254780520

254780520

flagellar basal body rod modification protein

GeneID in NCBI database:8209515Locus tag:CLIBASIA_02035
Protein GI in NCBI database:254780520Protein Accession:YP_003064933.1
Gene range:+(761626, 762021)Protein Length:131aa
Gene description:flagellar basal body rod modification protein
COG prediction:[N] Flagellar hook capping protein
KEGG prediction:flgD; flagellar basal body rod modification protein; K02389 flagellar basal-body rod modification protein FlgD
SEED prediction:Flagellar basal-body rod modification protein FlgD
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN
ccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccEEEEEEEEEEcccccEEEEEcccEEEEEEEEEEcc
ccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEccccEEEEEEEEEEEcccEEEEEEcccEEEEccEEEEcc
meintevnptqqefskskskktlgQDAFLKLLITQIkhqdptepmkaSEQVAQLAVFSQMEQSVQMNSTLQELLKSnnlaqassyigknitnadgsiSGVVNAIQVsstgltaitvdnteipittgirisn
meintevnptqqefskskskktlGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSstgltaitvdnteipittgirisn
MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN
***************************FLKLLITQIKHQD***PMKASEQVAQLAVFS************************SSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS*
********************KTLGQDAFLKLLITQIKHQ**********QVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN
*********************TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN
MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN
MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target131 flagellar basal body rod modification protein [Candidat
315122289125 flagellar basal body rod modification protein [Candidat 1 2e-47
227820880148 flagellar basal body rod modification protein [Sinorhiz 1 6e-29
86356335142 flagellar basal body rod modification protein [Rhizobiu 1 4e-28
190890387141 flagellar basal-body rod protein [Rhizobium etli CIAT 6 1 2e-27
218506521118 flagellar basal body rod modification protein [Rhizobiu 1 8e-27
116250505142 flagellar basal body rod modification protein [Rhizobiu 1 2e-25
237817497151 flagellar basal body rod modification protein [Brucella 1 3e-25
17988508137 flagellar basal body rod modification protein [Brucella 1 4e-25
163758037133 flagellar basal-body rod modification protein D [Hoefle 1 8e-25
13472597135 flagellar basal body rod modification protein [Mesorhiz 1 8e-25
>gi|315122289|ref|YP_004062778.1| flagellar basal body rod modification protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 125 Back     alignment and organism information
 Score =  191 bits (486), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/124 (75%), Positives = 105/124 (84%)

Query: 7   VNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 66
           +N TQ+E   SK    +G DAF KLLI Q+KHQDPTEPMKASEQVAQLAVFSQMEQSVQM
Sbjct: 1   MNSTQKESLPSKPNTMMGHDAFFKLLIAQMKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 60

Query: 67  NSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
           N+ L+ELL SNNLAQASSYIGKNI N DGS+SG+V A+QVSSTGLTAIT +N EIPI TG
Sbjct: 61  NTNLKELLNSNNLAQASSYIGKNIENVDGSMSGIVKAVQVSSTGLTAITAENQEIPIKTG 120

