp             HHHHHTCHHHHGGGSSCHHHHHHHHHHHHHHHHHHHHSCCHHHHHHHTT
T ss_pred             HHHHCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCC
T ss_conf             9996497878876515699999999999999999967999999974168



>d2bvca2 d.128.1.1 (A:105-478) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f52a1 d.15.9.1 (A:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bvca1 d.15.9.1 (A:5-104) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r8ga_ d.128.1.3 (A:) Carboxylate-amine ligase YbdK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 461 putative glutamine synthetase [Candidatus Liberiba
2bvc_A_115-416302 (A:115-416) Glutamine synthetase 1; ligase, transi 7e-49
1f52_A_99-399301 (A:99-399) Glutamine synthetase; ADP, MPD, ligase; 5e-46
3fky_A_107-370264 (A:107-370) Glutamine synthetase; beta-grAsp, cata 7e-44
2d3a_A_105-356252 (A:105-356) Glutamine synthetase; ligase; HET: P3S 1e-43
2ojw_A_129-384256 (A:129-384) Glutamine synthetase; amino-acid biosy 8e-42
2j9i_A_96-127_223-358168 (A:96-127,A:223-358) Glutamate-ammonia ligase doma 1e-32
1f52_A_1-9898 (A:1-98) Glutamine synthetase; ADP, MPD, ligase; H 6e-19
2bvc_A_1-114114 (A:1-114) Glutamine synthetase 1; ligase, transiti 1e-17
2j9i_A_1-9595 (A:1-95) Glutamate-ammonia ligase domain-containin 6e-17
2j9i_A_128-22295 (A:128-222) Glutamate-ammonia ligase domain-contai 3e-16
2j9i_A_359-42163 (A:359-421) Glutamate-ammonia ligase domain-contai 1e-09
>2bvc_A (A:115-416) Glutamine synthetase 1; ligase, transition state mimic; HET: P3S ADP; 2.1A {Mycobacterium tuberculosis}Length = 302 Back     alignment and structure
 Score =  189 bits (480), Expect = 7e-49
 Identities = 83/298 (27%), Positives = 123/298 (41%), Gaps = 26/298 (8%)

Query: 127 PRNVLKRVLNFYAQNELKPI--IAPEIEFYLI---------------------AKNEDPD 163
           PRN+ ++  N+     +        E EFY+                        N    
Sbjct: 2   PRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAA 61

Query: 164 YPLQPPKGRSGRSILGGQSYSIMGINEFDEIIDDIWKFSEKQGLEIDTLIHEE-GPAQFE 222
                   R  +    G  + +   +++ ++ D +       G  ++   HE     Q E
Sbjct: 62  TEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAE 121

Query: 223 INIRHGDPLKLADQVFLFKRTIREAAFKHDIYATFMAKPMQNYPGSAMHIHQSVLDIKSN 282
           IN +    L  AD + L+K  I+  A+++    TFM KP+    GS MH HQS+    + 
Sbjct: 122 INYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAP 181

Query: 283 QNIFSNPDGSETDNFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNR 342
                      +D  R++IGGL  + P+ L    P  NSY+RLV     P+N  +   NR
Sbjct: 182 LMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNR 241

Query: 343 TTAFRIPFS--DAKTKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSA 398
           +   RIP +  + K KR+E R P S  NPYL  +A L  GL GI  KIEP  P  K  
Sbjct: 242 SACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDL 299


