254780511

254780511

flagellar biosynthesis protein FliR

GeneID in NCBI database:8209506Locus tag:CLIBASIA_01990
Protein GI in NCBI database:254780511Protein Accession:YP_003064924.1
Gene range:+(766368, 767114)Protein Length:248aa
Gene description:flagellar biosynthesis protein FliR
COG prediction:[N] [U] Flagellar biosynthesis pathway, component FliR
KEGG prediction:fliR; flagellar biosynthesis protein FliR; K02421 flagellar biosynthetic protein FliR
SEED prediction:Flagellar biosynthesis protein FliR
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM7 TM-Helix
TOPPRED6 TM-Helix
HMMTOP6 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS8 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF
ccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MTISPEIIMMSLFLIVCRVGscimllpglsmsyiPMQVRLCFAMAFSIVLLPflwdtidlqnfvnrAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNlqtsmgisdslaetplnSLIGIIGLLALWVIDFHHQVFYALVKSygtipigqelnfgNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLlnklvpqipiyfistpyliglgSLFLCLSIEIIVYQFShsflygff
MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF
MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF
***SPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGIS*SLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF
MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF
*TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooo
xxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
ooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooo
oooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooo
ooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooo
oooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF
MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF
MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target248 flagellar biosynthesis protein FliR [Candidatus Liberib
315122292247 flagellar biosynthesis protein FliR [Candidatus Liberib 1 1e-106
222084893250 flagellar byosinthesis transmembrane protein [Agrobacte 1 2e-52
209547954250 flagellar biosynthesis protein FliR [Rhizobium legumino 1 3e-52
218681681250 flagellar biosynthesis protein FliR [Rhizobium etli CIA 1 2e-51
116250508250 flagellar biosynthesis protein FliR [Rhizobium legumino 1 3e-51
86356338250 flagellar biosynthesis protein FliR [Rhizobium etli CFN 1 3e-51
241203132250 flagellar biosynthesis protein FliR [Rhizobium legumino 1 4e-51
218463239250 flagellar biosynthesis protein FliR [Rhizobium etli Kim 1 6e-51
190890390250 flagellar biosynthesis transmembrane protein [Rhizobium 1 8e-51
218662875250 flagellar biosynthesis protein FliR [Rhizobium etli IE4 1 4e-50
>gi|315122292|ref|YP_004062781.1| flagellar biosynthesis protein FliR [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 247 Back     alignment and organism information
 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/243 (78%), Positives = 216/243 (88%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M  SPEII+MSLFLI CR+GSCIM LPG SM Y+PMQVR  F+M FSIVLLPFLWDTIDL
Sbjct: 1   MIASPEIIIMSLFLICCRIGSCIMFLPGFSMPYVPMQVRFFFSMTFSIVLLPFLWDTIDL 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q F +RAYY KLV+VELFLGCVHG+L+R+YT GLQF GSVISTAIGLNLQ+SMGISDS+ 
Sbjct: 61  QIFADRAYYLKLVIVELFLGCVHGVLVRIYTFGLQFMGSVISTAIGLNLQSSMGISDSIP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET  +SLIG IGLLALW+IDFHHQ+FYALVKSYGT PIG+EL+F NIFSS +N+LQ TF+
Sbjct: 121 ETSFSSLIGTIGLLALWIIDFHHQIFYALVKSYGTTPIGKELHFDNIFSSLINILQMTFI 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRLSSPFLFFY+VFNISIG LNK+VPQIP+YFISTPY++GLG LFL  SIE+I+YQF 
Sbjct: 181 IMLRLSSPFLFFYVVFNISIGFLNKIVPQIPVYFISTPYMVGLGFLFLYSSIEMIIYQFI 240