Query: 127 IRIS 130
           IR+S
Sbjct: 121 IRVS 124


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227820880|ref|YP_002824850.1| flagellar basal body rod modification protein [Sinorhizobium fredii NGR234] Length = 148 Back     alignment and organism information
>gi|86356335|ref|YP_468227.1| flagellar basal body rod modification protein [Rhizobium etli CFN 42] Length = 142 Back     alignment and organism information
>gi|190890387|ref|YP_001976929.1| flagellar basal-body rod protein [Rhizobium etli CIAT 652] Length = 141 Back     alignment and organism information
>gi|218506521|ref|ZP_03504399.1| flagellar basal body rod modification protein [Rhizobium etli Brasil 5] Length = 118 Back     alignment and organism information
>gi|116250505|ref|YP_766343.1| flagellar basal body rod modification protein [Rhizobium leguminosarum bv. viciae 3841] Length = 142 Back     alignment and organism information
>gi|237817497|ref|ZP_04596488.1| flagellar basal body rod modification protein [Brucella abortus str. 2308 A] Length = 151 Back     alignment and organism information
>gi|17988508|ref|NP_541141.1| flagellar basal body rod modification protein [Brucella melitensis bv. 1 str. 16M] Length = 137 Back     alignment and organism information
>gi|163758037|ref|ZP_02165125.1| flagellar basal-body rod modification protein D [Hoeflea phototrophica DFL-43] Length = 133 Back     alignment and organism information
>gi|13472597|ref|NP_104164.1| flagellar basal body rod modification protein [Mesorhizobium loti MAFF303099] Length = 135 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target131 flagellar basal body rod modification protein [Candidat
PRK06009140 PRK06009, flgD, flagellar basal body rod modification p 1e-28
PRK09618142 PRK09618, flgD, flagellar basal body rod modification p 3e-19
COG1843222 COG1843, FlgD, Flagellar hook capping protein [Cell mot 8e-17
PRK12634221 PRK12634, flgD, flagellar basal body rod modification p 7e-09
PRK11911140 PRK11911, flgD, flagellar basal body rod modification p 6e-08
PRK06792190 PRK06792, flgD, flagellar basal body rod modification p 7e-06
PRK09619218 PRK09619, flgD, flagellar basal body rod modification p 2e-05
PRK12813223 PRK12813, flgD, flagellar basal body rod modification p 4e-14
PRK06655225 PRK06655, flgD, flagellar basal body rod modification p 2e-13
PRK12812 259 PRK12812, flgD, flagellar basal body rod modification p 2e-08
PRK12633230 PRK12633, flgD, flagellar basal body rod modification p 5e-07
PRK05842 295 PRK05842, flgD, flagellar basal body rod modification p 1e-05
pfam03963140 pfam03963, FlgD, Flagellar hook capping protein 5e-18
>gnl|CDD|168345 PRK06009, flgD, flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>gnl|CDD|181995 PRK09618, flgD, flagellar basal body rod modification protein; Provisional Back     alignment and domain information
>gnl|CDD|32028 COG1843, FlgD, Flagellar hook capping protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|183639 PRK12634, flgD, flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>gnl|CDD|138812 PRK11911, flgD, flagellar basal body rod modification protein; Provisional Back     alignment and domain information
>gnl|CDD|180695 PRK06792, flgD, flagellar basal body rod modification protein; Validated Back     alignment and domain information
>gnl|CDD|181996 PRK09619, flgD, flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>gnl|CDD|183764 PRK12813, flgD, flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>gnl|CDD|180647 PRK06655, flgD, flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>gnl|CDD|139245 PRK12812, flgD, flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>gnl|CDD|183638 PRK12633, flgD, flagellar basal body rod modification protein; Provisional Back     alignment and domain information
>gnl|CDD|180283 PRK05842, flgD, flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>gnl|CDD|146544 pfam03963, FlgD, Flagellar hook capping protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 131 flagellar basal body rod modification protein [Candidat
PRK06009135 flgD flagellar basal body rod modification protein; Rev 100.0
PRK09618146 flgD flagellar basal body rod modification protein; Pro 100.0
PRK11911140 flgD flagellar basal body rod modification protein; Pro 100.0
PRK06792190 flgD flagellar basal body rod modification protein; Val 99.98
COG1843222 FlgD Flagellar hook capping protein [Cell motility and 99.97
PRK12812 259 flgD flagellar basal body rod modification protein; Rev 100.0
PRK12634221 flgD flagellar basal body rod modification protein; Rev 99.98
PRK12813223 flgD flagellar basal body rod modification protein; Rev 99.97
pfam03963140 FlgD Flagellar hook capping protein. FlgD is known to b 99.97
PRK12633230 flgD flagellar basal body rod modification protein; Pro 99.97
PRK06655225 flgD flagellar basal body rod modification protein; Rev 99.97
PRK05842 269 flgD flagellar basal body rod modification protein; Rev 99.97
PRK09619220 flgD flagellar basal body rod modification protein; Rev 99.96
>PRK06009 flgD flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>PRK09618 flgD flagellar basal body rod modification protein; Provisional Back     alignment and domain information
>PRK11911 flgD flagellar basal body rod modification protein; Provisional Back     alignment and domain information
>PRK06792 flgD flagellar basal body rod modification protein; Validated Back     alignment and domain information
>COG1843 FlgD Flagellar hook capping protein [Cell motility and secretion] Back     alignment and domain information
>PRK12812 flgD flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>PRK12634 flgD flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>PRK12813 flgD flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>pfam03963 FlgD Flagellar hook capping protein Back     alignment and domain information
>PRK12633 flgD flagellar basal body rod modification protein; Provisional Back     alignment and domain information
>PRK06655 flgD flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>PRK05842 flgD flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>PRK09619 flgD flagellar basal body rod modification protein; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target131 flagellar basal body rod modification protein [Candidat
3c12_A138 FLGD, flagellar protein; HOOK capping, IG-like domain, 95.59
>3c12_A FLGD, flagellar protein; HOOK capping, IG-like domain, FN-III domain, tudor-like domain, flagellar biogenesis, flagellum; 2.51A {Xanthomonas campestris PV} Back     alignment and structure
Probab=95.59  E-value=0.023  Score=32.25  Aligned_cols=32  Identities=19%  Similarity=0.397  Sum_probs=18.6

