254780516

254780516

type II modification methyltransferase

GeneID in NCBI database:8209511Locus tag:CLIBASIA_02015
Protein GI in NCBI database:254780516Protein Accession:YP_003064929.1
Gene range:-(762963, 763214)Protein Length:83aa
Gene description:type II modification methyltransferase
COG prediction:[L] Site-specific DNA methylase
KEGG prediction:type II modification methyltransferase; K00558 DNA (cytosine-5-)-methyltransferase [EC:2.1.1.37]
SEED prediction:Cytosine-specific methyltransferase NlaX (EC 2.1.1.37) (M.NlaX)
Pathway involved in KEGG:Cysteine and methionine metabolism [PATH:las00270]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80---
MLKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKTQDIPDHDVLLAGFPCQPFSQAG
ccEEEEEEccHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHcccccccccHHHccHHHcccccEEEEccccccccccc
cccHHHHHHccccHcHHHHHHHHHcccEEEEcccccHHHHHHHHHHcccccccccccEccHHccccccEEEEccccccccccc
MLKITDLfcgiggirldleqtfnhrnvecffsseinpysvktyqanfpntlifgdiakiktqdipdhdvllagfpcqpfsqag
mlkitdlfcGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKTQDIPDHDVLLAGFPcqpfsqag
MLKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKTQDIPDHDVLLAGFPCQPFSQAG
MLKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKTQDIPDHDVLLAGFPCQPFSQAG
MLKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKTQDIPDHDVLLAGFPCQPFSQAG
MLKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKTQDIPDHDVLLAGFPCQPFS***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKTQDIPDHDVLLAGFPCQPFSQAG
MLKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKTQDIPDHDVLLAGFPCQPFSQAG
MLKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKTQDIPDHDVLLAGFPCQPFSQAG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target83 type II modification methyltransferase [Candidatus Libe
319407456 307 Cytosine-specific methyltransferase NlaX [Bartonella sp 1 2e-23
261400948 313 modification methylase EcoRII [Neisseria lactamica ATCC 1 3e-23
313667524 313 cytosine-specific methyltransferase [Neisseria lactamic 1 5e-23
150026187 335 type II modification methyltransferase [Flavobacterium 1 1e-22
127471 313 RecName: Full=Cytosine-specific methyltransferase NlaX; 1 2e-22
317501747 499 DNA-cytosine methyltransferase [Lachnospiraceae bacteri 1 1e-19
315498495 410 transcriptional regulator, xre family [Asticcacaulis ex 1 2e-18
269123998 438 DNA-cytosine methyltransferase [Streptobacillus monilif 1 3e-18
462657 389 RecName: Full=Modification methylase ScrFIA; Short=M.Sc 1 4e-18
321310755 362 C-5 cytosine-specific DNA methylase [Mycoplasma haemofe 1 5e-18
>gi|319407456|emb|CBI81106.1| Cytosine-specific methyltransferase NlaX [Bartonella sp. 1-1C] Length = 307 Back     alignment and organism information
 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 61/83 (73%)

Query: 1  MLKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIK 60
          M +I DLF GIGGIRL  E  F   N +C F+SEI+ YS++TY+ NF N  + GDI +I 
Sbjct: 1  MYRIIDLFAGIGGIRLGFESAFGLNNTQCIFTSEIDKYSIQTYKLNFNNDYVHGDITQIH 60