>1f52_A (A:99-399) Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A {Salmonella typhimurium}Length = 301 Back     alignment and structure
>3fky_A (A:107-370) Glutamine synthetase; beta-grAsp, catalytic domain, acetylation, cytoplasm, ligase, UBL conjugation; HET: FLC; 2.95A {Saccharomyces cerevisiae}Length = 264 Back     alignment and structure
>2d3a_A (A:105-356) Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea mays} PDB: 2d3b_A* 2d3c_A*Length = 252 Back     alignment and structure
>2ojw_A (A:129-384) Glutamine synthetase; amino-acid biosynthesis, ligase, structural genomics, structural genomics consortium, SGC; HET: ADP; 2.05A {Homo sapiens} PDB: 2qc8_A* 2uu7_ALength = 256 Back     alignment and structure
>2j9i_A (A:96-127,A:223-358) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus}Length = 168 Back     alignment and structure
>1f52_A (A:1-98) Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A {Salmonella typhimurium}Length = 98 Back     alignment and structure
>2bvc_A (A:1-114) Glutamine synthetase 1; ligase, transition state mimic; HET: P3S ADP; 2.1A {Mycobacterium tuberculosis}Length = 114 Back     alignment and structure
>2j9i_A (A:1-95) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus}Length = 95 Back     alignment and structure
>2j9i_A (A:128-222) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus}Length = 95 Back     alignment and structure
>2j9i_A (A:359-421) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus}Length = 63 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target461 putative glutamine synthetase [Candidatus Liberibacter
1f52_A_99-399301 Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 100.0
2bvc_A_115-416302 Glutamine synthetase 1; ligase, transition state m 100.0
3fky_A_107-370264 Glutamine synthetase; beta-grAsp, catalytic domain 100.0
2ojw_A_129-384256 Glutamine synthetase; amino-acid biosynthesis, lig 100.0
2d3a_A_105-356252 Glutamine synthetase; ligase; HET: P3S ADP; 2.63A 100.0
1r8g_A_372 Hypothetical protein YBDK; structural genomics, un 98.3
2j9i_A_96-127_223-358168 Glutamate-ammonia ligase domain-containing protein 100.0
2j9i_A_128-22295 Glutamate-ammonia ligase domain-containing protein 99.84
2bvc_A_1-114114 Glutamine synthetase 1; ligase, transition state m 99.83
1f52_A_1-9898 Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 99.82
2j9i_A_1-9595 Glutamate-ammonia ligase domain-containing protein 99.79
3fky_A_1-106106 Glutamine synthetase; beta-grAsp, catalytic domain 98.14
2d3a_A_1-104104 Glutamine synthetase; ligase; HET: P3S ADP; 2.63A 97.91
2ojw_A_42-12887 Glutamine synthetase; amino-acid biosynthesis, lig 97.81
2j9i_A_359-42163 Glutamate-ammonia ligase domain-containing protein 99.18
2gwd_A_1-422422 Glutamate cysteine ligase; disulfide bridges, glut 98.3
1va6_A_19-156_243-337_461-481254 Glutamate--cysteine ligase; glutathione homeostasi 95.86
2d3a_A_105-356252 Glutamine synthetase; ligase; HET: P3S ADP; 2.63A 94.96
>1f52_A (A:99-399) Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A {Salmonella typhimurium} Back     alignment and structure
Probab=100.00  E-value=0  Score=606.11  Aligned_cols=277  Identities=29%  Similarity=0.443  Sum_probs=248.9

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCC--EEECCCCCEEEEECCCCCCCCC-----------------CC-CCCCCCCCCCCCC
Q ss_conf             12342577789999986102764--0232244179982167888877-----------------78-7788887766787
Q gi|254780503|r  122 EVTYTPRNVLKRVLNFYAQNELK--PIIAPEIEFYLIAKNEDPDYPL-----------------QP-PKGRSGRSILGGQ  181 (461)
Q Consensus       122 p~~~~PR~iLkr~i~~l~~~G~~--~~~g~E~EF~L~~~~~~~~~~~-----------------~~-~~~~~~~~~~~~~  181 (461)
                      .|+.|||++|||++++++++|+.  +++|+|+|||||++..+.....                 .. .......+..+++
T Consensus         1 ~~~~~pR~vLkr~~~~l~~~G~~~~~~~g~E~EF~lf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (301)
T 1f52_A            1 GYDRDPRSIAKRAEDYLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNSSTKYEGGNKGHRPGVKGG   80 (301)
T ss_dssp             CCTTCHHHHHHHHHHHHHHHTSCSEEEEEEEEEEEEESEEEEEEETTEEEEEEECTTCGGGGGCCCTTCCCCCCCCTTCC
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             58889699999999999981996313434534799974443455666663344641113567876667887876576653


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHCCHHHH-HCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEECCC
Q ss_conf             7776654428999998997678631102210-101278642011126652113789999999999998630660331123
Q gi|254780503|r  182 SYSIMGINEFDEIIDDIWKFSEKQGLEIDTL-IHEEGPAQFEINIRHGDPLKLADQVFLFKRTIREAAFKHDIYATFMAK  260 (461)
Q Consensus       182 ~y~~~~~~~~~~~l~~i~~~l~~~Gi~ve~~-~~E~gpGQ~Ei~~~~~~~l~aaD~~~~~k~~ik~vA~~~G~~atFmpK  260 (461)
                      +|++.+.+..+++++++++.|+++||+|+++ |+|+||||+||++.|+++|++||+++++|++||+||++||+.||||||
T Consensus        81 ~~~~~~~~~~~~~~~~i~~~l~~~Gi~v~~~~h~E~~~gQ~Ei~~~~~~~l~aAD~~~~~r~~ik~vA~~~G~~atFmpK  160 (301)
T 1f52_A           81 YFPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYKYVVHNVAHRFGKTATFMPK  160 (301)
T ss_dssp             SSBCTTSSCCHHHHHHHHHHHHHTTCCEEEEEECSSTTTEEEEEECCEEHHHHHHHHHHHHHHHHHHHHHTTCEEECCSC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHCCEEEECCC
T ss_conf             02677420078999999999997699717755022367877995067878888999999999999999984987897166


