254780512

254780512

flagellar biosynthesis protein FlhA

GeneID in NCBI database:8209507Locus tag:CLIBASIA_01995
Protein GI in NCBI database:254780512Protein Accession:YP_003064925.1
Gene range:+(764293, 766371)Protein Length:692aa
Gene description:flagellar biosynthesis protein FlhA
COG prediction:none
KEGG prediction:flhA; flagellar biosynthesis protein FlhA; K02400 flagellar biosynthesis protein FlhA
SEED prediction:Flagellar biosynthesis protein FlhA
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM7 TM-Helix
TOPPRED9 TM-Helix
HMMTOP7 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM5 TM-Helix
PHOBIUS9 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690--
MIQSLIGISDSNDRNHLHDFAFSFCIVLIICILFLPIPTVLLDVGLASSIALSILILMVALWIEKPLEFSSFPTVLLIVTIIRLSLNIATTRAILSFGHEGYGAAGGIIAGFSSLVMSGDFVIGLVVFMILITINFIVITKGATRIAEVGARFTLDAIPGKQMAIDADLSSGLIEEEEAKRRRKELEEESAFFGAMDGASKFVRGDAIASIIITAINIVGGIVIGCFRYDMSIHHAADVFVRLSVGDGLVSQVPALIISLSAAFLVSRTTSKGSTNTAIVEQLSHYPRALLISAFFMIVLSVMPNLPAFPFIMLGGFFACAGFYVPYKNELQRLAKVAQIQEASKQNQHSAQLNFITSGVELVLGSLVSNRLLSSQEDLFLRVSKIRRKFAVQYGFIVPEIKVTTDISLPEKGYTIRVYGTTVAISELRVGEVLVILGSGQKPTFPGDEVKEPAFGMPAFAIMESFSDDLRRQGFHPIDNLAVVLTHLSEVIRNNLSQLLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQAVLKLLLAEHVSIRNLPLILESIAEVAPHSRKTSHIVEQVRIRMAQQICGDLAPTGILNILKLGNHWDMIFYQAIQRDSKGECVDFNVEPRAVEMFSENATNSIRQYIDKGIPLTIVTLPEIRSYIRMILERNFPSLAVLSHMEIAKGLKVNILGTIS
ccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccHHHcccccccHHHHHHHHccccccccHHHccccHHHHHHHcEEEEEccHHHHHHHHHHHHHHHHHEEEEcccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccHHHccHHHHHHccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccEEEEEcccccccEEEEEEEEEEEEEEEEEcccEEEEcccccccccccEEcccccccccEEEEcHHHHHHHHHcccEEEEHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHcccccEEEHHHcccccEEEEEEEEc
ccHHHHcccHHcccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHcHHHHHHHHHHHHHHHHcHHccHEHHHccccccHHHccHHHHHccEEEccHHHHHHHHHHHHHHHHHHHEccccccEEEEEEEEEcccccccccEEEcccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHEEcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccHHccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccEEEEEEEEEEEEEEEccccEEEEccccccccccccccccccccccEEEEcHHHHHHHHHcccEEEcHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEcHHHHHHHHHHHHHHccccEEEEEEEcccccEEEEEEEEc
miqsligisdsndrnhlhdfAFSFCIVLIICILflpiptvlLDVGLASSIALSILILMVALWIEkplefssfptVLLIVTIIRLSLNIATTRAILsfghegygaaggIIAGFSSLVMSGDFVIGLVVFMILITINFIVITKGATRIAEVGarftldaipgkqmaidadlssglieEEEAKRRRKELEEESaffgamdgaskfvrgDAIASIIITAINIVGGIVIGCfrydmsihhAADVFVRLSVGDGLVSQVPALIISLSAAFLVSrttskgstnTAIVEQLSHYPRALLISAFFMIVLSvmpnlpafpfimlggffacagfyvpyKNELQRLAKVAQIQEASKQNQHSAQLNFITSGVELVLGSLVSNRLLSSQEDLFLRVSKIRRKFAVQYGfivpeikvttdislpekgytIRVYGTTVAISELRVGEVLVILgsgqkptfpgdevkepafgmpafAIMESFSDDlrrqgfhpidnLAVVLTHLSEVIRNNLSQLLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQAVLKLLLAEHVSIRNLPLILESIAevaphsrktsHIVEQVRIRMAQQICgdlaptgiLNILKLGNHWDMIFYQAIQrdskgecvdfnvepRAVEMFSENATNSIRQYidkgipltivtLPEIRSYIRMILERNFPSLAVLSHMEIAKGLKVNILGTIS
