254780519

254780519

flagellar biosynthesis protein FliQ

GeneID in NCBI database:8209514Locus tag:CLIBASIA_02030
Protein GI in NCBI database:254780519Protein Accession:YP_003064932.1
Gene range:+(762074, 762340)Protein Length:88aa
Gene description:flagellar biosynthesis protein FliQ
COG prediction:none
KEGG prediction:fliQ; flagellar biosynthesis protein FliQ; K02420 flagellar biosynthetic protein FliQ
SEED prediction:Flagellar biosynthesis protein FliQ
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------
MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSSL
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIsapfiggqISSFVTLVLSRIQSSL
MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSSL
MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSSL
***ADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSSL
MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSSL
*NEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSSL
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSSL
MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSSL
MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target88 flagellar biosynthesis protein FliQ [Candidatus Liberib
31512229088 flagellar biosynthesis protein FliQ [Candidatus Liberib 1 2e-36
11739533088 putative export protein [Gossypium hirsutum] Length = 8 1 7e-25
22214759588 flagellar biosynthesis protein FliQ [Agrobacterium viti 1 3e-24
22782088188 flagellar biosynthesis protein FliQ [Sinorhizobium fred 1 1e-23
16375803888 flagellar biosynthesis protein Q [Hoeflea phototrophica 1 1e-23
1596443888 flagellar biosynthesis protein FliQ [Sinorhizobium meli 1 2e-23
22208489188 flagellar biosynthesis transmembrane protein [Agrobacte 1 2e-23
1099853488 FliQ [Sinorhizobium meliloti] Length = 88 1 2e-23
11858996088 flagellar biosynthesis protein Q [Stappia aggregata IAM 1 4e-23
1347259888 flagellar biosynthesis protein FliQ [Mesorhizobium loti 1 1e-22
>gi|315122290|ref|YP_004062779.1| flagellar biosynthesis protein FliQ [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 88 Back     alignment and organism information
 Score =  155 bits (391), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/87 (90%), Positives = 85/87 (97%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEADVLEIARAA+WTILS+SAPVL +AMF G+L+AFLQALTQIQEVTLTFVPKIIAVFI
Sbjct: 1  MNEADVLEIARAAIWTILSASAPVLLAAMFFGVLVAFLQALTQIQEVTLTFVPKIIAVFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          TLIISAPFIGGQIS+FVTLVLSRIQSS
Sbjct: 61 TLIISAPFIGGQISAFVTLVLSRIQSS 87