Q ss_pred             EEEEEEEEECCCCEEEEEE-CCEEEECCCCEEEE
Q ss_conf             9999788862796699997-89789623105860
Q gi|254780520|r   98 SGVVNAIQVSSTGLTAITV-DNTEIPITTGIRIS  130 (131)
Q Consensus        98 ~G~v~~V~~~~~g~~~~~v-~~~~v~~~~v~~V~  130 (131)
                      .|.|++|++..++ +.+.+ ++..+++..|.+|+
T Consensus       106 ~~~V~~V~~~~~~-~~L~l~g~~~v~~~~V~~Is  138 (138)
T 3c12_A          106 DAPVDSVTIGSDG-LYLNLTGLGTSPLANVLRVS  138 (138)
T ss_dssp             EEEEEEEEEETTE-EEEEETTTEEEETTSCCBCC
T ss_pred             EEEEEEEEECCCC-EEEEECCCCEEEHHHEEECC
T ss_conf             9999999976990-79998799599489909909




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 131 flagellar basal body rod modification protein [Can
1xf1_A_616-828213 (A:616-828) C5A peptidase, SCP; hydrolase; HET: CI 5e-11
>1xf1_A (A:616-828) C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A*Length = 213 Back     alignment and structure
 Score = 61.1 bits (147), Expect = 5e-11
 Identities = 7/108 (6%), Positives = 26/108 (24%), Gaps = 3/108 (2%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKS 76
             +    ++     +  K Q   + ++           +       +   ++E    ++ 
Sbjct: 4   YDSKDGSSYYHEANSDAKDQLDGDGLQFYALKNNFTALTTESNPWTIIKAVKEGVENIED 63

Query: 77  NNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPIT 124
              ++ +  I           S        +     AI+ +       
Sbjct: 64  IESSEITETIFAGTFAKQDDDSHYYIHRHANGKPYAAISPNGDGNRDY 111


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target131 flagellar basal body rod modification protein [Candidat
1xf1_A_616-828213 C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St 99.44
>1xf1_A (A:616-828) C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Back     alignment and structure
Probab=99.44  E-value=7.4e-18  Score=122.44  Aligned_cols=77  Identities=5%  Similarity=-0.003  Sum_probs=67.7

Q ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHCCCEEECCC
Q ss_conf             7733338899999999983299899988978999999999999999999999999999---9997645532261466389
Q gi|254780520|r   18 KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK---SNNLAQASSYIGKNITNAD   94 (131)
Q Consensus        18 ~~~~~l~~d~FLkLL~aQL~nQDP~~P~d~~e~isQlAqfs~leq~~~~~~~l~~~~~---~~~~~~a~sliGk~V~~~~   94 (131)
                      +.++.++++.||+||++||+||||++|||+++|++|+|||+++|++.++++.+..+..   ..+..++.+++|+.+...+
T Consensus         2 ~~~~~~~~~~Fl~ll~~q~~nqdp~~p~~~~~f~~q~aq~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~   81 (213)
T 1xf1_A            2 PIYDSKDGSSYYHEANSDAKDQLDGDGLQFYALKNNFTALTTESNPWTIIKAVKEGVENIEDIESSEITETIFAGTFAKQ   81 (213)
T ss_dssp             CGGGCSSSCCSSCCCCTTCTTBCCCSTTSCCTTSSCSSEEEEEECCHHHHHHHHHTCSCSTTSSCCCCCEEEETTEEECS
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEC
T ss_conf             33235666531024566665554554431234555446441223454212222344211244555555542112410001