MIQSLIGISDSNDRNHLHDFAFSFCIVLIICILFLPIPTVLLDVGLASSIALSILILMVALWIEKPLEFSSFPTVLLIVTIIRLSLNIATTRAILSFGHEGYGAAGGIIAGFSSLVMSGDFVIGLVVFMILITINFIVITKGATRIAEVGARftldaipgkqmaidadlssgliEEEEAKRRRKELEeesaffgamdgaskFVRGDAIASIIITAINIVGGIVIGCFRYDMSIHHAADVFVRLSVGDGLVSQVPALIISLSAAFLVSRTTSKGSTNTAIVEQLSHYPRALLISAFFMIVLSVMPNLPAFPFIMLGGFFACAGFYVPYKNELQRLAKVAQIQEASKQNQHSAQLNFITSGVELVLGSLVSNRLLSSQEDLFLRVSKIRRKFavqygfivpeikvttdislpekgYTIRVYGTTVAISELRVGEVLVILGSGQKPTFPGDEVKEPAFGMPAFAIMESFSDDLRRQGFHPIDNLAVVLTHLSEVIRNNLSQLLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQAVLKLLLAEHVSIRNLPLILESIAEVAPHSRKTSHIVEQVRIRMAQQICGDLAPTGILNILKLGNHWDMIFYQAIQRDSKGECVDFNVEPRAVEMFSENATNSirqyidkgipltIVTLPEIRSYIRMILERNFPSLAVLSHmeiakglkvnilgtis
MIQSLIGISDSNDRNHLHDFAFSfcivliicilflpipTVLLDVGlassialsililmvalWIEKPLEFSSFPTVLLIVTIIRLSLNIATTRAILSFGHEgygaaggiiagFSSLVMSGDFVIGLVVFMILITINFIVITKGATRIAEVGARFTLDAIPGKQMAIDADLSSGLIeeeeakrrrkeleeeSAFFGAMDGASKFVRGDaiasiiitainivggivigCFRYDMSIHHAADVFVRLSVGDGLVSQVPALIISLSAAFLVSRTTSKGSTNTAIVEQLSHYPRALLISAFFMIVLSVMPNLPAFPFIMLGGFFACAGFYVPYKNELQRLAKVAQIQEASKQNQHSAQLNFITSGVELVLGSLVSNRLLSSQEDLFLRVSKIRRKFAVQYGFIVPEIKVTTDISLPEKGYTIRVYGTTVAISELRVGEVLVILGSGQKPTFPGDEVKEPAFGMPAFAIMESFSDDLRRQGFHPIDNLAVVLTHLSEVIRNNLSQLLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQAVLKLLLAEHVSIRNLPLILESIAEVAPHSRKTSHIVEQVRIRMAQQICGDLAPTGILNILKLGNHWDMIFYQAIQRDSKGECVDFNVEPRAVEMFSENATNSIRQYIDKGIPLTIVTLPEIRSYIRMILERNFPSLAVLSHMEIAKGLKVNILGTIS
****************LHDFAFSFCIVLIICILFLPIPTVLLDVGLASSIALSILILMVALWIEKPLEFSSFPTVLLIVTIIRLSLNIATTRAILSFGHEGYGAAGGIIAGFSSLVMSGDFVIGLVVFMILITINFIVITKGATRIAEVGARFTLDAIPGKQMAIDADLSSGLIEEEEAKRRRKELEEESAFFGAMDGASKFVRGDAIASIIITAINIVGGIVIGCFRYDMSIHHAADVFVRLSVGDGLVSQVPALIISLSAAFLVSRTTSK**TNTAIVEQLSHYPRALLISAFFMIVLSVMPNLPAFPFIMLGGFFACAGF********************************ITSGVELVLGSLVSNRLLSSQEDLFLRVSKIRRKFAVQYGFIVPEIKVTTDISLPEKGYTIRVYGTTVAISELRVGEVLVILGSGQKPTFPGDEVKEPAFGMPAFAIMESFSDDLRRQGFHPIDNLAVVLTHLSEVIRNNLSQLLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQAVLKLLLAEHVSIRNLPLILESIAEVAPHSRKTSHIVEQVRIRMAQQICGDLAPTGILNILKLGNHWDMIFY**************NVEPRAVEMFSEN**********KGIPLTIVTLPEIRSYIRMILERNFPSLAVLSHMEIAKGLKVNILGTIS
MIQSLIGISDSNDRNHLHDFAFSFCIVLIICILFLPIPTVLLDVGLASSIALSILILMVALWIEKPLEFSSFPTVLLIVTIIRLSLNIATTRAILSFGHEGYGAAGGIIAGFSSLVMSGDFVIGLVVFMILITINFIVITKGATRIAEVGARFTLDAIPGKQMAIDADLSSGLIEE************ESAFFGAMDGASKFVRGDAIASIIITAINIVGGIVIGCFRYDMSIHHAADVFVRLSVGDGLVSQVPALIISLSAAFLVSRTTSKGSTNTAIVEQLSHYPRALLISAFFMIVLSVMPNLPAFPFIMLGGFFACAGFYVPYKNELQRLAKVAQ***********AQLNFITSGVELVLGSLVSNRLLSSQEDLFLRVSKIRRKFAVQYGFIVPEIKVTTDISLPEKGYTIRVYGTTVAISELRVGEVLVILGSGQKPTFPGDEVKEPAFGMPAFAIMESFSDDLRRQGFHPIDNLAVVLTHLSEVIRNNLSQLLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQAVLKLLLAEHVSIRNLPLILESIAEVAPHSRKTSHIVEQVRIRMAQQICGDLAPTGILNILKLGNHWDMIFYQAIQRDSKGECVDFNVEPRAVEMFSENATNSIRQYIDKGIPLTIVTLPEIRSYIRMILERNFPSLAVLSHMEIAKGLKVNILGTIS
*I***IGISDSNDRNHLHDFAFSFCIVLIICILFLPIPTVLLDVGLASSIALSILILMVALWIEKPLEFSSFPTVLLIVTIIRLSLNIATTRAILSFGHEGYGAAGGIIAGFSSLVMSGDFVIGLVVFMILITINFIVITKGATRIAEVGARFTLDAIPGKQMAIDADLSSGLIEEEEAKRRRKELEEESAFFGAMDGASKFVRGDAIASIIITAINIVGGIVIGCFRYDMSIHHAADVFVRLSVGDGLVSQVPALIISLSAAFLVSRTTSKGSTNTAIVEQLSHYPRALLISAFFMIVLSVMPNLPAFPFIMLGGFFACAGFYVPYKNELQRLA*****************LNFITSGVELVLGSLVSNRLLSSQEDLFLRVSKIRRKFAVQYGFIVPEIKVTTDISLPEKGYTIRVYGTTVAISELRVGEVLVILGSGQKPTFPGDEVKEPAFGMPAFAIMESFSDDLRRQGFHPIDNLAVVLTHLSEVIRNNLSQLLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQAVLKLLLAEHVSIRNLPLILESIAEVAPHSRKTSHIVEQVRIRMAQQICGDLAPTGILNILKLGNHWDMIFYQAIQRDSKGECVDFNVEPRAVEMFSENATNSIRQYIDKGIPLTIVTLPEIRSYIRMILERNFPSLAVLSHMEIAKGLKVNILGTIS
