254780532

254780532

aminodeoxychorismate lyase

GeneID in NCBI database:8209528Locus tag:CLIBASIA_02095
Protein GI in NCBI database:254780532Protein Accession:YP_003064945.1
Gene range:+(747913, 748890)Protein Length:325aa
Gene description:aminodeoxychorismate lyase
COG prediction:[R] Predicted periplasmic solute-binding protein
KEGG prediction:aminodeoxychorismate lyase; K07082
SEED prediction:FIG004453: protein YceG like
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-----
MLKFLIPLITIFLLAIGVHIHVIRVYNATGPLQNDTIFLVRNNMSLKEISKNLFNGGVIVNPYIFRYVTQFYFGSRGLKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFTVKQMARRLKDNPLLVGELPLELPLEGTLCPSTYNFPLGTHRSEILNQAMLKQKQVVDEVWEIRDVDHPIKSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYGILEGDYDLTNRKISRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKPLHTEDLYFVGDGKGGHFFSTNFKDHTINVQKWRKMSLESKP
cHHHHHHHHHHHHHHHHHHHccEEEccccccccccEEEEEcccccHHHHHHHHHHccccccHHHHHHHHHHccccccccccEEEccccccHHHHHHHHHHccEEEEEEEEcccccHHHHHHHHHccHHHHHHccccccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHHcccccccccccccHHHHcccccccccccccccccccccccHHHHHHHcccccccEEEEEEcccccEEEcccHHHHHHHHHHHHHHHHHccc
cHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEccccccHHHHHHHHHHcccccccHHHHHHHHEcccccccccccEEccccccHHHHHHHHHcccEEEEEEEEcccccHHHHHHHHHcccccEEcccccccccccccccccEccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccHHHccccccccEEEEccccccccccccHHHHHHHHccccccEEEEEEccccccEccccHHHHHHHHHHHHHHHHcccc
MLKFLIPLITIFLLAIGVHIHVIRVynatgplqndtiFLVRNNMSLKEISKNLfnggvivnpYIFRYVTQFyfgsrglktgeyeiekgssMSQIAEKIMYGKVLMhsisfpegftVKQMARRlkdnpllvgelplelplegtlcpstynfplgthRSEILNQAMLKQKQVVDEVweirdvdhpikskeDLVILASIVEKETSRADERAHVASVFINRFSksirlqsdstVIYGILegdydltnrkisrsdfsiktpynsylmnglpptaisnpgrlsleavakplhtedlyfvgdgkgghffstnfkdhtINVQKWRKMSLESKP
MLKFLIPLITIFLLAIGVHIHVIRVYNATGPLQNDTIFLVRNNMSLKEISKNLFNGGVIVNPYIFRYVTQFYFGSRGLKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFTVKQMARRLKDNPLLVGELPLELPLEGTLCPSTYNFPLGTHRSEILNQAMLKQKQVVDEVWEIRdvdhpikskedlvILASIVEketsraderahVASVfinrfsksirlqsdstvIYGILegdydltnrkiSRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKPLHTEDLYFVGDGKGGHFFstnfkdhtinvQKWRKMSLESKP
MLKFLIPLITIFLLAIGVHIHVIRVYNATGPLQNDTIFLVRNNMSLKEISKNLFNGGVIVNPYIFRYVTQFYFGSRGLKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFTVKQMARRLKDNpllvgelplelplegtlCPSTYNFPLGTHRSEILNQAMLKQKQVVDEVWEIRDVDHPIKSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYGILEGDYDLTNRKISRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKPLHTEDLYFVGDGKGGHFFSTNFKDHTINVQKWRKMSLESKP
MLKFLIPLITIFLLAIGVHIHVIRVYNATGPLQNDTIFLVRNNMSLKEISKNLFNGGVIVNPYIFRYVTQFYFGSRGLKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFTVKQMARRLKDNPLLVGELPLELPLEGTLCPSTYNFPLGTHRSEILNQAMLKQKQVVDEVWE**D***PIKSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYGILEGDYDLTNRKISRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKPLHTEDLYFVGDGKGGHFFSTNFKDHTINVQKW**M******