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|117395330|gb|ABK34502.1| putative export protein [Gossypium hirsutum] Length = 88 Back     alignment and organism information
>gi|222147595|ref|YP_002548552.1| flagellar biosynthesis protein FliQ [Agrobacterium vitis S4] Length = 88 Back     alignment and organism information
>gi|227820881|ref|YP_002824851.1| flagellar biosynthesis protein FliQ [Sinorhizobium fredii NGR234] Length = 88 Back     alignment and organism information
>gi|163758038|ref|ZP_02165126.1| flagellar biosynthesis protein Q [Hoeflea phototrophica DFL-43] Length = 88 Back     alignment and organism information
>gi|15964438|ref|NP_384791.1| flagellar biosynthesis protein FliQ [Sinorhizobium meliloti 1021] Length = 88 Back     alignment and organism information
>gi|222084891|ref|YP_002543420.1| flagellar biosynthesis transmembrane protein [Agrobacterium radiobacter K84] Length = 88 Back     alignment and organism information
>gi|10998534|gb|AAG25964.1|AF300968_6 FliQ [Sinorhizobium meliloti] Length = 88 Back     alignment and organism information
>gi|118589960|ref|ZP_01547364.1| flagellar biosynthesis protein Q [Stappia aggregata IAM 12614] Length = 88 Back     alignment and organism information
>gi|13472598|ref|NP_104165.1| flagellar biosynthesis protein FliQ [Mesorhizobium loti MAFF303099] Length = 88 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target88 flagellar biosynthesis protein FliQ [Candidatus Liberib
PRK0601088 PRK06010, fliQ, flagellar biosynthesis protein FliQ; Re 1e-25
PRK1278188 PRK12781, fliQ, flagellar biosynthesis protein FliQ; Re 3e-19
TIGR0140288 TIGR01402, fliQ, flagellar biosynthetic protein FliQ 5e-14
pfam0131376 pfam01313, Bac_export_3, Bacterial export proteins, fam 3e-13
PRK0570089 PRK05700, fliQ, flagellar biosynthesis protein FliQ; Va 6e-13
PRK1535088 PRK15350, PRK15350, type III secretion system protein S 1e-08
TIGR0140381 TIGR01403, fliQ_rel_III, type III secretion protein, Hr 1e-08
COG479489 COG4794, EscS, Type III secretory pathway, component Es 9e-08
COG198789 COG1987, FliQ, Flagellar biosynthesis pathway, componen 1e-13
>gnl|CDD|180349 PRK06010, fliQ, flagellar biosynthesis protein FliQ; Reviewed Back     alignment and domain information
>gnl|CDD|139219 PRK12781, fliQ, flagellar biosynthesis protein FliQ; Reviewed Back     alignment and domain information
>gnl|CDD|130469 TIGR01402, fliQ, flagellar biosynthetic protein FliQ Back     alignment and domain information
>gnl|CDD|144785 pfam01313, Bac_export_3, Bacterial export proteins, family 3 Back     alignment and domain information
>gnl|CDD|180210 PRK05700, fliQ, flagellar biosynthesis protein FliQ; Validated Back     alignment and domain information
>gnl|CDD|185248 PRK15350, PRK15350, type III secretion system protein SsaS; Provisional Back     alignment and domain information
>gnl|CDD|130470 TIGR01403, fliQ_rel_III, type III secretion protein, HrpO family Back     alignment and domain information
>gnl|CDD|34403 COG4794, EscS, Type III secretory pathway, component EscS [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|32170 COG1987, FliQ, Flagellar biosynthesis pathway, component FliQ [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 88 flagellar biosynthesis protein FliQ [Candidatus Liberib
TIGR0140288 fliQ flagellar biosynthetic protein FliQ; InterPro: IPR 100.0
PRK1278188 fliQ flagellar biosynthesis protein FliQ; Reviewed 100.0
PRK0570089 fliQ flagellar biosynthesis protein FliQ; Validated 100.0
COG198789 FliQ Flagellar biosynthesis pathway, component FliQ [Ce 100.0
PRK0601088 fliQ flagellar biosynthesis protein FliQ; Reviewed 100.0
pfam0131376 Bac_export_3 Bacterial export proteins, family 3. This 100.0
TIGR0140381 fliQ_rel_III type III secretion protein, HrpO family; I 99.97
COG479489 EscS Type III secretory pathway, component EscS [Intrac 99.96
PRK05701250 fliR flagellar biosynthesis protein FliR; Reviewed 97.27
pfam01311249 Bac_export_1 Bacterial export proteins, family 1. This 97.05
PRK12772 609 bifunctional flagellar biosynthesis protein FliR/FlhB; 96.38
PRK12780250 fliR flagellar biosynthesis protein FliR; Reviewed 94.06
COG1684258 FliR Flagellar biosynthesis pathway, component FliR [Ce 93.75
TIGR01400248 fliR flagellar biosynthetic protein FliR; InterPro: IPR 92.9
TIGR00328 352 flhB flagellar biosynthetic protein FlhB; InterPro: IPR 92.16
COG1377 363 FlhB Flagellar biosynthesis pathway, component FlhB [Ce 90.86
>TIGR01402 fliQ flagellar biosynthetic protein FliQ; InterPro: IPR006305 These sequences represent FliQ, a protein involved in biosynthesis of bacterial flagella Back     alignment and domain information
>PRK12781 fliQ flagellar biosynthesis protein FliQ; Reviewed Back     alignment and domain information
>PRK05700 fliQ flagellar biosynthesis protein FliQ; Validated Back     alignment and domain information
>COG1987 FliQ Flagellar biosynthesis pathway, component FliQ [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06010 fliQ flagellar biosynthesis protein FliQ; Reviewed Back     alignment and domain information
>pfam01313 Bac_export_3 Bacterial export proteins, family 3 Back     alignment and domain information
>TIGR01403 fliQ_rel_III type III secretion protein, HrpO family; InterPro: IPR006306 This is one of several families of proteins related to bacterial flagellar biosynthesis proteins and involved in bacterial type III protein secretion systems Back     alignment and domain information
>COG4794 EscS Type III secretory pathway, component EscS [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05701 fliR flagellar biosynthesis protein FliR; Reviewed Back     alignment and domain information
>pfam01311 Bac_export_1 Bacterial export proteins, family 1 Back     alignment and domain information
>PRK12772 bifunctional flagellar biosynthesis protein FliR/FlhB; Provisional Back     alignment and domain information
>PRK12780 fliR flagellar biosynthesis protein FliR; Reviewed Back     alignment and domain information
>COG1684 FliR Flagellar biosynthesis pathway, component FliR [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01400 fliR flagellar biosynthetic protein FliR; InterPro: IPR006303 These sequences represent the FliR protein of bacterial flagellar biosynthesis Back     alignment and domain information
>TIGR00328 flhB flagellar biosynthetic protein FlhB; InterPro: IPR006136 The flhB and flhA genes constitute an operon called flhB operon on the Salmonella typhimurium chromosome Back     alignment and domain information
>COG1377 FlhB Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00