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCC-CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCCCCCCCCCC
Q ss_conf             211356626899987631368742335-8865521566654577764223212220766101344204655754334243
Q gi|254780503|r  261 PMQNYPGSAMHIHQSVLDIKSNQNIFS-NPDGSETDNFRYFIGGLQKYIPNALVMLAPYGNSYRRLVLDMGCPVNNAWGY  339 (461)
Q Consensus       261 P~~~~~GsG~H~h~SL~d~~~g~n~f~-~~~~~ls~~~~~fiaGil~h~~al~a~~~PtvNSYkRl~p~~~ap~~~~WG~  339 (461)
                      |+.+.+|||||+|+|||+ + +.|+|. ++.+++|+.+++||||||+|++++++|++||+||||||+|++|||++++||.
T Consensus       161 P~~~~~Gsg~H~h~Sl~~-~-~~n~~~~~~~~~lS~~~~~fiaGil~h~~~l~a~~~pt~nSY~Rl~~~~~ap~~~~wG~  238 (301)
T 1f52_A          161 PMFGDNGSGMHCHMSLAK-N-GTNLFSGDKYAGLSEQALYYIGGVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSA  238 (301)
T ss_dssp             SSTTSCCCCEEEEEEEEE-T-TEETTBCSSGGGBCHHHHHHHHHHHHTHHHHHHHHSCSGGGGGTSSSCSSCCCEEEEES
T ss_pred             CCCCCCCCEEEEEECCCC-C-CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCCCCCEECC
T ss_conf             679999661479972456-9-98667777765522999999999999999977643799863321579865777531236


Q ss_pred             CCCCEEEEECCC-CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             345003650223-8865203530358779989999999999999898468887433453000
Q gi|254780503|r  340 DNRTTAFRIPFS-DAKTKRIENRLPSSDTNPYLVLAASLACGLLGILQKIEPTPPTMKSANQ  400 (461)
Q Consensus       340 ~NR~~~iRip~~-~~~~~riE~R~~d~~aNPYL~laail~agl~Gi~~~l~p~~~~~~~~~~  400 (461)
                      +||+++||||.. +.+++|||+|++|++|||||++|+||+||++||+++++||+|+.+|+|+
T Consensus       239 ~NR~a~iRvp~~~~~~~~r~E~R~~da~aNPYl~lAail~agl~Gi~~~l~~~~~~~~~~~e  300 (301)
T 1f52_A          239 RNRSASIRIPVVASPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYD  300 (301)
T ss_dssp             SCTTEEEECCCCSCGGGCCEEECCCCTTSCHHHHHHHHHHHHHHHHHTTCCCCSCCCSCCSS
T ss_pred             CCCCCEEEECCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             67753088303689877667863788887899999999999999998479999888786244



>2bvc_A (A:115-416) Glutamine synthetase 1; ligase, transition state mimic; HET: P3S ADP; 2.1A {Mycobacterium tuberculosis} Back     alignment and structure
>3fky_A (A:107-370) Glutamine synthetase; beta-grAsp, catalytic domain, acetylation, cytoplasm, ligase, UBL conjugation; HET: FLC; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojw_A (A:129-384) Glutamine synthetase; amino-acid biosynthesis, ligase, structural genomics, structural genomics consortium, SGC; HET: ADP; 2.05A {Homo sapiens} PDB: 2qc8_A* 2uu7_A Back     alignment and structure
>2d3a_A (A:105-356) Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea mays} PDB: 2d3b_A* 2d3c_A* Back     alignment and structure
>1r8g_A (A:) Hypothetical protein YBDK; structural genomics, unknown function, carboxylate-amine ligase, structure 2 function project, S2F; 2.15A {Escherichia coli} Back     alignment and structure
>2j9i_A (A:96-127,A:223-358) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus} Back     alignment and structure
>2j9i_A (A:128-222) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus} Back     alignment and structure
>2bvc_A (A:1-114) Glutamine synthetase 1; ligase, transition state mimic; HET: P3S ADP; 2.1A {Mycobacterium tuberculosis} Back     alignment and structure
>1f52_A (A:1-98) Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A {Salmonella typhimurium} Back     alignment and structure
>2j9i_A (A:1-95) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus} Back     alignment and structure
>3fky_A (A:1-106) Glutamine synthetase; beta-grAsp, catalytic domain, acetylation, cytoplasm, ligase, UBL conjugation; HET: FLC; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2d3a_A (A:1-104) Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea mays} PDB: 2d3b_A* 2d3c_A* Back     alignment and structure
>2ojw_A (A:42-128) Glutamine synthetase; amino-acid biosynthesis, ligase, structural genomics, structural genomics consortium, SGC; HET: ADP; 2.05A {Homo sapiens} PDB: 2qc8_A* 2uu7_A Back     alignment and structure
>2j9i_A (A:359-421) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus} Back     alignment and structure
>2gwd_A (A:1-422) Glutamate cysteine ligase; disulfide bridges, glutathione biosynthesis, beta-hairpin, redox regulation; HET: GLU; 2.09A {Brassica juncea} PDB: 2gwc_A* Back     alignment and structure
>1va6_A (A:19-156,A:243-337,A:461-481) Glutamate--cysteine ligase; glutathione homeostasis, beta barrel, peptide synthesis, transition state analogue; HET: P2S ADP P6G; 2.10A {Escherichia coli} Back     alignment and structure
>2d3a_A (A:105-356) Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea mays} PDB: 2d3b_A* 2d3c_A* Back     alignment and structure