MLKFLIPLITIFLLAIGVHIHVIRVYNATGPLQNDTIFLVRNNMSLKEISKNLFNGGVIVNPYIFRYVTQFYFGSRGLKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFTVKQMARRLKDNPLLVGELPLELPLEGTLCPSTYNFPLGTHRSEILNQAMLKQKQVVDEVWEIRDVDHPIKSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYGILEGDYDLTNRKISRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKPLHTEDLYFVGDGKGGHFFSTNFKDHTINVQKW*********
MLKFLIPLITIFLLAIGVHIHVIRVYNATGPLQNDTIFLVRNNMSLKEISKNLFNGGVIVNPYIFRYVTQFYFGSRGLKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFTVKQMARRLKDNPLLVGELPLELPLEGTLCPSTYNFPLGTHRSEILNQAMLKQKQVVDEVWEIRDVDHPIKSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYGILEGDYDLTNRKISRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKPLHTEDLYFVGDGKGGHFFSTNFKDHTINVQKWRKMSL****
oooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKFLIPLITIFLLAIGVHIHVIRVYNATGPLQNDTIFLVRNNMSLKEISKNLFNGGVIVNPYIFRYVTQFYFGSRGLKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFTVKQMARRLKDNPLLVGELPLELPLEGTLCPSTYNFPLGTHRSEILNQAMLKQKQVVDEVWEIRDVDHPIKSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYGILEGDYDLTNRKISRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKPLHTEDLYFVGDGKGGHFFSTNFKDHTINVQKWRKMSLESKP
MLKFLIPLITIFLLAIGVHIHVIRVYNATGPLQNDTIFLVRNNMSLKEISKNLFNGGVIVNPYIFRYVTQFYFGSRGLKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFTVKQMARRLKDNPLLVGELPLELPLEGTLCPSTYNFPLGTHRSEILNQAMLKQKQVVDEVWEIRDVDHPIKSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYGILEGDYDLTNRKISRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKPLHTEDLYFVGDGKGGHFFSTNFKDHTINVQKWRKMSLESKP
MLKFLIPLITIFLLAIGVHIHVIRVYNATGPLQNDTIFLVRNNMSLKEISKNLFNGGVIVNPYIFRYVTQFYFGSRGLKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFTVKQMARRLKDNPLLVGELPLELPLEGTLCPSTYNFPLGTHRSEILNQAMLKQKQVVDEVWEIRDVDHPIKSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYGILEGDYDLTNRKISRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKPLHTEDLYFVGDGKGGHFFSTNFKDHTINVQKWRKMSLESKP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target325 aminodeoxychorismate lyase [Candidatus Liberibacter asi
315122861341 aminodeoxychorismate lyase [Candidatus Liberibacter sol 1 1e-137
150395972399 aminodeoxychorismate lyase [Sinorhizobium medicae WSM41 1 2e-87
209548663412 aminodeoxychorismate lyase [Rhizobium leguminosarum bv. 1 3e-87
15964898399 hypothetical protein SMc00575 [Sinorhizobium meliloti 1 1 3e-87
86357084350 hypothetical protein RHE_CH01446 [Rhizobium etli CFN 42 1 4e-87
190891128405 aminodeoxychorismate lyase [Rhizobium etli CIAT 652] Le 1 3e-86
15888439406 hypothetical protein Atu1099 [Agrobacterium tumefaciens 1 4e-86
227821468395 aminodeoxychorismate lyase [Sinorhizobium fredii NGR234 1 5e-86
241203941405 aminodeoxychorismate lyase [Rhizobium leguminosarum bv. 1 3e-85
116251327405 aminodeoxychorismate lyase [Rhizobium leguminosarum bv. 1 1e-84
>gi|315122861|ref|YP_004063350.1| aminodeoxychorismate lyase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 341 Back     alignment and organism information
 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 230/325 (70%), Positives = 274/325 (84%)