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQSLIGISDSNDRNHLHDFAFSFCIVLIICILFLPIPTVLLDVGLASSIALSILILMVALWIEKPLEFSSFPTVLLIVTIIRLSLNIATTRAILSFGHEGYGAAGGIIAGFSSLVMSGDFVIGLVVFMILITINFIVITKGATRIAEVGARFTLDAIPGKQMAIDADxxxxxxxxxxxxxxxxxxxxxSAFFGAMDGASKFVRGDAIASIIITAINIVGGIVIGCFRYDMSIHHAADVFVRLSVGDGLVSQVPALIISLSAAFLVSRTTSKGSTNTAIVEQLSHYPRALLISAFFMIVLSVMPNLPAFPFIMLGGFFACAGFYVPYKNELQRLAKVAQIQEASKQNQHSAQLNFITSGVELVLGSLVSNRLLSSQEDLFLRVSKIRRKFAVQYGFIVPEIKVTTDISLPEKGYTIRVYGTTVAISELRVGEVLVILGSGQKPTFPGDEVKEPAFGMPAFAIMESFSDDLRRQGFHPIDNLAVVLTHLSEVIRNNLSQLLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQAVLKLLLAEHVSIRNLPLILESIAEVAPHSRKTSHIVEQVRIRMAQQICGDLAPTGILNILKLGNHWDMIFYQAIQRDSKGECVDFNVEPRAVEMFSENATNSIRQYIDKGIPLTIVTLPEIRSYIRMILERNFPSLAVLSHMEIAKGLKVNILGTIS
MIQSLIGISDSNDRNHLHDFAFSFCIVLIICILFLPIPTVLLDVGLASSIALSILILMVALWIEKPLEFSSFPTVLLIVTIIRLSLNIATTRAILSFGHEGYGAAGGIIAGFSSLVMSGDFVIGLVVFMILITINFIVITKGATRIAEVGARFTLDAIPGKQMAIDADLSSGLIEEEEAKRRRKELEEESAFFGAMDGASKFVRGDAIASIIITAINIVGGIVIGCFRYDMSIHHAADVFVRLSVGDGLVSQVPALIISLSAAFLVSRTTSKGSTNTAIVEQLSHYPRALLISAFFMIVLSVMPNLPAFPFIMLGGFFACAGFYVPYKNELQRLAKVAQIQEASKQNQHSAQLNFITSGVELVLGSLVSNRLLSSQEDLFLRVSKIRRKFAVQYGFIVPEIKVTTDISLPEKGYTIRVYGTTVAISELRVGEVLVILGSGQKPTFPGDEVKEPAFGMPAFAIMESFSDDLRRQGFHPIDNLAVVLTHLSEVIRNNLSQLLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQAVLKLLLAEHVSIRNLPLILESIAEVAPHSRKTSHIVEQVRIRMAQQICGDLAPTGILNILKLGNHWDMIFYQAIQRDSKGECVDFNVEPRAVEMFSENATNSIRQYIDKGIPLTIVTLPEIRSYIRMILERNFPSLAVLSHMEIAKGLKVNILGTIS
MIQSLIGISDSNDRNHLHDFAFSFCIVLIICILFLPIPTVLLDVGLASSIALSILILMVALWIEKPLEFSSFPTVLLIVTIIRLSLNIATTRAILSFGHEGYGAAGGIIAGFSSLVMSGDFVIGLVVFMILITINFIVITKGATRIAEVGARFTLDAIPGKQMAIDADLSSGLIEEEEAKRRRKELEEESAFFGAMDGASKFVRGDAIASIIITAINIVGGIVIGCFRYDMSIHHAADVFVRLSVGDGLVSQVPALIISLSAAFLVSRTTSKGSTNTAIVEQLSHYPRALLISAFFMIVLSVMPNLPAFPFIMLGGFFACAGFYVPYKNELQRLAKVAQIQEASKQNQHSAQLNFITSGVELVLGSLVSNRLLSSQEDLFLRVSKIRRKFAVQYGFIVPEIKVTTDISLPEKGYTIRVYGTTVAISELRVGEVLVILGSGQKPTFPGDEVKEPAFGMPAFAIMESFSDDLRRQGFHPIDNLAVVLTHLSEVIRNNLSQLLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQAVLKLLLAEHVSIRNLPLILESIAEVAPHSRKTSHIVEQVRIRMAQQICGDLAPTGILNILKLGNHWDMIFYQAIQRDSKGECVDFNVEPRAVEMFSENATNSIRQYIDKGIPLTIVTLPEIRSYIRMILERNFPSLAVLSHMEIAKGLKVNILGTIS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target692 flagellar biosynthesis protein FlhA [Candidatus Liberib
315122291692 flagellar biosynthesis protein FlhA [Candidatus Liberib 1 0.0
222084892695 flagellar biosynthesis protein FlhA [Agrobacterium radi 1 0.0
159184372695 flagellar biosynthesis protein FlhA [Agrobacterium tume 1 0.0
241203131695 flagellar biosynthesis protein FlhA [Rhizobium legumino 1 0.0
327193068695 flagellar biosynthesis transmembrane protein [Rhizobium 1 0.0
190890389695 flagellar biosynthesis transmembrane protein [Rhizobium 1 0.0
222147596696 flagellar biosynthesis protein FlhA [Agrobacterium viti 1 0.0
86356337695 flagellar biosynthesis protein FlhA [Rhizobium etli CFN 1 0.0
325291969695 flagellar biosynthesis protein FlhA [Agrobacterium sp. 1 0.0
163758039695 flagellar biosynthesis protein [Hoeflea phototrophica D 1 0.0
>gi|315122291|ref|YP_004062780.1| flagellar biosynthesis protein FlhA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 692 Back     alignment and organism information
 Score = 1094 bits (2830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/692 (82%), Positives = 638/692 (92%)