Query: 61 TQDIPDHDVLLAGFPCQPFSQAG 83
           ++IP HD+LLAGFPCQPFSQAG
Sbjct: 61 EEEIPKHDILLAGFPCQPFSQAG 83


Species: Bartonella sp. 1-1C
Genus: Bartonella
Family: Bartonellaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|261400948|ref|ZP_05987073.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970] Length = 313 Back     alignment and organism information
>gi|313667524|ref|YP_004047808.1| cytosine-specific methyltransferase [Neisseria lactamica ST-640] Length = 313 Back     alignment and organism information
>gi|150026187|ref|YP_001297013.1| type II modification methyltransferase [Flavobacterium psychrophilum JIP02/86] Length = 335 Back     alignment and organism information
>gi|127471|sp|P24581|MTNX_NEILA RecName: Full=Cytosine-specific methyltransferase NlaX; Short=M.NlaX Length = 313 Back     alignment and organism information
>gi|317501747|ref|ZP_07959934.1| DNA-cytosine methyltransferase [Lachnospiraceae bacterium 8_1_57FAA] Length = 499 Back     alignment and organism information
>gi|315498495|ref|YP_004087299.1| transcriptional regulator, xre family [Asticcacaulis excentricus CB 48] Length = 410 Back     alignment and organism information
>gi|269123998|ref|YP_003306575.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM 12112] Length = 438 Back     alignment and organism information
>gi|462657|sp|P34877|MTSA_LACLC RecName: Full=Modification methylase ScrFIA; Short=M.ScrFI-A; Short=M.ScrFIA; AltName: Full=Cytosine-specific methyltransferase ScrFIA Length = 389 Back     alignment and organism information
>gi|321310755|ref|YP_004193084.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str. Langford 1] Length = 362 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target83 type II modification methyltransferase [Candidatus Libe
TIGR00675 315 TIGR00675, dcm, DNA-methyltransferase (dcm) 2e-29
cd00315 275 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA 3e-24
PRK10458 467 PRK10458, PRK10458, DNA cytosine methylase; Provisional 7e-19
COG0270 328 COG0270, Dcm, Site-specific DNA methylase [DNA replicat 1e-18
pfam00145 319 pfam00145, DNA_methylase, C-5 cytosine-specific DNA met 6e-26
>gnl|CDD|161991 TIGR00675, dcm, DNA-methyltransferase (dcm) Back     alignment and domain information
>gnl|CDD|73191 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>gnl|CDD|182476 PRK10458, PRK10458, DNA cytosine methylase; Provisional Back     alignment and domain information
>gnl|CDD|30619 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|143915 pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 83 type II modification methyltransferase [Candidatus Libe
TIGR00675 425 dcm DNA-cytosine methyltransferase; InterPro: IPR001525 100.0
pfam00145 319 DNA_methylase C-5 cytosine-specific DNA methylase. 99.97
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylase 99.97
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, recom 99.96
PRK10458 470 DNA cytosine methylase; Provisional 99.96
KOG0919 338 consensus 99.62
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 98.47
COG2520341 Predicted methyltransferase [General function predictio 98.38
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 98.15
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 98.1
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 97.97
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 97.75
PHA02056 279 putative methyltransferase 97.68
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 97.57
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 97.47
KOG1227351 consensus 97.38
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 97.31
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 97.25
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 97.21
TIGR00095210 TIGR00095 putative methyltransferase; InterPro: IPR0043 97.19
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 97.18
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 97.1
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 97.06
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 97.04
COG4123 248 Predicted O-methyltransferase [General function predict 96.98
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 96.95
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 96.76
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 96.66
pfam05175170 MTS Methyltransferase small domain. This domain is foun 96.62
PRK11933 471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 96.58
pfam01189 277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 96.41
COG1092393 Predicted SAM-dependent methyltransferases [General fun 96.28
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 96.27
pfam10672286 Methyltrans_SAM S-adenosylmethionine-dependent methyltr 96.25
PRK10901428 16S rRNA methyltransferase B; Provisional 96.2
COG0144 355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 95.98
KOG3420185 consensus 95.98
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 95.64