Query: 1   MLKFLIPLITIFLLAIGVHIHVIRVYNATGPLQNDTIFLVRNNMSLKEISKNLFNGGVIV 60
            LK ++  + + +  IG++ +V R+Y+A GPLQN+ IFL+RN MSLKE SK LFN  +I 
Sbjct: 17  FLKVVLAFLIVLIFGIGIYFYVSRIYHAKGPLQNNVIFLIRNGMSLKETSKKLFNSRIIS 76

Query: 61  NPYIFRYVTQFYFGSRGLKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFTVKQMA 120
           NPYIFRY+TQ  FGS+ +K GEYE+E GSSM Q+AEKI+YGK  M+SISFPEGFTVKQ+ 
Sbjct: 77  NPYIFRYLTQMRFGSQSVKAGEYEVEIGSSMLQVAEKIIYGKYFMYSISFPEGFTVKQIF 136

Query: 121 RRLKDNPLLVGELPLELPLEGTLCPSTYNFPLGTHRSEILNQAMLKQKQVVDEVWEIRDV 180
           +RLK+NP L+GELP ELP EGTL PSTY F LGTHRSEI+ +A+L+QK++VD+VWEIRDV
Sbjct: 137 KRLKENPFLIGELPAELPREGTLYPSTYKFSLGTHRSEIIEKAILEQKKIVDDVWEIRDV 196

Query: 181 DHPIKSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYGILEGDYD 240
           ++ IKSKEDLVILASIVEKETSR+DER HVASVFINR S SIRLQ+DSTVIYG  EGDY+
Sbjct: 197 NNFIKSKEDLVILASIVEKETSRSDERPHVASVFINRLSNSIRLQADSTVIYGAFEGDYE 256

Query: 241 LTNRKISRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKPLHTEDLYFVGDGKGGH 300
           L  R++ RSDF  KTPYNSYL+NGLPPTAISNP RLSLEAVAKPL T+DLYFV DG+GGH
Sbjct: 257 LAERQLKRSDFYKKTPYNSYLVNGLPPTAISNPSRLSLEAVAKPLQTDDLYFVSDGRGGH 316