Query: 1   MIQSLIGISDSNDRNHLHDFAFSFCIVLIICILFLPIPTVLLDVGLASSIALSILILMVA 60
           M QSL+  SDSN+RNH+HDF+ SFCIVLIICILFLPIPT LLD+GLA SIALS+LILMVA
Sbjct: 1   MRQSLVRGSDSNNRNHVHDFSLSFCIVLIICILFLPIPTFLLDIGLAFSIALSVLILMVA 60

Query: 61  LWIEKPLEFSSFPTVLLIVTIIRLSLNIATTRAILSFGHEGYGAAGGIIAGFSSLVMSGD 120
           LWIEKPLEFSSFPT+LLIVTIIRLSLNIA TRAILSFGHEGYGAAGGIIAGFSSLVMSGD
Sbjct: 61  LWIEKPLEFSSFPTILLIVTIIRLSLNIAITRAILSFGHEGYGAAGGIIAGFSSLVMSGD 120

Query: 121 FVIGLVVFMILITINFIVITKGATRIAEVGARFTLDAIPGKQMAIDADLSSGLIEEEEAK 180
           FVIGLVVF+ILITINFIVITKGATRIAEVGARFTLD+IPGKQMAIDADLSSGLI+E+EAK
Sbjct: 121 FVIGLVVFLILITINFIVITKGATRIAEVGARFTLDSIPGKQMAIDADLSSGLIDEDEAK 180

Query: 181 RRRKELEEESAFFGAMDGASKFVRGDAIASIIITAINIVGGIVIGCFRYDMSIHHAADVF 240
            RRK+LE ES+FFGAMDGASKFVRGDAIASIIITAINI+GGI+IGCFR+DMSIHHAADVF
Sbjct: 181 IRRKDLENESSFFGAMDGASKFVRGDAIASIIITAINILGGIIIGCFRHDMSIHHAADVF 240

Query: 241 VRLSVGDGLVSQVPALIISLSAAFLVSRTTSKGSTNTAIVEQLSHYPRALLISAFFMIVL 300
           VRLSVGDGLVSQ+PAL++SLSAA LVSRTTSKGSTNTAI+EQLS+YPRALLISAFFM +L
Sbjct: 241 VRLSVGDGLVSQIPALLVSLSAALLVSRTTSKGSTNTAIIEQLSNYPRALLISAFFMSIL 300

Query: 301 SVMPNLPAFPFIMLGGFFACAGFYVPYKNELQRLAKVAQIQEASKQNQHSAQLNFITSGV 360
           S +P LP FPF++LGGFFA +G+YVPYK E + +AK  Q ++  +QNQ +  LNF   G+
Sbjct: 301 SAIPTLPTFPFLILGGFFAFSGWYVPYKIEQENIAKTNQAKKHLEQNQDTTDLNFNVPGI 360

Query: 361 ELVLGSLVSNRLLSSQEDLFLRVSKIRRKFAVQYGFIVPEIKVTTDISLPEKGYTIRVYG 420
           ELVLGSLVS+RLLSS +DLF R SKIR+KFA +YG IVPEIKVTTDISLPEKGY I++YG
Sbjct: 361 ELVLGSLVSSRLLSSTKDLFFRASKIRKKFAKEYGLIVPEIKVTTDISLPEKGYHIKMYG 420

Query: 421 TTVAISELRVGEVLVILGSGQKPTFPGDEVKEPAFGMPAFAIMESFSDDLRRQGFHPIDN 480
           TTVAISELR+GEVLVI+GSGQ+PTFPGDEV+EPAFGM A +IMESF+DDLRRQGF PIDN
Sbjct: 421 TTVAISELRIGEVLVIVGSGQRPTFPGDEVQEPAFGMQAISIMESFADDLRRQGFQPIDN 480

Query: 481 LAVVLTHLSEVIRNNLSQLLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQAVLKLL 540
           L+V+LTHL+EVIRNNL QLLSYKDVKNLIS+LDPEY+KLA+E C+SH SYSGIQA+LK L
Sbjct: 481 LSVILTHLNEVIRNNLPQLLSYKDVKNLISKLDPEYKKLADEICTSHTSYSGIQAILKSL 540

Query: 541 LAEHVSIRNLPLILESIAEVAPHSRKTSHIVEQVRIRMAQQICGDLAPTGILNILKLGNH 600
           LAE VSIRNL LILESIAEVAPH RKTS IVEQVR+RMAQQICGDLA  GILNILKLGNH
Sbjct: 541 LAERVSIRNLQLILESIAEVAPHVRKTSQIVEQVRVRMAQQICGDLADAGILNILKLGNH 600

Query: 601 WDMIFYQAIQRDSKGECVDFNVEPRAVEMFSENATNSIRQYIDKGIPLTIVTLPEIRSYI 660
           WDMIFY+AIQRDSKGECVDFN+EPRA+E F E+ATN+IR+Y+++GIPL I+TLPEIRSY+
Sbjct: 601 WDMIFYKAIQRDSKGECVDFNIEPRAIEAFLEDATNAIREYVNQGIPLIIITLPEIRSYV 660