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 95.63
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 95.58
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 95.46
COG3897218 Predicted methyltransferase [General function predictio 94.75
KOG2904328 consensus 94.55
COG2521287 Predicted archaeal methyltransferase [General function 94.48
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 94.12
pfam05185 447 PRMT5 PRMT5 arginine-N-methyltransferase. The human hom 94.02
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 93.8
COG2226 238 UbiE Methylase involved in ubiquinone/menaquinone biosy 92.8
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 92.8
PRK05134 233 3-demethylubiquinone-9 3-methyltransferase; Provisional 91.02
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 90.91
smart00650169 rADc Ribosomal RNA adenine dimethylases. 90.87
pfam00398 258 RrnaAD Ribosomal RNA adenine dimethylase. 90.82
COG1041347 Predicted DNA modification methylase [DNA replication, 90.7
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 90.69
PTZ00338 296 dimethyladenosine transferase; Provisional 90.54
KOG2730263 consensus 90.16
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 96.63
pfam02005 375 TRM N2,N2-dimethylguanosine tRNA methyltransferase. Thi 95.13
PRK04338 376 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Pro 92.77
TIGR02085386 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase R 92.52
TIGR02143361 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: 92.02
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 91.98
>TIGR00675 dcm DNA-cytosine methyltransferase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>pfam00145 DNA_methylase C-5 cytosine-specific DNA methylase Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>KOG0919 consensus Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PHA02056 putative methyltransferase Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1227 consensus Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00095 TIGR00095 putative methyltransferase; InterPro: IPR004398 This is a family of conserved hypothetical proteins, which includes a putative methylase Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>pfam10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3420 consensus Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; InterPro: IPR001566 This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>pfam05185 PRMT5 PRMT5 arginine-N-methyltransferase Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase; Provisional Back     alignment and domain information
>KOG2730 consensus Back     alignment and domain information
>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>pfam02005 TRM N2,N2-dimethylguanosine tRNA methyltransferase Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB; InterPro: IPR011825 This family consists of RNA methyltransferases designated RumB, formerly YbjF Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: IPR011869 This family consists exclusively of proteins believed to act as tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target83 type II modification methyltransferase [Candidatus Libe
2i9k_A 327 Engineered Extrahelical Base Destabilization Enhanc 4e-16
1mht_A 327 Covalent Ternary Structure Of Hhai Methyltransferas 5e-16
2zcj_A 327 Ternary Structure Of The Glu119gln M.Hhai, C5-Cytos 6e-16
2uz4_A 327 Hhai Dna Methyltransferase R165n Mutant Complex Wit 6e-16
2uyc_A 327 Hhai Dna Methyltransferase R163n Mutant Complex Wit 6e-16
2z6u_A 327 Ternary Structure Of The Glu119ala M.Hhai, C5-Cytos 6e-16
2z6q_A 327 Ternary Structure Of Arg165ala M.Hhai C5-Cytosine D 6e-16
1fjx_A 327 Structure Of Ternary Complex Of Hhai Methyltransfer 7e-16
1svu_A 327 Structure Of The Q237w Mutant Of Hhai Dna Methyltra 8e-16
2uyh_A 327 Hhai Dna Methyltransferase S87q-Q237s Mutant Comple 1e-15
1dct_A 324 Dna (Cytosine-5) Methylase From Haeiii Covalently B 4e-15
3me5_A 482 Crystal Structure Of Putative Dna Cytosine Methylas 2e-14
3lx6_A 410 Structure Of Probable Cytosine-Specific Methyltrans 2e-14
2z6a_A 327 S-Adenosyl-L-Methionine-Dependent Methyl Transfer: 3e-14
3g7u_A 376 Crystal Structure Of Putative Dna Modification Meth 6e-12
3av4_A 1330 Crystal Structure Of Mouse Dna Methyltransferase 1 2e-08
3pt9_A 873 Crystal Structure Of Mouse Dnmt1(731-1602) In The F 3e-08
3pt6_A 954 Crystal Structure Of Mouse Dnmt1(650-1602) In Compl 4e-08
3pta_A 956 Crystal Structure Of Human Dnmt1(646-1600) In Compl 9e-08
1g55_A 343 Structure Of Human Dnmt2, An Enigmatic Dna Methyltr 8e-07
2qrv_A 295 Structure Of Dnmt3a-Dnmt3l C-Terminal Domain Comple 0.003
>gi|118138268|pdb|2I9K|A Chain A, Engineered Extrahelical Base Destabilization Enhances Sequence Discrimination Of Dna Methyltransferase M.Hhai Length = 327 Back     alignment and structure
 Score = 87.7 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 36/82 (43%), Positives = 49/82 (59%), Gaps = 5/82 (6%)