Query: 301 FFSTNFKDHTINVQKWRKMSLESKP 325
           FFS NFKDH +NVQKWRK+S +SKP
Sbjct: 317 FFSKNFKDHGVNVQKWRKISSKSKP 341


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150395972|ref|YP_001326439.1| aminodeoxychorismate lyase [Sinorhizobium medicae WSM419] Length = 399 Back     alignment and organism information
>gi|209548663|ref|YP_002280580.1| aminodeoxychorismate lyase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 412 Back     alignment and organism information
>gi|15964898|ref|NP_385251.1| hypothetical protein SMc00575 [Sinorhizobium meliloti 1021] Length = 399 Back     alignment and organism information
>gi|86357084|ref|YP_468976.1| hypothetical protein RHE_CH01446 [Rhizobium etli CFN 42] Length = 350 Back     alignment and organism information
>gi|190891128|ref|YP_001977670.1| aminodeoxychorismate lyase [Rhizobium etli CIAT 652] Length = 405 Back     alignment and organism information
>gi|15888439|ref|NP_354120.1| hypothetical protein Atu1099 [Agrobacterium tumefaciens str. C58] Length = 406 Back     alignment and organism information
>gi|227821468|ref|YP_002825438.1| aminodeoxychorismate lyase [Sinorhizobium fredii NGR234] Length = 395 Back     alignment and organism information
>gi|241203941|ref|YP_002975037.1| aminodeoxychorismate lyase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 405 Back     alignment and organism information
>gi|116251327|ref|YP_767165.1| aminodeoxychorismate lyase [Rhizobium leguminosarum bv. viciae 3841] Length = 405 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target325 aminodeoxychorismate lyase [Candidatus Liberibacter asi
COG1559342 COG1559, COG1559, Predicted periplasmic solute-binding 5e-81
TIGR00247342 TIGR00247, TIGR00247, conserved hypothetical protein, Y 2e-58
PRK10270340 PRK10270, PRK10270, putative aminodeoxychorismate lyase 7e-53
cd08010245 cd08010, yceG_like, proteins similar to Escherichia col 5e-65
pfam02618287 pfam02618, YceG, YceG-like family 2e-86
>gnl|CDD|31747 COG1559, COG1559, Predicted periplasmic solute-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|161789 TIGR00247, TIGR00247, conserved hypothetical protein, YceG family Back     alignment and domain information
>gnl|CDD|182348 PRK10270, PRK10270, putative aminodeoxychorismate lyase; Provisional Back     alignment and domain information
>gnl|CDD|153433 cd08010, yceG_like, proteins similar to Escherichia coli yceG Back     alignment and domain information
>gnl|CDD|145655 pfam02618, YceG, YceG-like family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 325 aminodeoxychorismate lyase [Candidatus Liberibacter asi
PRK10270340 hypothetical protein; Provisional 100.0
COG1559342 Aminodeoxychorismate lyase [Coenzyme transport and meta 100.0
TIGR00247373 TIGR00247 conserved hypothetical protein TIGR00247; Int 100.0
pfam02618287 YceG YceG-like family. This family of proteins is found 100.0
cd08010245 yceG_like proteins similar to Escherichia coli yceG. Th 100.0
TIGR02869232 spore_SleB spore cortex-lytic enzyme; InterPro: IPR0142 96.63
pfam02618287 YceG YceG-like family. This family of proteins is found 95.68
cd08010245 yceG_like proteins similar to Escherichia coli yceG. Th 95.49
COG1559342 Aminodeoxychorismate lyase [Coenzyme transport and meta 93.97
PRK10270340 hypothetical protein; Provisional 94.53
TIGR00247373 TIGR00247 conserved hypothetical protein TIGR00247; Int 92.56
>PRK10270 hypothetical protein; Provisional Back     alignment and domain information
>COG1559 Aminodeoxychorismate lyase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00247 TIGR00247 conserved hypothetical protein TIGR00247; InterPro: IPR003770 This family contains several aminodeoxychorismate lyase proteins Back     alignment and domain information
>pfam02618 YceG YceG-like family Back     alignment and domain information
>cd08010 yceG_like proteins similar to Escherichia coli yceG Back     alignment and domain information
>TIGR02869 spore_SleB spore cortex-lytic enzyme; InterPro: IPR014224 The entry represents the spore cortex-lytic enzyme SleB from Bacillus subtilis and other Gram-positive, endospore-forming bacterial species Back     alignment and domain information
>pfam02618 YceG YceG-like family Back     alignment and domain information
>cd08010 yceG_like proteins similar to Escherichia coli yceG Back     alignment and domain information
>COG1559 Aminodeoxychorismate lyase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK10270 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00247 TIGR00247 conserved hypothetical protein TIGR00247; InterPro: IPR003770 This family contains several aminodeoxychorismate lyase proteins Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target325 aminodeoxychorismate lyase [Candidatus Liberibacter asi
2r1f_A270 Crystal Structure Of Predicted Aminodeoxychorismate 2e-48
>gi|158430555|pdb|2R1F|A Chain A, Crystal Structure Of Predicted Aminodeoxychorismate Lyase From Escherichia Coli Length = 270 Back     alignment and structure
 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 97/270 (35%), Positives = 131/270 (48%), Gaps = 18/270 (6%)

Query: 68  VTQFYFGSRGLKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFTVKQMARRLKDNP 127
           + +        K G Y      ++ +  + +  GK     +   EG  +    ++L++ P
Sbjct: 2   LLRIEPDLSHFKAGTYRFTPQXTVREXLKLLESGKEAQFPLRLVEGXRLSDYLKQLREAP 61