Query: 661 RMILERNFPSLAVLSHMEIAKGLKVNILGTIS 692
           RMIL R FPSLAVLSHMEIAK LK+NILG+IS
Sbjct: 661 RMILARTFPSLAVLSHMEIAKELKINILGSIS 692


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084892|ref|YP_002543421.1| flagellar biosynthesis protein FlhA [Agrobacterium radiobacter K84] Length = 695 Back     alignment and organism information
>gi|159184372|ref|NP_353607.2| flagellar biosynthesis protein FlhA [Agrobacterium tumefaciens str. C58] Length = 695 Back     alignment and organism information
>gi|241203131|ref|YP_002974227.1| flagellar biosynthesis protein FlhA [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 695 Back     alignment and organism information
>gi|327193068|gb|EGE59980.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CNPAF512] Length = 695 Back     alignment and organism information
>gi|190890389|ref|YP_001976931.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT 652] Length = 695 Back     alignment and organism information
>gi|222147596|ref|YP_002548553.1| flagellar biosynthesis protein FlhA [Agrobacterium vitis S4] Length = 696 Back     alignment and organism information
>gi|86356337|ref|YP_468229.1| flagellar biosynthesis protein FlhA [Rhizobium etli CFN 42] Length = 695 Back     alignment and organism information
>gi|325291969|ref|YP_004277833.1| flagellar biosynthesis protein FlhA [Agrobacterium sp. H13-3] Length = 695 Back     alignment and organism information
>gi|163758039|ref|ZP_02165127.1| flagellar biosynthesis protein [Hoeflea phototrophica DFL-43] Length = 695 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target692 flagellar biosynthesis protein FlhA [Candidatus Liberib
COG1298696 COG1298, FlhA, Flagellar biosynthesis pathway, componen 0.0
PRK12792694 PRK12792, flhA, flagellar biosynthesis protein FlhA; Re 0.0
PRK06012697 PRK06012, flhA, flagellar biosynthesis protein FlhA; Va 0.0
TIGR01398678 TIGR01398, FlhA, flagellar biosynthesis protein FlhA 0.0
TIGR01399677 TIGR01399, hrcV, type III secretion protein, HrcV famil 1e-128
COG4789689 COG4789, EscV, Type III secretory pathway, component Es 1e-124
PRK15337686 PRK15337, PRK15337, type III secretion system protein I 1e-114
PRK12720675 PRK12720, PRK12720, secretion system apparatus protein 1e-102
PRK05910584 PRK05910, PRK05910, type III secretion system protein; 6e-54
pfam00771658 pfam00771, FHIPEP, FHIPEP family 0.0
>gnl|CDD|31489 COG1298, FlhA, Flagellar biosynthesis pathway, component FlhA [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|183749 PRK12792, flhA, flagellar biosynthesis protein FlhA; Reviewed Back     alignment and domain information
>gnl|CDD|180350 PRK06012, flhA, flagellar biosynthesis protein FlhA; Validated Back     alignment and domain information
>gnl|CDD|162338 TIGR01398, FlhA, flagellar biosynthesis protein FlhA Back     alignment and domain information
>gnl|CDD|162339 TIGR01399, hrcV, type III secretion protein, HrcV family Back     alignment and domain information
>gnl|CDD|34399 COG4789, EscV, Type III secretory pathway, component EscV [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|185237 PRK15337, PRK15337, type III secretion system protein InvA; Provisional Back     alignment and domain information
>gnl|CDD|183699 PRK12720, PRK12720, secretion system apparatus protein SsaV; Provisional Back     alignment and domain information
>gnl|CDD|168293 PRK05910, PRK05910, type III secretion system protein; Validated Back     alignment and domain information
>gnl|CDD|144389 pfam00771, FHIPEP, FHIPEP family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 692 flagellar biosynthesis protein FlhA [Candidatus Liberib
TIGR01398713 FlhA flagellar biosynthesis protein FlhA; InterPro: IPR 100.0
PRK12792694 flhA flagellar biosynthesis protein FlhA; Reviewed 100.0
PRK06012691 flhA flagellar biosynthesis protein FlhA; Validated 100.0
pfam00771658 FHIPEP FHIPEP family. 100.0
PRK12720681 secretion system apparatus protein SsaV; Provisional 100.0
TIGR01399709 hrcV type III secretion protein, HrcV family; InterPro: 100.0
COG1298696 FlhA Flagellar biosynthesis pathway, component FlhA [Ce 100.0
COG4789689 EscV Type III secretory pathway, component EscV [Intrac 100.0
PRK05910583 type III secretion system protein; Validated 100.0
PRK10527125 hypothetical protein; Provisional 92.9
PRK06012691 flhA flagellar biosynthesis protein FlhA; Validated 92.87
>TIGR01398 FlhA flagellar biosynthesis protein FlhA; InterPro: IPR006301 These sequences describe the flagellar biosynthesis protein FlhA, one of a large number of genes associated with the biosynthesis of functional bacterial flagella Back     alignment and domain information
>PRK12792 flhA flagellar biosynthesis protein FlhA; Reviewed Back     alignment and domain information
>PRK06012 flhA flagellar biosynthesis protein FlhA; Validated Back     alignment and domain information
>pfam00771 FHIPEP FHIPEP family Back     alignment and domain information
>PRK12720 secretion system apparatus protein SsaV; Provisional Back     alignment and domain information
>TIGR01399 hrcV type III secretion protein, HrcV family; InterPro: IPR006302 Members of this family are closely homologous to the flagellar biosynthesis protein FlhA and should all participate in type III secretion systems Back     alignment and domain information
>COG1298 FlhA Flagellar biosynthesis pathway, component FlhA [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG4789 EscV Type III secretory pathway, component EscV [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05910 type III secretion system protein; Validated Back     alignment and domain information
>PRK10527 hypothetical protein; Provisional Back     alignment and domain information
>PRK06012 flhA flagellar biosynthesis protein FlhA; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target692 flagellar biosynthesis protein FlhA [Candidatus Liberib
3mix_A382 Crystal Structure Of The Cytosolic Domain Of B. Sub 1e-94
3a5i_A389 Structure Of The Cytoplasmic Domain Of Flha Length 5e-87
3myd_A365 Structure Of The Cytoplasmic Domain Of Flha From He 5e-75
2x49_A333 Crystal Structure Of The C-Terminal Domain Of Inva 7e-64
3lw9_A168 Structure Of A Cytoplasmic Domain Of Salmonella Inv 9e-15
>gi|299689237|pdb|3MIX|A Chain A, Crystal Structure Of The Cytosolic Domain Of B. Subtilis Flha Length = 382 Back     alignment and structure
 Score =  352 bits (903), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 97/375 (25%), Positives = 169/375 (45%), Gaps = 7/375 (1%)

