254780515

254780515

hypothetical protein CLIBASIA_02010

GeneID in NCBI database:8209510Locus tag:CLIBASIA_02010
Protein GI in NCBI database:254780515Protein Accession:YP_003064928.1
Gene range:-(763285, 763413)Protein Length:42aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--
MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE
ccEEEEEEEccHHHHHHHHHHccccEEEEEEHHHHHHHHHcc
cccEEEEEEcHHHHHHHHHHHHcccEEEEEEHHHHHHHHccc
MPTIHLLTVDSEIAENkaeridkhNIILVVLDKVKKEKHLKE
mptihlltVDSEIAenkaeridkhniilvvldkvkkekhlke
MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE
*PTIHLLTVDSEIAENKAERIDKHNIILVVLDK*********
MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE
*PTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEK****
oooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE
MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE
MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target42 hypothetical protein CLIBASIA_02010 [Candidatus Liberib
319407457302 putative type II restriction endonuclease [Bartonella s 1 8e-06
261400949132 type II restriction enzyme SsoII [Neisseria lactamica A 1 1e-04
313667523132 restriction endonuclease [Neisseria lactamica ST-640] L 1 0.002
>gi|319407457|emb|CBI81107.1| putative type II restriction endonuclease [Bartonella sp. 1-1C] Length = 302 Back     alignment and organism information
 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/36 (66%), Positives = 32/36 (88%)

Query: 2   PTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKE 37
           P IHLLTVDS+I+ NK E+++KHNI+LVVLD +KK+
Sbjct: 237 PNIHLLTVDSDISVNKIEQMNKHNIVLVVLDTIKKQ 272


Species: Bartonella sp. 1-1C
Genus: Bartonella
Family: Bartonellaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|261400949|ref|ZP_05987074.1| type II restriction enzyme SsoII [Neisseria lactamica ATCC 23970] Length = 132 Back     alignment and organism information
>gi|313667523|ref|YP_004047807.1| restriction endonuclease [Neisseria lactamica ST-640] Length = 132 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 42 hypothetical protein CLIBASIA_02010 [Candidatus Liberib
pfam09019164 EcoRII-C EcoRII C terminal. The C-terminal catalytic do 96.0
>pfam09019 EcoRII-C EcoRII C terminal Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target42 hypothetical protein CLIBASIA_02010 [Candidatus Liberib
1na6_A404 Ecorii, restriction endonuclease ecorii; site-specific 0.002
2gb7_A305 R.ECL18KI; ECL18KI-DNA complex, type II restriction end 0.004
>1na6_A Ecorii, restriction endonuclease ecorii; site-specific restriction, mutation, replication, hydrolase; 2.10A {Escherichia coli} SCOP: b.142.1.1 c.52.1.22 PDB: 3hqg_A 3hqf_A Length = 404 Back     alignment and structure
 Score = 36.0 bits (83), Expect = 0.002
 Identities = 7/35 (20%), Positives = 16/35 (45%)

Query: 2   PTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKK 36
             +HL T+   ++  +   + +  + LVV   + K
Sbjct: 342 HQVHLFTLQEGVSLAQYREMRESGVRLVVPSSLHK 376


>2gb7_A R.ECL18KI; ECL18KI-DNA complex, type II restriction endonuclease, nucleotide flipping, base extrusion, hydrolase/DNA complex; HET: DNA; 1.70A {Enterobacter cloacae} PDB: 2fqz_A* Length = 305 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target42 hypothetical protein CLIBASIA_02010 [Candidatus Liberib
2gb7_A305 R.ECL18KI; ECL18KI-DNA complex, type II restriction end 94.97
3bm3_A272 PSPGI restriction endonuclease; endonuclease-DNA comple 93.59
1na6_A404 Ecorii, restriction endonuclease ecorii; site-specific 93.13
>2gb7_A R.ECL18KI; ECL18KI-DNA complex, type II restriction endonuclease, nucleotide flipping, base extrusion, hydrolase/DNA complex; HET: DNA; 1.70A {Enterobacter cloacae} PDB: 2fqz_A* Back     alignment and structure
Probab=94.97  E-value=0.012  Score=32.34  Aligned_cols=36  Identities=19%  Similarity=0.308  Sum_probs=32.2

Q ss_pred             CCEEEEEEECCHHHHHHHHHHCCCCEEEEEEHHHHH
Q ss_conf             971799985003221055320335389998520113
Q gi|254780515|r    1 MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKK   36 (42)
Q Consensus         1 mptihlltvdseiaenkaeridkhniilvvldkvkk   36 (42)
                      .|.+||+|.+..|.+|+..-+..||++|||-..+++
T Consensus       201 I~~~~L~TL~~~IS~~q~~eM~~~~v~LVVp~~~~s  236 (305)
T 2gb7_A          201 IREMYLATLDDSFSEETINILYEANVVVVTTVENKN  236 (305)
T ss_dssp             CSCEEEEECCSCCCHHHHHHHHHTTEEEEECHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCEEEEECHHHCC
T ss_conf             763599862788898999999977909995534247