Query: 128 LLVGELPLELP--------------LEGTLCPSTYNFPLGTHRSEILNQAMLKQKQVVDE 173
            +   L  +                +EG   P T+ +   T    +L +A  K  + VD 
Sbjct: 62  YIKHTLSDDKYATVAQALELENPEWIEGWFWPDTWXYTANTTDVALLKRAHKKXVKAVDS 121

Query: 174 VWEIRDVDHPIKSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYG 233
            WE R    P K K  LV  ASI+EKET+ A ER  VASVFINR     RLQ+D TVIYG
Sbjct: 122 AWEGRADGLPYKDKNQLVTXASIIEKETAVASERDQVASVFINRLRIGXRLQTDPTVIYG 181

Query: 234 ILEGDYDLTNRKISRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKPLHTEDLYFV 293
             E      N K+SR+D    T YN+Y + GLPP AI+ PG  SL+A A P  T  LYFV
Sbjct: 182 XGE----RYNGKLSRADLETPTAYNTYTITGLPPGAIATPGADSLKAAAHPAKTPYLYFV 237

Query: 294 GDGKGGHFFSTNFKDHTINVQKWRKMSLES 323
            DGKGGH F+TN   H  +VQ + K+  E 
Sbjct: 238 ADGKGGHTFNTNLASHNKSVQDYLKVLKEK 267


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target325 aminodeoxychorismate lyase [Candidatus Liberibacter asi
2r1f_A270 Protein YCEG, predicted aminodeoxychorismate lyase; str 1e-46
>2r1f_A Protein YCEG, predicted aminodeoxychorismate lyase; structural genomics, unknown function, PFAM 02618, PSI-2, protein structure initiative; 2.21A {Escherichia coli K12} Length = 270 Back     alignment and structure
 Score =  181 bits (461), Expect = 1e-46
 Identities = 96/255 (37%), Positives = 131/255 (51%), Gaps = 18/255 (7%)

Query: 78  LKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFTVKQMARRLKDNPLLVG------ 131
            K G Y      ++ ++ + +  GK     +   EG  +    ++L++ P +        
Sbjct: 12  FKAGTYRFTPQMTVREMLKLLESGKEAQFPLRLVEGMRLSDYLKQLREAPYIKHTLSDDK 71

Query: 132 --------ELPLELPLEGTLCPSTYNFPLGTHRSEILNQAMLKQKQVVDEVWEIRDVDHP 183
                   EL     +EG   P T+ +   T    +L +A  K  + VD  WE R    P
Sbjct: 72  YATVAQALELENPEWIEGWFWPDTWMYTANTTDVALLKRAHKKMVKAVDSAWEGRADGLP 131

Query: 184 IKSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYGILEGDYDLTN 243
            K K  LV +ASI+EKET+ A ER  VASVFINR    +RLQ+D TVIYG+     +  N
Sbjct: 132 YKDKNQLVTMASIIEKETAVASERDQVASVFINRLRIGMRLQTDPTVIYGM----GERYN 187

Query: 244 RKISRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKPLHTEDLYFVGDGKGGHFFS 303
            K+SR+D    T YN+Y + GLPP AI+ PG  SL+A A P  T  LYFV DGKGGH F+
Sbjct: 188 GKLSRADLETPTAYNTYTITGLPPGAIATPGADSLKAAAHPAKTPYLYFVADGKGGHTFN 247

Query: 304 TNFKDHTINVQKWRK 318
           TN   H  +VQ + K
Sbjct: 248 TNLASHNKSVQDYLK 262


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target325 aminodeoxychorismate lyase [Candidatus Liberibacter asi
2r1f_A270 Protein YCEG, predicted aminodeoxychorismate lyase; str 100.0
2r1f_A270 Protein YCEG, predicted aminodeoxychorismate lyase; str 93.6
>2r1f_A Protein YCEG, predicted aminodeoxychorismate lyase; structural genomics, unknown function, PFAM 02618, PSI-2, protein structure initiative; 2.21A {Escherichia coli K12} Back     alignment and structure
Probab=100.00  E-value=0  Score=619.93  Aligned_cols=253  Identities=38%  Similarity=0.587  Sum_probs=235.6