Query: 241 HSF 243
           HSF
Sbjct: 241 HSF 243


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084893|ref|YP_002543422.1| flagellar byosinthesis transmembrane protein [Agrobacterium radiobacter K84] Length = 250 Back     alignment and organism information
>gi|209547954|ref|YP_002279871.1| flagellar biosynthesis protein FliR [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 250 Back     alignment and organism information
>gi|218681681|ref|ZP_03529482.1| flagellar biosynthesis protein FliR [Rhizobium etli CIAT 894] Length = 250 Back     alignment and organism information
>gi|116250508|ref|YP_766346.1| flagellar biosynthesis protein FliR [Rhizobium leguminosarum bv. viciae 3841] Length = 250 Back     alignment and organism information
>gi|86356338|ref|YP_468230.1| flagellar biosynthesis protein FliR [Rhizobium etli CFN 42] Length = 250 Back     alignment and organism information
>gi|241203132|ref|YP_002974228.1| flagellar biosynthesis protein FliR [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 250 Back     alignment and organism information
>gi|218463239|ref|ZP_03503330.1| flagellar biosynthesis protein FliR [Rhizobium etli Kim 5] Length = 250 Back     alignment and organism information
>gi|190890390|ref|YP_001976932.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT 652] Length = 250 Back     alignment and organism information
>gi|218662875|ref|ZP_03518805.1| flagellar biosynthesis protein FliR [Rhizobium etli IE4771] Length = 250 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target248 flagellar biosynthesis protein FliR [Candidatus Liberib
PRK12780251 PRK12780, fliR, flagellar biosynthesis protein FliR; Re 2e-36
PRK05701242 PRK05701, fliR, flagellar biosynthesis protein FliR; Re 6e-35
TIGR01400245 TIGR01400, fliR, flagellar biosynthetic protein FliR 2e-23
pfam01311249 pfam01311, Bac_export_1, Bacterial export proteins, fam 4e-16
PRK12772 609 PRK12772, PRK12772, bifunctional flagellar biosynthesis 7e-13
COG4791259 COG4791, EscT, Type III secretory pathway, component Es 5e-09
TIGR01401253 TIGR01401, fliR_like_III, type III secretion protein Sp 2e-08
COG1684258 COG1684, FliR, Flagellar biosynthesis pathway, componen 6e-26
>gnl|CDD|183741 PRK12780, fliR, flagellar biosynthesis protein FliR; Reviewed Back     alignment and domain information
>gnl|CDD|180211 PRK05701, fliR, flagellar biosynthesis protein FliR; Reviewed Back     alignment and domain information
>gnl|CDD|130467 TIGR01400, fliR, flagellar biosynthetic protein FliR Back     alignment and domain information
>gnl|CDD|144784 pfam01311, Bac_export_1, Bacterial export proteins, family 1 Back     alignment and domain information
>gnl|CDD|183736 PRK12772, PRK12772, bifunctional flagellar biosynthesis protein FliR/FlhB; Provisional Back     alignment and domain information
>gnl|CDD|34401 COG4791, EscT, Type III secretory pathway, component EscT [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|130468 TIGR01401, fliR_like_III, type III secretion protein SpaR/YscT/HrcT Back     alignment and domain information
>gnl|CDD|31870 COG1684, FliR, Flagellar biosynthesis pathway, component FliR [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 248 flagellar biosynthesis protein FliR [Candidatus Liberib
PRK12772 609 bifunctional flagellar biosynthesis protein FliR/FlhB; 100.0
PRK12780250 fliR flagellar biosynthesis protein FliR; Reviewed 100.0
PRK05701250 fliR flagellar biosynthesis protein FliR; Reviewed 100.0
pfam01311249 Bac_export_1 Bacterial export proteins, family 1. This 100.0
TIGR01400248 fliR flagellar biosynthetic protein FliR; InterPro: IPR 100.0
COG1684258 FliR Flagellar biosynthesis pathway, component FliR [Ce 100.0
TIGR01401262 fliR_like_III type III secretion apparatus protein SpaR 100.0
COG4791259 EscT Type III secretory pathway, component EscT [Intrac 100.0
PRK0570089 fliQ flagellar biosynthesis protein FliQ; Validated 95.94
pfam0131376 Bac_export_3 Bacterial export proteins, family 3. This 95.84
PRK09617305 type III secretion system protein; Reviewed 95.64
PRK1278188 fliQ flagellar biosynthesis protein FliQ; Reviewed 95.55
PRK12797215 type III secretion system protein; Provisional 95.45
PRK0601088 fliQ flagellar biosynthesis protein FliQ; Reviewed 95.35
PRK12796219 spaP surface presentation of antigens protein SpaP; Pro 95.02
COG198789 FliQ Flagellar biosynthesis pathway, component FliQ [Ce 94.9
PRK12783252 fliP flagellar biosynthesis protein FliP; Reviewed 94.48
PRK05699245 fliP flagellar biosynthesis protein FliP; Reviewed 94.46
PRK12430379 type III secretion system protein; Provisional 94.45
TIGR0140288 fliQ flagellar biosynthetic protein FliQ; InterPro: IPR 93.7
>PRK12772 bifunctional flagellar biosynthesis protein FliR/FlhB; Provisional Back     alignment and domain information
>PRK12780 fliR flagellar biosynthesis protein FliR; Reviewed Back     alignment and domain information
>PRK05701 fliR flagellar biosynthesis protein FliR; Reviewed Back     alignment and domain information
>pfam01311 Bac_export_1 Bacterial export proteins, family 1 Back     alignment and domain information
>TIGR01400 fliR flagellar biosynthetic protein FliR; InterPro: IPR006303 These sequences represent the FliR protein of bacterial flagellar biosynthesis Back     alignment and domain information
>COG1684 FliR Flagellar biosynthesis pathway, component FliR [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01401 fliR_like_III type III secretion apparatus protein SpaR/YscT/HrcT; InterPro: IPR006304 These sequences represent members of bacterial type III secretion systems homologous to the flagellar biosynthetic protein FliR (IPR006303 from INTERPRO) Back     alignment and domain information
>COG4791 EscT Type III secretory pathway, component EscT [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05700 fliQ flagellar biosynthesis protein FliQ; Validated Back     alignment and domain information
>pfam01313 Bac_export_3 Bacterial export proteins, family 3 Back     alignment and domain information
>PRK09617 type III secretion system protein; Reviewed Back     alignment and domain information
>PRK12781 fliQ flagellar biosynthesis protein FliQ; Reviewed Back     alignment and domain information
>PRK12797 type III secretion system protein; Provisional Back     alignment and domain information
>PRK06010 fliQ flagellar biosynthesis protein FliQ; Reviewed Back     alignment and domain information
>PRK12796 spaP surface presentation of antigens protein SpaP; Provisional Back     alignment and domain information
>COG1987 FliQ Flagellar biosynthesis pathway, component FliQ [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12783 fliP flagellar biosynthesis protein FliP; Reviewed Back     alignment and domain information
>PRK05699 fliP flagellar biosynthesis protein FliP; Reviewed Back     alignment and domain information
>PRK12430 type III secretion system protein; Provisional Back     alignment and domain information
>TIGR01402 fliQ flagellar biosynthetic protein FliQ; InterPro: IPR006305 These sequences represent FliQ, a protein involved in biosynthesis of bacterial flagella Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00