Query: 2  LKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKT 61
          L+  DLF G+GG RL LE        EC +S+E + Y+ + Y+ NF       DI ++  
Sbjct: 12 LRFIDLFAGLGGFRLALE----SCGAECVYSNEWDKYAQEVYEMNFGEKPEG-DITQVNE 66

Query: 62 QDIPDHDVLLAGFPCQPFSQAG 83
          + IPDHD+L AGFPCQ FS +G
Sbjct: 67 KTIPDHDILCAGFPCQAFSISG 88


gi|1065144|pdb|1MHT|A Chain A, Covalent Ternary Structure Of Hhai Methyltransferase, Dna And S-Adenosyl-L-Homocysteine Length = 327 Back     alignment and structure
>gi|161761159|pdb|2ZCJ|A Chain A, Ternary Structure Of The Glu119gln M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 Back     alignment and structure
>gi|189339547|pdb|2UZ4|A Chain A, Hhai Dna Methyltransferase R165n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Back     alignment and structure
>gi|189096047|pdb|2UYC|A Chain A, Hhai Dna Methyltransferase R163n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Back     alignment and structure
>gi|160877870|pdb|2Z6U|A Chain A, Ternary Structure Of The Glu119ala M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 Back     alignment and structure
>gi|158431504|pdb|2Z6Q|A Chain A, Ternary Structure Of Arg165ala M.Hhai C5-Cytosine Dna Methyltransferase With Unmodified Dna And Adohcy Length = 327 Back     alignment and structure
>gi|12084381|pdb|1FJX|A Chain A, Structure Of Ternary Complex Of Hhai Methyltransferase Mutant (T250g) In Complex With Dna And Adohcy Length = 327 Back     alignment and structure
>gi|50513617|pdb|1SVU|A Chain A, Structure Of The Q237w Mutant Of Hhai Dna Methyltransferase: An Insight Into Protein-Protein Interactions Length = 327 Back     alignment and structure
>gi|189096062|pdb|2UYH|A Chain A, Hhai Dna Methyltransferase S87q-Q237s Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Back     alignment and structure
>gi|1127162|pdb|1DCT|A Chain A, Dna (Cytosine-5) Methylase From Haeiii Covalently Bound To Dna Length = 324 Back     alignment and structure
>gi|294979850|pdb|3ME5|A Chain A, Crystal Structure Of Putative Dna Cytosine Methylase From Shigella Flexneri 2a Str. 301 Length = 482 Back     alignment and structure
>gi|291463698|pdb|3LX6|A Chain A, Structure Of Probable Cytosine-Specific Methyltransferase From Shigella Flexneri Length = 410 Back     alignment and structure
>gi|159795737|pdb|2Z6A|A Chain A, S-Adenosyl-L-Methionine-Dependent Methyl Transfer: Observable Precatalytic Intermediates During Dna Cytosine Methylation Length = 327 Back     alignment and structure
>gi|224036442|pdb|3G7U|A Chain A, Crystal Structure Of Putative Dna Modification Methyltransferase Encoded Within Prophage Cp-933r (E.Coli) Length = 376 Back     alignment and structure
>gi|332138119|pdb|3AV4|A Chain A, Crystal Structure Of Mouse Dna Methyltransferase 1 Length = 1330 Back     alignment and structure
>gi|315583649|pdb|3PT9|A Chain A, Crystal Structure Of Mouse Dnmt1(731-1602) In The Free State Length = 873 Back     alignment and structure
>gi|315583643|pdb|3PT6|A Chain A, Crystal Structure Of Mouse Dnmt1(650-1602) In Complex With Dna Length = 954 Back     alignment and structure
>gi|315583650|pdb|3PTA|A Chain A, Crystal Structure Of Human Dnmt1(646-1600) In Complex With Dna Length = 956 Back     alignment and structure
>gi|13096616|pdb|1G55|A Chain A, Structure Of Human Dnmt2, An Enigmatic Dna Methyltransferase Homologue Length = 343 Back     alignment and structure
>gi|161761041|pdb|2QRV|A Chain A, Structure Of Dnmt3a-Dnmt3l C-Terminal Domain Complex Length = 295 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target83 type II modification methyltransferase [Candidatus Libe
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA methylt 3e-20
3me5_A 482 Cytosine-specific methyltransferase; structural genomic 1e-18
1dct_A 324 Protein (modification methylase HAEIII); enzyme, cytosi 6e-17
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase, met 2e-16
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, NAD-b 5e-14
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methyltransf 1e-12
2qrv_B 230 DNA (cytosine-5)-methyltransferase 3-like; DNA methyltr 3e-06
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unme 2e-05
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Length = 343 Back     alignment and structure
 Score = 91.6 bits (226), Expect = 3e-20
 Identities = 23/85 (27%), Positives = 46/85 (54%), Gaps = 5/85 (5%)