Q ss_pred             HHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC-------------
Q ss_conf             9995386676257204406787589999986102433321011110348999998620731113443-------------
Q gi|254780532|r   68 VTQFYFGSRGLKTGEYEIEKGSSMSQIAEKIMYGKVLMHSISFPEGFTVKQMARRLKDNPLLVGELP-------------  134 (325)
Q Consensus        68 ~~~~~~~~~~ikaG~Y~i~~~~s~~~il~~L~~G~~~~~~iTI~EG~t~~ei~~~L~~~~~l~~~~~-------------  134 (325)
                      ++|+.+...+||||+|.|+++||..+|+..|.+|++..++||||||+|+.||+++|++...+.....             
T Consensus         2 llr~~p~~s~ikaG~Y~l~~~ms~~~i~~~L~~G~~~~~~vtI~EG~t~~~i~~~L~~~~~i~~~~~~~~~~~~~~~~~~   81 (270)
T 2r1f_A            2 LLRIEPDLSHFKAGTYRFTPQMTVREMLKLLESGKEAQFPLRLVEGMRLSDYLKQLREAPYIKHTLSDDKYATVAQALEL   81 (270)
T ss_dssp             ---------CCCCEEEEECTTCCHHHHHHHHHHCCCCCEEEECCTTCCHHHHHHHHHSSTTCBCCCSCCCHHHHHHHHTC
T ss_pred             CEEECCCCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             64107682560547989799999999999986489615899977885399999999857154011222467888864276


Q ss_pred             -CCCCCCCCCCHHHEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             -6688100003011210146897899999999999987556554531066765999999887777652672578899999
Q gi|254780532|r  135 -LELPLEGTLCPSTYNFPLGTHRSEILNQAMLKQKQVVDEVWEIRDVDHPIKSKEDLVILASIVEKETSRADERAHVASV  213 (325)
Q Consensus       135 -~~~~lEG~l~PdTY~~~~~~s~~~il~~m~~~~~~~~~~~~~~~~~~~~~~s~~evlilASIVEkEa~~~~e~~~IA~V  213 (325)
                       ...++|||||||||+|.+++++++|+++|+++|.+++++.|..+....++.|++|+||||||||+||+.++|||+||||
T Consensus        82 ~~~~~lEG~LfPdTY~~~~~~t~~~il~~m~~~~~~~~~~~~~~~~~~~~~~s~~e~ltlASIVEkEa~~~~e~~~IA~V  161 (270)
T 2r1f_A           82 ENPEWIEGWFWPDTWMYTANTTDVALLKRAHKKMVKAVDSAWEGRADGLPYKDKNQLVTMASIIEKETAVASERDQVASV  161 (270)
T ss_dssp             SSTTSCTTCSCCSEEEECTTCBHHHHHHHHHHHHHHHHHHHHHTCCTTCCCSSHHHHHHHHHHHHHHCCSGGGHHHHHHH
T ss_pred             CCCCCCCEEECCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             88777014761866641255889999999999999998777765531035678999999999988851571668999999


Q ss_pred             HHHHHCCCCEEEEEEEEEEECCCCCCCCCCCCCCCHHHCCCCCCHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEEE
Q ss_conf             99974058702442221010155667754200000010156830110238889998664327989996087889879999
Q gi|254780532|r  214 FINRFSKSIRLQSDSTVIYGILEGDYDLTNRKISRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKPLHTEDLYFV  293 (325)
Q Consensus       214 ~~NRL~~~M~Lq~D~Tv~Y~l~~~~~~~~~~~~~~~dl~~~spYNTY~~~GLPP~PI~~pg~~ai~A~l~p~~~dylyfv  293 (325)
                      |+|||++||+||+||||+||+++.    ..++++++|++++||||||+++|||||||||||.+||+||+||+++||||||
T Consensus       162 ~~NRL~~~m~Lq~D~Tv~Y~~~~~----~~~~~~~~dl~~~sPYNTY~~~GLPPgPI~~Pg~~ai~Aal~P~~~~ylyFv  237 (270)
T 2r1f_A          162 FINRLRIGMRLQTDPTVIYGMGER----YNGKLSRADLETPTAYNTYTITGLPPGAIATPGADSLKAAAHPAKTPYLYFV  237 (270)
T ss_dssp             HHHHHHHTCCCCCHHHHHHHHGGG----CCSCCCHHHHHSCCTTCTTTSSSCCSSCSSCCCHHHHHHHHSCCCCCCCEEE
T ss_pred             HHHHCCCCCCCCCCCHHHHHCCCC----CCCCCCHHHHCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHCCCCCCEEEEE
T ss_conf             999634699877673445304675----4554207775268852431507999976678799999998688888849999