Query: 322 GFYVPYKNELQRLAKVAQIQEASKQN---QHSAQLNFITSGVELVLGS-LVSNRLLSSQE 377
            + +    + +        +EA         S         +E   G  L+     +   
Sbjct: 8   AYTLSKSGKEKEEVDEILEEEAEVDELKSPESVVQLLHIDPIEFEFGYGLIPLADANQGG 67

Query: 378 DLFLRVSKIRRKFAVQYGFIVPEIKVTTDISLPEKGYTIRVYGTTVAISELRVGEVLVIL 437
           DL  R+  IRR+ A++ G ++P +++  +I+L    Y +++ G  VA  EL +   L + 
Sbjct: 68  DLLDRIVMIRRQLALELGLVIPVVRIRDNIALQPNEYRLKIKGNEVAKGELLLDHYLAMS 127

Query: 438 GSGQKPTFPGDEVKEPAFGMPAFAIMESFSDDLRRQGFHPIDNLAVVLTHLSEVIRNNLS 497
            + +     G E  EP+FG+PA  I E+  D+    G+  +D  +VV TH++E I+ +  
Sbjct: 128 PTPEDDLIEGIETVEPSFGLPAKWISEAVKDEADMLGYTVVDPASVVSTHITEKIKQHAH 187

Query: 498 QLLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQAVLKLLLAEHVSIRNLPLILESI 557
           +L+  ++ K LI  L   Y  L EE   + +S   IQ VL  LL E VSIRNL  I E++
Sbjct: 188 ELIGRQETKQLIDHLKESYPVLVEEVTPNPLSVGDIQKVLAKLLKEKVSIRNLVTIFETL 247

Query: 558 AEVAPHSRKTSHIVEQVRIRMAQQICGDLAPTGI-LNILKLGNHWDMIFYQAIQRDSKGE 616
           A+    +  +  + E  R  +A+QI    A     L ++      +      +Q+   G 
Sbjct: 248 ADYGKLTTDSDLLTEYTRQALAKQITAQFAKENEVLKVVTCSGRVEKAIADGVQQTEHGN 307

Query: 617 CVDFNVEPRAVEMFSENATNSIRQYIDKGIPLTIVTLPEIRSYIRMILERNFPSLAVLSH 676
               ++EP   E    +      Q   +     ++  P +R Y++ +LER FP L VLS+
Sbjct: 308 Y--LSLEPDISESIVRSVAKEAEQLSLRQETAILLCSPPVRMYVKQLLERYFPDLPVLSY 365

Query: 677 MEIAKGLKVNILGTI 691
            E+   ++V  +G +
Sbjct: 366 NELEANVEVQSIGVV 380


>gi|290789905|pdb|3A5I|A Chain A, Structure Of The Cytoplasmic Domain Of Flha Length = 389 Back     alignment and structure
>gi|296863729|pdb|3MYD|A Chain A, Structure Of The Cytoplasmic Domain Of Flha From Helicobacter Pylori Length = 365 Back     alignment and structure
>gi|292659541|pdb|2X49|A Chain A, Crystal Structure Of The C-Terminal Domain Of Inva Length = 333 Back     alignment and structure
>gi|296863567|pdb|3LW9|A Chain A, Structure Of A Cytoplasmic Domain Of Salmonella Inva Length = 168 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target692 flagellar biosynthesis protein FlhA [Candidatus Liberib
3mix_A382 Flagellar biosynthesis protein FLHA; flagella biosynthe 2e-71
3a5i_A389 Flagellar biosynthesis protein FLHA; four domains, thio 8e-70
2x49_A333 INVA, invasion protein INVA; protein transport, transpo 1e-67
3myd_A365 Flagellar biosynthesis protein FLHA; flagellar export, 4e-64
>3mix_A Flagellar biosynthesis protein FLHA; flagella biosynthesis, protein transport, type III secretion; 2.30A {Bacillus subtilis} Length = 382 Back     alignment and structure
 Score =  265 bits (678), Expect = 2e-71
 Identities = 97/375 (25%), Positives = 177/375 (47%), Gaps = 8/375 (2%)

Query: 324 YVPYKNELQRLAKVAQIQEASKQNQHSAQLNFI----TSGVELVLG-SLVSNRLLSSQED 378
           Y   K+  ++      ++E ++ ++  +  + +       +E   G  L+     +   D
Sbjct: 9   YTLSKSGKEKEEVDEILEEEAEVDELKSPESVVQLLHIDPIEFEFGYGLIPLADANQGGD 68

Query: 379 LFLRVSKIRRKFAVQYGFIVPEIKVTTDISLPEKGYTIRVYGTTVAISELRVGEVLVILG 438
           L  R+  IRR+ A++ G ++P +++  +I+L    Y +++ G  VA  EL +   L +  
Sbjct: 69  LLDRIVMIRRQLALELGLVIPVVRIRDNIALQPNEYRLKIKGNEVAKGELLLDHYLAMSP 128