>3bm3_A PSPGI restriction endonuclease; endonuclease-DNA complex, restriction enzyme, PSPGI, base flipping, hydrolase/DNA complex; HET: DNA MSE CIT; 1.70A {Pyrococcus SP} Back     alignment and structure
>1na6_A Ecorii, restriction endonuclease ecorii; site-specific restriction, mutation, replication, hydrolase; 2.10A {Escherichia coli} SCOP: b.142.1.1 c.52.1.22 PDB: 3hqg_A 3hqf_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 42 hypothetical protein CLIBASIA_02010 [Candidatus Liberib
d1na6a2220 c.52.1.22 (A:179-398) Restriction endonuclease EcoRII, 0.001
>d1na6a2 c.52.1.22 (A:179-398) Restriction endonuclease EcoRII, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 220 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Restriction endonuclease-like
superfamily: Restriction endonuclease-like
family: Type II restriction endonuclease catalytic domain
domain: Restriction endonuclease EcoRII, C-terminal domain
species: Escherichia coli [TaxId: 562]
 Score = 36.0 bits (83), Expect = 0.001
 Identities = 7/36 (19%), Positives = 17/36 (47%)

Query: 2   PTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKE 37
             +HL T+   ++  +   + +  + LVV   + K+
Sbjct: 164 HQVHLFTLQEGVSLAQYREMRESGVRLVVPSSLHKK 199


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target42 hypothetical protein CLIBASIA_02010 [Candidatus Liberib
d1na6a2220 Restriction endonuclease EcoRII, C-terminal domain {Esc 94.94
>d1na6a2 c.52.1.22 (A:179-398) Restriction endonuclease EcoRII, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Restriction endonuclease-like
superfamily: Restriction endonuclease-like
family: Type II restriction endonuclease catalytic domain
domain: Restriction endonuclease EcoRII, C-terminal domain
species: Escherichia coli [TaxId: 562]
Probab=94.94  E-value=0.0025  Score=34.40  Aligned_cols=37  Identities=19%  Similarity=0.343  Sum_probs=33.3

Q ss_pred             CEEEEEEECCHHHHHHHHHHCCCCEEEEEEHHHHHHH
Q ss_conf             7179998500322105532033538999852011334
Q gi|254780515|r    2 PTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEK   38 (42)
Q Consensus         2 ptihlltvdseiaenkaeridkhniilvvldkvkkek   38 (42)
                      +.+||+|.+..|.+||..-+..||+.|||-+.+++.-
T Consensus       164 ~~~~L~TL~~~IS~~q~~eM~~~~v~LVVP~~i~~sy  200 (220)
T d1na6a2         164 HQVHLFTLQEGVSLAQYREMRESGVRLVVPSSLHKKY  200 (220)
T ss_dssp             ---CEEECCSCCCHHHHHHHHTTTCCEECCHHHHTTS
T ss_pred             HHHEEEECCCCCCHHHHHHHHHCCEEEEEEHHHHHCC
T ss_conf             5440230368888899999997796999737876307



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target42 hypothetical protein CLIBASIA_02010 [Candidatus Liberib
2gb7_A_175-26490 R.ECL18KI; ECL18KI-DNA complex, type II restrictio 95.87
1na6_A_284-404121 Ecorii, restriction endonuclease ecorii; site-spec 94.7
>2gb7_A (A:175-264) R.ECL18KI; ECL18KI-DNA complex, type II restriction endonuclease, nucleotide flipping, base extrusion, hydrolase/DNA complex; HET: DNA; 1.70A {Enterobacter cloacae} PDB: 2fqz_A* Back     alignment and structure
Probab=95.87  E-value=0.0055  Score=34.66  Aligned_cols=38  Identities=21%  Similarity=0.286  Sum_probs=33.2

Q ss_pred             CCEEEEEEECCHHHHHHHHHHCCCCEEEEEEHHHHHHH
Q ss_conf             97179998500322105532033538999852011334
Q gi|254780515|r    1 MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEK   38 (42)
Q Consensus         1 mptihlltvdseiaenkaeridkhniilvvldkvkkek   38 (42)
                      .|.+||+|+|..|.+|+..-...|||+|||-..+++-.
T Consensus        27 i~~~hL~TL~~gIS~~q~~eM~~~~i~LVvP~~l~~~y   64 (90)
T 2gb7_A           27 IREMYLATLDDSFSEETINILYEANVVVVTTVENKNFK   64 (90)
T ss_dssp             CSCEEEEECCSCCCHHHHHHHHHTTEEEEECHHHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCEEEECHHHCCHH
T ss_conf             76258986068888899999997693899545641414



>1na6_A (A:284-404) Ecorii, restriction endonuclease ecorii; site-specific restriction, mutation, replication, hydrolase; 2.10A {Escherichia coli} Back     alignment and structure