Query: 2  LKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNT-LIFGDIAKIK 60
          L++ +L+ G+GG+   L ++      +   + ++N  + + Y+ NFP+T L+   I  I 
Sbjct: 3  LRVLELYSGVGGMHHALRESC--IPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGIT 60

Query: 61 TQDIP--DHDVLLAGFPCQPFSQAG 83
           ++      D++L   PCQPF++ G
Sbjct: 61 LEEFDRLSFDMILMSPPCQPFTRIG 85


>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Length = 482 Back     alignment and structure
>1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase; HET: DNA C49 5CM; 2.80A {Haemophilus aegyptus} SCOP: c.66.1.26 Length = 324 Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* 2uz4_A* ... Length = 327 Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural genomics, protein structure initiative, PSI; 1.75A {Escherichia coli O157} Length = 376 Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295 Back     alignment and structure
>2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 230 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target83 type II modification methyltransferase [Candidatus Libe
1dct_A 324 Protein (modification methylase HAEIII); enzyme, cytosi 99.97
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase, met 99.97
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA methylt 99.97
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, NAD-b 99.96
3me5_A 482 Cytosine-specific methyltransferase; structural genomic 99.96
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methyltransf 99.95
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unme 99.54
2qrv_B 230 DNA (cytosine-5)-methyltransferase 3-like; DNA methyltr 99.51
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, tRNA m 98.43
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta sheet, 98.42
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine modifi 98.28
1ne2_A200 Hypothetical protein TA1320; structural genomics, conse 98.25
2fpo_A202 Methylase YHHF; structural genomics, putative methyltra 98.24
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, structural 98.22
2esr_A177 Methyltransferase; structural genomics, hypothetical pr 98.17
2frn_A278 Hypothetical protein PH0793; structural genomics, PSI, 98.15
1ws6_A171 Methyltransferase; structural genomics, riken structura 98.09
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase, str 98.06
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, structu 98.02
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dimethyl 97.96
2b78_A385 Hypothetical protein SMU.776; structure genomics, methy 97.85
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; metal 97.83
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus thermoph 97.8
2qm3_A 373 Predicted methyltransferase; putative methyltransferase 97.65
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, meth 97.64
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwich, b 97.61
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent meth 97.56
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modifi 97.41
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, pred 97.37
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research cente 97.35
2b3t_A276 Protein methyltransferase HEMK; translation termination 97.35
3lpm_A 259 Putative methyltransferase; structural genomics, protei 97.25
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase; met 97.15
1nv8_A284 HEMK protein; class I adoMet-dependent methyltransferas 97.06
2b9e_A 309 NOL1/NOP2/SUN domain family, member 5 isoform 2; methyt 97.03
1dus_A194 MJ0882; hypothetical protein, methanococcus jannaschii, 96.84
3ll7_A 410 Putative methyltransferase; methytransferase, structura 96.84
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosylmeth 96.83
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase; tra 96.67
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcytidin 96.61
3dmg_A381 Probable ribosomal RNA small subunit methyltransferase; 96.5
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA domain, 96.25
2f8l_A 344 Hypothetical protein LMO1582; 16411011, structural geno 96.22
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adenosyl-m 96.21
2h00_A254 Methyltransferase 10 domain containing protein; structu 96.14
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxylase; 95.9
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed beta she 95.85
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; gene d 95.85
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransferase 95.71
2yxl_A 450 PH0851 protein, 450AA long hypothetical FMU protein; FM 95.7
3bxo_A 239 N,N-dimethyltransferase; desosamine, sugar, carbohydrat 95.58
2fyt_A 340 Protein arginine N-methyltransferase 3; structural geno 95.49
3ajd_A 274 Putative methyltransferase MJ0026; tRNA, M5C, rossmann 95.32
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding domain, 94.75
1yb2_A275 Hypothetical protein TA0852; structural genomics, methy 94.6
1ixk_A 315 Methyltransferase; open beta sheet; 1.90A {Pyrococcus h 94.54
1or8_A 340 Protein arginine N-methyltransferase 1; protein arginin 94.52
2pxx_A215 Uncharacterized protein MGC2408; structural genomics co 94.35
1wzn_A 252 SAM-dependent methyltransferase; structural genomics, r 94.29
3m70_A286 Tellurite resistance protein TEHB homolog; structural g 94.23
3g5l_A 253 Putative S-adenosylmethionine dependent methyltransfera 94.17
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe relat 94.06
3m33_A226 Uncharacterized protein; structural genomics, PSI-2, pr 93.99
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA bind 93.99
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltransfer 93.97
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent methylt 93.84
3dtn_A 234 Putative methyltransferase MM_2633; structural genomics 93.75
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like fold 93.68
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridium the 93.64
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ERMC', 93.58
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messenger 93.57
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; struc 93.34
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glycopepti 92.89
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protein, st 92.84
3f4k_A 257 Putative methyltransferase; structural genomics, PSI-2, 92.77
3hnr_A220 Probable methyltransferase BT9727_4108; structural geno 92.69
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, 92.37
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813429.1 92.15
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, transfe 92.06
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta protein, s 91.72
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_32134 91.71
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein argin 91.61
3b3f_A 341 Histone-arginine methyltransferase CARM1; protein argin 91.6
1xxl_A 239 YCGJ protein; structural genomics, protein structure in 91.46
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent meth 91.46
3dh0_A219 SAM dependent methyltransferase; cystal structure, PSI- 91.41
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, protein 91.39
3lcc_A235 Putative methyl chloride transferase; halide methyltran 91.2
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribosomal 91.18
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransferase, 90.98
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, struct 90.97
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structural ge 90.96
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgrc, pr 90.68
3ege_A 261 Putative methyltransferase from antibiotic biosynthesis 90.43
3gu3_A 284 Methyltransferase; alpha-beta protein, structural genom 90.31
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferase; tRN 96.34
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structural ge 96.34
2yxd_A183 Probable cobalt-precorrin-6Y C(15)- methyltransferase [ 95.29
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwi 94.67
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann-like 94.59
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; structu 93.98
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, structura 93.81
3frh_A253 16S rRNA methylase; methyltransferase domain, helical N 90.04
>1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26 Back     alignment and structure
Probab=99.97  E-value=7.6e-33  Score=184.23  Aligned_cols=78  Identities=33%  Similarity=0.674  Sum_probs=75.9