Query: 439 SGQKPTFPGDEVKEPAFGMPAFAIMESFSDDLRRQGFHPIDNLAVVLTHLSEVIRNNLSQ 498
           + +     G E  EP+FG+PA  I E+  D+    G+  +D  +VV TH++E I+ +  +
Sbjct: 129 TPEDDLIEGIETVEPSFGLPAKWISEAVKDEADMLGYTVVDPASVVSTHITEKIKQHAHE 188

Query: 499 LLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQAVLKLLLAEHVSIRNLPLILESIA 558
           L+  ++ K LI  L   Y  L EE   + +S   IQ VL  LL E VSIRNL  I E++A
Sbjct: 189 LIGRQETKQLIDHLKESYPVLVEEVTPNPLSVGDIQKVLAKLLKEKVSIRNLVTIFETLA 248

Query: 559 EVAPHSRKTSHIVEQVRIRMAQQICGDLAP-TGILNILKLGNHWDMIFYQAIQRDSKGEC 617
           +    +  +  + E  R  +A+QI    A    +L ++      +      +Q+   G  
Sbjct: 249 DYGKLTTDSDLLTEYTRQALAKQITAQFAKENEVLKVVTCSGRVEKAIADGVQQTEHGN- 307

Query: 618 VDFNVEPRAVEMFSENATNSIRQYIDKGIPLTIVTLPEIRSYIRMILERNFPSLAVLSHM 677
              ++EP   E    +      Q   +     ++  P +R Y++ +LER FP L VLS+ 
Sbjct: 308 -YLSLEPDISESIVRSVAKEAEQLSLRQETAILLCSPPVRMYVKQLLERYFPDLPVLSYN 366

Query: 678 EIAKGLKVNILGTIS 692
           E+   ++V  +G + 
Sbjct: 367 ELEANVEVQSIGVVD 381


>3a5i_A Flagellar biosynthesis protein FLHA; four domains, thioredoxin-like fold, bacterial flagellum BIO bacterial flagellum protein export; 2.80A {Salmonella typhimurium} Length = 389 Back     alignment and structure
>2x49_A INVA, invasion protein INVA; protein transport, transport, pathogenesis; 1.50A {Salmonella enterica subsp} PDB: 2x4a_A* 3lw9_A Length = 333 Back     alignment and structure
>3myd_A Flagellar biosynthesis protein FLHA; flagellar export, type III secretion, cytoplasmic FRAG protein transport; 2.40A {Helicobacter pylori} Length = 365 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target692 flagellar biosynthesis protein FlhA [Candidatus Liberib
3mix_A382 Flagellar biosynthesis protein FLHA; flagella biosynthe 100.0
3a5i_A389 Flagellar biosynthesis protein FLHA; four domains, thio 100.0
3myd_A365 Flagellar biosynthesis protein FLHA; flagellar export, 100.0
2x49_A333 INVA, invasion protein INVA; protein transport, transpo 100.0
>3mix_A Flagellar biosynthesis protein FLHA; flagella biosynthesis, protein transport, type III secretion; 2.30A {Bacillus subtilis} Back     alignment and structure
Probab=100.00  E-value=0  Score=769.90  Aligned_cols=375  Identities=26%  Similarity=0.418  Sum_probs=349.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCC---CCCCCCCCCCCHHHCCCCCHHHHCC-CCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             99999999886443222210011000---2356676753001002460122101-1111234575526889999999999
Q gi|254780512|r  316 GFFACAGFYVPYKNELQRLAKVAQIQ---EASKQNQHSAQLNFITSGVELVLGS-LVSNRLLSSQEDLFLRVSKIRRKFA  391 (692)
Q Consensus       316 ~~l~~~a~~~~r~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~i~l~lg~-li~l~~~~~~~~L~~rI~~iRk~la  391 (692)
                      +++++.||+++|+.+.++..+....+   ......++++......|++++++|| ++++++.+++++|.+||+++||+++
T Consensus         2 g~~~~~ay~~~k~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~l~vd~i~lelG~~Li~lvd~~~gg~L~~rI~~iRk~ia   81 (382)
T 3mix_A            2 GHHHHHAYTLSKSGKEKEEVDEILEEEAEVDELKSPESVVQLLHIDPIEFEFGYGLIPLADANQGGDLLDRIVMIRRQLA   81 (382)
T ss_dssp             ---------------------CHHHHHHHHSCCCSHHHHGGGSCCCSEEEEECGGGHHHHHSSSCCCHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHCCCCCEEEEEECCCHHHHHCCCCCCHHHHHHHHHHHHHH
T ss_conf             86421566413523335567777754420003478531344357760799965064977484559749999999999999


Q ss_pred             HHHCCCCCCEEEEECCCCCCCEEEEEECCEEEEEEEECCCCEEEECCCCCCCCCCCCEEECCCCCCCEEECCHHHHHHHH
Q ss_conf             98098788324454377898716999748245348841783413305888767887410147668830343978845888
Q gi|254780512|r  392 VQYGFIVPEIKVTTDISLPEKGYTIRVYGTTVAISELRVGEVLVILGSGQKPTFPGDEVKEPAFGMPAFAIMESFSDDLR  471 (692)
Q Consensus       392 ~elG~~iP~IrIrDn~~L~~~~Y~I~I~Gv~va~gei~~~~lLai~~~~~~~~l~G~~~~eP~fgl~A~WI~~~~~~~a~  471 (692)
                      .|+||++|+||||||++|+||+|+|+|+|+++++|+++||++||+++++....++|++++||+||+||+||+++++++|+
T Consensus        82 ~elG~v~P~IrIrDn~~L~~~~Y~I~i~gv~v~~g~l~~~~lLai~~~~~~~~~~g~~~~ePafgl~a~WI~~~~~~~a~  161 (382)
T 3mix_A           82 LELGLVIPVVRIRDNIALQPNEYRLKIKGNEVAKGELLLDHYLAMSPTPEDDLIEGIETVEPSFGLPAKWISEAVKDEAD  161 (382)
T ss_dssp             HHHSCCCCCCEEEECTTSCTTEEEEEETTEEEEEEECCTTCCBC------------------------------------
T ss_pred             HHCCCCCCCEEEEECCCCCCCEEEEEECCEEEEEECCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCEEEECHHHHHHHH
T ss_conf             97198789469997877888859999988998641356661111178765445788303278888751775776787999