Q ss_pred             ECCCCCEEECCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             8389876652999999999999999987288
Q gi|254780532|r  294 GDGKGGHFFSTNFKDHTINVQKWRKMSLESK  324 (325)
Q Consensus       294 ~~~~g~h~Fs~t~~eH~~nv~~y~~~~~~~k  324 (325)
                      +|++|+|+||+||+||++||++||+|++++.
T Consensus       238 a~~~G~~~Fs~t~~eH~~~v~~y~~~~~~~~  268 (270)
T 2r1f_A          238 ADGKGGHTFNTNLASHNKSVQDYLKVLKEKN  268 (270)
T ss_dssp             ECSSSSEEEESSHHHHHHHHHHHHHHHHHHH
T ss_pred             ECCCCCEEECCCHHHHHHHHHHHHHHHHHHC
T ss_conf             8599977807899999999999999999851



>2r1f_A Protein YCEG, predicted aminodeoxychorismate lyase; structural genomics, unknown function, PFAM 02618, PSI-2, protein structure initiative; 2.21A {Escherichia coli K12} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 325 aminodeoxychorismate lyase [Candidatus Liberibacte
2r1f_A_131-230100 (A:131-230) Protein YCEG, predicted aminodeoxychor 6e-32
2r1f_A_37-13094 (A:37-130) Protein YCEG, predicted aminodeoxychori 1e-14
2r1f_A_231-27040 (A:231-270) Protein YCEG, predicted aminodeoxychor 5e-08
>2r1f_A (A:131-230) Protein YCEG, predicted aminodeoxychorismate lyase; structural genomics, unknown function, PFAM 02618, PSI-2, protein structure initiative; 2.21A {Escherichia coli K12}Length = 100 Back     alignment and structure
 Score =  132 bits (334), Expect = 6e-32
 Identities = 54/102 (52%), Positives = 64/102 (62%), Gaps = 4/102 (3%)

Query: 183 PIKSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYGILEGDYDLT 242
           P K K  LV  ASI+EKET+ A ER  VASVFINR     RLQ+D TVIY    G  +  
Sbjct: 1   PYKDKNQLVTXASIIEKETAVASERDQVASVFINRLRIGXRLQTDPTVIY----GXGERY 56

Query: 243 NRKISRSDFSIKTPYNSYLMNGLPPTAISNPGRLSLEAVAKP 284
           N K+SR+D    T YN+Y + GLPP AI+ PG  SL+A A P
Sbjct: 57  NGKLSRADLETPTAYNTYTITGLPPGAIATPGADSLKAAAHP 98