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCEEEEECCCCCCCCC
Q ss_conf             26964107947889999872220895699998069555112220012332321158975365788719998689975436
Q gi|254780516|r    2 LKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKTQDIPDHDVLLAGFPCQPFSQ   81 (83)
Q Consensus         2 l~v~~LFsG~GG~~~gl~~a~~~~~~~~v~a~e~d~~a~~~y~~n~~~~~~~~DI~~~~~~~~~~~D~l~gG~PCq~fS~   81 (83)
                      |||+|||||+||+++||+++    |+++++++|+|++|++||++|||.....+||++++.+++|++|+|+||||||+||+
T Consensus         1 ~kv~~lF~G~Gg~~~gl~~a----G~~~~~a~e~d~~a~~~~~~N~~~~~~~~Di~~~~~~~~~~~D~~~~g~PCq~fS~   76 (324)
T 1dct_A            1 MNLISLFSGAGGLDLGFQKA----GFRIICANEYDKSIWKTYESNHSAKLIKGDISKISSDEFPKCDGIIGGPPCQSWSE   76 (324)
T ss_dssp             CEEEEESCSSCHHHHHHHHH----TCEEEEEEECCHHHHHHHHHHCCSEEEESCTTTSCGGGSCCCSEEEECCCCTTTSS
T ss_pred             CEEEEECCCCCHHHHHHHHC----CCEEEEEEECCHHHHHHHHHHCCCCCCCCCHHHCCHHHCCCCCEEEECCCCCCHHH
T ss_conf             90999480747899999987----99799999679999999998789997249824599857675365773699842233