Q ss_pred             HCCCEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             28990705889999999999998799987299999999997666489999863115998999999999997498654699
Q gi|254780512|r  472 RQGFHPIDNLAVVLTHLSEVIRNNLSQLLSYKDVKNLISRLDPEYQKLAEETCSSHISYSGIQAVLKLLLAEHVSIRNLP  551 (692)
Q Consensus       472 ~~G~tvvdp~~ViatHl~evir~~a~ellg~qEvq~LLd~L~~~~P~LV~Elvp~~v~l~~i~~VLq~LL~E~VsIRdlr  551 (692)
                      .+|||||||.+||+||+++++|+||+||+||||||+|+|.++++||+||||++|+++|++.+|+|||+||+|+|||||++
T Consensus       162 ~~G~tvvd~~~ViaTHL~evir~~a~ellgrqevq~LLd~l~~~~p~LVeelvp~~l~l~~i~~VLq~LL~E~VsIRdl~  241 (382)
T 3mix_A          162 MLGYTVVDPASVVSTHITEKIKQHAHELIGRQETKQLIDHLKESYPVLVEEVTPNPLSVGDIQKVLAKLLKEKVSIRNLV  241 (382)
T ss_dssp             ----CCBCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCHHHHHHHTTTTCCHHHHHHHHHHHHHTTCCCCCHH
T ss_pred             HCCCEEECHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             77985763344899999999999699996999999999999877579999875557798999999999987786353599


Q ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCC-CCEEEEEEECHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHH
Q ss_conf             9999998753357998999999999989998652077-884899988878999999983037778846456698899999
Q gi|254780512|r  552 LILESIAEVAPHSRKTSHIVEQVRIRMAQQICGDLAP-TGILNILKLGNHWDMIFYQAIQRDSKGECVDFNVEPRAVEMF  630 (692)
Q Consensus       552 ~IlEaLad~a~~~kD~~~LtE~VR~aL~R~I~~~~~~-~g~L~vi~L~p~lE~~l~~~i~~t~~G~~~~l~l~P~~~~~l  630 (692)
                      +|||||+||++++|||+.||||||++|+||||++|.+ +|.|+|++|+|+||++++++++++++|++  +++||+..+++
T Consensus       242 tIlEtLad~a~~~kd~~~LtE~VR~~L~r~I~~~~~~~~~~L~vi~L~p~lE~~l~~s~~~~~~g~~--l~l~P~~~~~l  319 (382)
T 3mix_A          242 TIFETLADYGKLTTDSDLLTEYTRQALAKQITAQFAKENEVLKVVTCSGRVEKAIADGVQQTEHGNY--LSLEPDISESI  319 (382)
T ss_dssp             HHHHHHHHHTTTCCCHHHHHHHHHHHTHHHHHHHHCCTTSCEECBEECHHHHHHHHHHBC------C--BCCCHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHCCCCCC--CCCCHHHHHHH
T ss_conf             9999999872147999999999999999999998568987158997398999999998762378885--56598999999


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHHHHHHCCCCCEEEECCCCCCCEEEEEEEEC
Q ss_conf             99999999999956998799828335489999988644898189440178996579888609
Q gi|254780512|r  631 SENATNSIRQYIDKGIPLTIVTLPEIRSYIRMILERNFPSLAVLSHMEIAKGLKVNILGTIS  692 (692)
Q Consensus       631 ~~~i~~~~~~~~~~g~~pVLl~s~~iRr~lr~lle~~~p~l~VLS~~EI~~~~~i~~iG~Is  692 (692)
                      ++++++.++++...|.+|||+|||++||++|+|+++++|+++||||+||+++++++++|+|+
T Consensus       320 ~~~~~~~~~~~~~~g~~pVllvs~~iR~~l~~l~~~~~p~l~VLS~~EI~~~~~i~~ig~V~  381 (382)
T 3mix_A          320 VRSVAKEAEQLSLRQETAILLCSPPVRMYVKQLLERYFPDLPVLSYNELEANVEVQSIGVVD  381 (382)
T ss_dssp             HHHHHHHHHHHHHTTCCCCEEECHHHHHHHHHHHTTTCTTCCEEEGGGSCTTCCEECSCEEC
T ss_pred             HHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEEHHHCCCCCCEEEEEEEE
T ss_conf             99999999999964998599978106799999999868998697055459998158999997



>3a5i_A Flagellar biosynthesis protein FLHA; four domains, thioredoxin-like fold, bacterial flagellum BIO bacterial flagellum protein export; 2.80A {Salmonella typhimurium} Back     alignment and structure
>3myd_A Flagellar biosynthesis protein FLHA; flagellar export, type III secretion, cytoplasmic FRAG protein transport; 2.40A {Helicobacter pylori} Back     alignment and structure
>2x49_A INVA, invasion protein INVA; protein transport, transport, pathogenesis; 1.50A {Salmonella enterica subsp} PDB: 2x4a_A* 3lw9_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00