>2r1f_A (A:37-130) Protein YCEG, predicted aminodeoxychorismate lyase; structural genomics, unknown function, PFAM 02618, PSI-2, protein structure initiative; 2.21A {Escherichia coli K12}Length = 94 Back     alignment and structure
>2r1f_A (A:231-270) Protein YCEG, predicted aminodeoxychorismate lyase; structural genomics, unknown function, PFAM 02618, PSI-2, protein structure initiative; 2.21A {Escherichia coli K12}Length = 40 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target325 aminodeoxychorismate lyase [Candidatus Liberibacter asi
2r1f_A_131-230100 Protein YCEG, predicted aminodeoxychorismate lyase 100.0
2r1f_A_37-13094 Protein YCEG, predicted aminodeoxychorismate lyase 99.67
2r1f_A_231-27040 Protein YCEG, predicted aminodeoxychorismate lyase 99.29
2r1f_A_37-13094 Protein YCEG, predicted aminodeoxychorismate lyase 96.33
>2r1f_A (A:131-230) Protein YCEG, predicted aminodeoxychorismate lyase; structural genomics, unknown function, PFAM 02618, PSI-2, protein structure initiative; 2.21A {Escherichia coli K12} Back     alignment and structure
Probab=100.00  E-value=1.8e-43  Score=297.48  Aligned_cols=100  Identities=55%  Similarity=0.793  Sum_probs=94.3

Q ss_pred             CCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCCCCCCCCCHHHCCCCCCHHCCC
Q ss_conf             67659999998877776526725788999999997405870244222101015566775420000001015683011023
Q gi|254780532|r  183 PIKSKEDLVILASIVEKETSRADERAHVASVFINRFSKSIRLQSDSTVIYGILEGDYDLTNRKISRSDFSIKTPYNSYLM  262 (325)
Q Consensus       183 ~~~s~~evlilASIVEkEa~~~~e~~~IA~V~~NRL~~~M~Lq~D~Tv~Y~l~~~~~~~~~~~~~~~dl~~~spYNTY~~  262 (325)
                      |..+++|+||||||||+|++.++||++|||||+|||++||+||+|+||+|++++.    ..++++.+|++++||||||++
T Consensus         1 P~~t~~e~ltlASiVe~E~~~~~d~~~IA~V~~NRL~~~m~Lq~D~Tv~Y~~g~~----~~~~~~~~~~~~~spYNTY~~   76 (100)
T 2r1f_A            1 PYKDKNQLVTXASIIEKETAVASERDQVASVFINRLRIGXRLQTDPTVIYGXGER----YNGKLSRADLETPTAYNTYTI   76 (100)
T ss_dssp             CCSSHHHHHHHHHHHHHHCCSGGGHHHHHHHHHHHHHHTCCCCCHHHHHHHHGGG----CCSCCCHHHHHSCCTTCTTTS
T ss_pred             CCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCC----CCCCCCHHHHCCCCCHHHHHH
T ss_conf             6556346788999997750477899999999999986288623011577611465----555420766324320655300


Q ss_pred             CCCCCCCCCCCCHHHHHHHCCCCC
Q ss_conf             888999866432798999608788
Q gi|254780532|r  263 NGLPPTAISNPGRLSLEAVAKPLH  286 (325)
Q Consensus       263 ~GLPP~PI~~pg~~ai~A~l~p~~  286 (325)
                      +|||||||||||.+||+|||||++
T Consensus        77 ~GLPpgPI~~Pg~~ai~AalnP~k  100 (100)
T 2r1f_A           77 TGLPPGAIATPGADSLKAAAHPAK  100 (100)
T ss_dssp             SSCCSSCSSCCCHHHHHHHHSCCC
T ss_pred             CCCCCCCCCCCCHHHHHHHHCCCC
T ss_conf             015741024989999999868788



>2r1f_A (A:37-130) Protein YCEG, predicted aminodeoxychorismate lyase; structural genomics, unknown function, PFAM 02618, PSI-2, protein structure initiative; 2.21A {Escherichia coli K12} Back     alignment and structure
>2r1f_A (A:231-270) Protein YCEG, predicted aminodeoxychorismate lyase; structural genomics, unknown function, PFAM 02618, PSI-2, protein structure initiative; 2.21A {Escherichia coli K12} Back     alignment and structure
>2r1f_A (A:37-130) Protein YCEG, predicted aminodeoxychorismate lyase; structural genomics, unknown function, PFAM 02618, PSI-2, protein structure initiative; 2.21A {Escherichia coli K12} Back     alignment and structure