Q ss_pred             CC
Q ss_conf             89
Q gi|254780516|r   82 AG   83 (83)
Q Consensus        82 aG   83 (83)
                      ||
T Consensus        77 ag   78 (324)
T 1dct_A           77 GG   78 (324)
T ss_dssp             SS
T ss_pred             HC
T ss_conf             02



>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural genomics, protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 2zzm_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structural genomics; HET: SAH; 2.20A {Pyrococcus horikoshii OT3} SCOP: c.66.1.32 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protein structure initiative, midwest center for structural genomics; HET: MSE; 2.05A {Escherichia coli K12} SCOP: c.66.1.46 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes MGAS10394} SCOP: c.66.1.46 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus HB8} SCOP: c.66.1.46 Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis V583} SCOP: c.66.1.46 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus HB8} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI- 2, protein structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175, PSI-2; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research center for structural genomics, protein structure initiative, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, NYSGXRC, structural genomics; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein structure initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransferase domain; 2.90A {Escherichia coli} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransferase posttranslational modification; 1.59A {Thermus thermophilus HB8} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus HB8} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransferase; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; 16411011, structural genomics, PSI, protein structure initiative, joint center for structural genomics; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics, protein structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5- methylpyrimidin-2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii OT3} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 1f3l_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer, dimer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum dsm 1728} SCOP: c.66.1.13 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1or8_A Protein arginine N-methyltransferase 1; protein arginine methylation, adoMet-dependent methylation, transferase; HET: SAH; 2.35A {Rattus norvegicus} SCOP: c.66.1.6 PDB: 1orh_A* 1ori_A* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii OT3} SCOP: c.66.1.43 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima MSB8} SCOP: c.66.1.41 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 1pry_A Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1, methyltransferase domain, structural genomics; HET: MSE; 1.60A {Mesorhizobium loti MAFF303099} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, antibiotic resistance, methyltransferase; 1.44A {Aquifex aeolicus VF5} PDB: 3ftc_A 3fte_A 3ftf_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI, nysgxrc; 2.50A {Clostridium acetobutylicum atcc 824} SCOP: c.66.1.43 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus HB27} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, structural genomics; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase, structural genomics; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, alternative splicing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3b3f_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase, catalytic domain, alternative splicing, chromatin regulator; HET: SAH; 2.20A {Rattus norvegicus} PDB: 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltransferase, structural genomics, PSI-2, protein structure initiative; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative, SAM-dependent methyltransferase; HET: SAI; 1.94A {Leishmania major strain friedlin} SCOP: c.66.1.42 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assembly S-adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosynthesis pathway; YP_324569.1, structural genomics; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.30A {Bacillus cereus atcc 14579} PDB: 2gh1_A Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferase; tRNA modification enzyme, guanine 26, N(2),N(2)- dimethyltransferase; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)- methyltransferase [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 83 type II modification methyltransferase [Candidatus Libe
d1dcta_ 324 c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegypt 1e-17
d2c7pa1 327 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus hae 5e-16
d1g55a_ 343 c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606 1e-14
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Length = 324 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: C5 cytosine-specific DNA methylase, DCM
domain: DNA methylase HaeIII
species: Haemophilus aegyptius [TaxId: 197575]
 Score = 82.0 bits (201), Expect = 1e-17
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 4/79 (5%)

Query: 2  LKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKT 61
          + +  LF G GG+ L  ++           ++E +    KTY++N    LI GDI+KI +
Sbjct: 1  MNLISLFSGAGGLDLGFQKA----GFRIICANEYDKSIWKTYESNHSAKLIKGDISKISS 56

Query: 62 QDIPDHDVLLAGFPCQPFS 80
           + P  D ++ G PCQ +S
Sbjct: 57 DEFPKCDGIIGGPPCQSWS 75


>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Length = 327 Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Length = 343 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target83 type II modification methyltransferase [Candidatus Libe
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197 99.97
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 72 99.97
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus horiko 98.53
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus pyoge 98.41
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.34
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma acid 98.33
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae [TaxI 98.21
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [TaxId 98.11
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [TaxId 98.05
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii [Tax 98.05
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-terminal do 98.03
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal doma 97.92
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal doma 97.87
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium tumef 97.66
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia coli 97.48
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic doma 97.45
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga mariti 97.01
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcus jan 96.74
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Methano 96.66
d2f8la1 328 Hypothetical protein Lmo1582 {Listeria monocytogenes [T 96.56
d2b9ea1 293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 96.48
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus thermophil 96.43
d2h00a1250 Methyltransferase 10 domain containing protein METT10D 96.39
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, RsmB ( 96.2
d2ih2a1 223 DNA methylase TaqI, N-terminal domain {Thermus aquaticu 95.31
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Human (H 95.24
d1ixka_ 313 Hypothetical methyltransferase PH1374 {Archaeon Pyrococ 95.16
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (Saccha 94.92
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus (Encep 94.71
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rat 94.6
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikoshii [ 94.45
d1qama_ 235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' [Tax 94.42
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophilum [ 94.41
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Homo sap 94.37
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga marit 94.12
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Pyrococ 93.32
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leish 93.15
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulgidus 92.85
d2okca1 425 Type I restriction enzyme StySJI M protein {Bacteroides 91.36
d1ve3a1 226 Hypothetical protein PH0226 {Archaeon Pyrococcus horiko 91.27
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396] 91.16
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [TaxId 91.05
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 90.88
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium acetobu 90.73
d1p91a_ 268 rRNA methyltransferase RlmA {Escherichia coli [TaxId: 5 90.72
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermotoga m 90.09
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 95.99
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: C5 cytosine-specific DNA methylase, DCM
domain: DNA methylase HaeIII
species: Haemophilus aegyptius [TaxId: 197575]
Probab=99.97  E-value=5.7e-33  Score=183.67  Aligned_cols=78  Identities=33%  Similarity=0.674  Sum_probs=75.8

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCEEEEECCCCCCCCC
Q ss_conf             26964107947889999872220895699998069555112220012332321158975365788719998689975436
Q gi|254780516|r    2 LKITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKTQDIPDHDVLLAGFPCQPFSQ   81 (83)
Q Consensus         2 l~v~~LFsG~GG~~~gl~~a~~~~~~~~v~a~e~d~~a~~~y~~n~~~~~~~~DI~~~~~~~~~~~D~l~gG~PCq~fS~   81 (83)
                      ||++|||||+||+++||++|    |+++++++|+|++|+++|++|||...+++||++++.++++++|+|+||||||+||.
T Consensus         1 mk~~~lF~G~Gg~~~gl~~a----G~~~~~a~e~d~~a~~~~~~N~~~~~~~~Di~~~~~~~~~~~dll~~g~PCq~fS~   76 (324)
T d1dcta_           1 MNLISLFSGAGGLDLGFQKA----GFRIICANEYDKSIWKTYESNHSAKLIKGDISKISSDEFPKCDGIIGGPPCQSWSE   76 (324)
T ss_dssp             CEEEEESCSSCHHHHHHHHH----TCEEEEEEECCHHHHHHHHHHCCSEEEESCTTTSCGGGSCCCSEEEECCCCTTTSS
T ss_pred             CEEEEECCCCCHHHHHHHHC----CCEEEEEEECCHHHHHHHHHHCCCCCCCCCHHHCCHHHCCCCCEEEECCCCCCCCC
T ss_conf             91999370737899999987----99799999579999999998789997049824599857665667760255553112


Q ss_pred             CC
Q ss_conf             89
Q gi|254780516|r   82 AG   83 (83)
Q Consensus        82 aG   83 (83)
                      ||
T Consensus        77 ag   78 (324)
T d1dcta_          77 GG   78 (324)
T ss_dssp             SS
T ss_pred             CC
T ss_conf             33



>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure