254780531

254780531

flagellin domain-containing protein

GeneID in NCBI database:8209526Locus tag:CLIBASIA_02090
Protein GI in NCBI database:254780531Protein Accession:YP_003064944.1
Gene range:+(749696, 751054)Protein Length:452aa
Gene description:flagellin domain-containing protein
COG prediction:[N] Flagellin and related hook-associated proteins
KEGG prediction:flagellin domain-containing protein; K02406 flagellin
SEED prediction:Flagellin protein FlaA
Pathway involved in KEGG:Two-component system [PATH:las02020]
Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:Flagellum in Campylobacter
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450--
MTSILTNHSAMSASQKLRDINYNLEVVQDRVSSGLRVSDAADNAAYWSIAQIMKSDNGALSAVSDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITAGVERGTDSKSIQSEITQLQSQLRDIARGSSFNGENWLRTDLGSSTASIAKSVIGSFIRDDNGKVQITTIDYYLDPETVLLDSSTDGTERYGLLDRNHKIKVEPQVLKDIDVSVYDASGTISTKKFKLATTSGAWLKAANATFDQAKGIATIPVPLPAAPAAPNTTSGTSGSKSPSVAASATYIRMGNSDIWVRATTKNSITSDPGYTNSTVAKVGNTHYYVDTESTTLDSRKDLPKEIDSGYSMVTLNITRHANTDAYNEKLAMEEMVSFIDTQIKCATAAAGKIGSISSRIHLQEDFIKLMRDAVEKGVGRLVDADMASESTRLSALQTQQQLAVQALSIVNNSTARILSLFRG
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEccccccccccccccccccEEEcccccEEEEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccHHHHccccccccccccEEEccccccccccccccccccccccccccccccEEccccccccEEEccccccccccccccccccccccccccccccccccccHHcccccccccccHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEEccccEEEEEEEEEEEcccEEEEcccccccccEEEEEEEEEEEccccEEEEccccccccccHHHHHHHHHHHHHccccccccEEEEEccccEEEEEEcccccccccccccccccccEEEEcccEEEEEcccccEEEEEEccccccccccccEEEEccccEEEEEEcccEEEEEccccccccccccEEccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccEcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcc
mtsiltnhsamsASQKLRDINYNLEVVQDRvssglrvsdaadNAAYWSIAQIMKSDNGALSAVSDaiglgsskvDIAKAGMSKAIDVMSTIKNKITagvergtdskSIQSEITQLQSQLRDiargssfngenwlrtdlgsstASIAKSVIGsfirddngkvqiTTIDyyldpetvlldsstdgteryglldrnhkikvepqvlkdidvsvydasgtistkkfkLATTSGAWLKAANATfdqakgiatipvplpaapaapnttsgtsgskspsvaaSATYIrmgnsdiwvrattknsitsdpgytnstvakvgnthyyvdtesttldsrkdlpkeidsgYSMVTLNITrhantdaynEKLAMEEMVSFIDTQIKCATAAagkigsissRIHLQEDFIKLMRDAVEKGVGRLVDADMASESTRLSALQTQQQLAVQALSIVNNSTARILSLFRG
mtsiltnhsamsasqklrdINYNLEVVQDRVSSGLRVSDAADNAAYWSIAQIMKSDNGALSAVSDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITagvergtdsksiQSEITQLQSQLRDIARGSSFNGENWLRTDLGSSTASIAKSVIgsfirddngkvQITTIDYYLDPETVLLDSSTDGTEryglldrnhkikvepqvlkdidVSVYDasgtistkkfklaTTSGAWLKAANATFDQAKGIATIPVPLPAAPAAPnttsgtsgskspsVAASATYIRMGNSDIWVRATtknsitsdpgytnstvakvgnthyyvdtesttldsrkdlpkeIDSGYSMVTLNITRHANTDAYNEKLAMEEMVSFIDTQIKCATAAAGKIGSISSRIHLQEDFIKLMRDAVEKGVGRLVDADMASESTRLSALQTQQQLAVQALSIVNNSTARILSLFRG
MTSILTNHSAMSASQKLRDINYNLEVVQDRVSSGLRVSDAADNAAYWSIAQIMKSDNGALSAVSDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITAGVERGTDSKSIQSEITQLQSQLRDIARGSSFNGENWLRTDLGSSTASIAKSVIGSFIRDDNGKVQITTIDYYLDPETVLLDSSTDGTERYGLLDRNHKIKVEPQVLKDIDVSVYDASGTISTKKFKLATTSGAWLKAANATFDQAKGIatipvplpaapaapNttsgtsgsKSPSVAASATYIRMGNSDIWVRATTKNSITSDPGYTNSTVAKVGNTHYYVDTESTTLDSRKDLPKEIDSGYSMVTLNITRHANTDAYNEKLAMEEMVSFIDTQIKCATAAAGKIGSISSRIHLQEDFIKLMRDAVEKGVGRLVDADMASESTRLSalqtqqqlavqalSIVNNSTARILSLFRG
*TSILTNHSAMSASQ********************RVSDAADNAAYWSIAQIMKSDNGA*SAVSDAIGLGSSKVDIAKAGMSKAIDVMSTI*****************QSEITQLQSQLRDIARGSSFNGENWLRTDLGSSTASIAKSVIGSFIRDDNGKVQITTIDYYLDPETVLLDSSTDGTERYGLLDRNHKIKVEPQVLKDIDVSVYDASGTISTKKFKLATTSGAWLKAANATFDQAKGIATIPVPLPAAPAAPNTTSGTSGSKSPSVAASATYIRMGNSDIWVRATTKNSITSDPGYTNSTVAKVGNTHYYVDTESTTLDSRKDLPKEIDSGYSMVTLNITRHANTDAYNEKLAMEEMVSFIDTQIKCATAAAGKIGSISSRIHLQEDFIKLMRDAVEKGVGRLVDADMASESTRLSALQTQQQLAVQALSIVNNSTARILSLFRG
************ASQKLRDINYNLEVVQDRVSSGLRVSDAADNAAYWSIAQIMKSDNGALSAVSDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITAGVERGTDSKSIQSEITQLQSQLRDIARGSSFNGENWLRTDLGSSTASIAKSVIGSFIRDDNGKVQITTIDYYLDPETVLLDSSTDGTERYGLLDRNHKIKVEPQVLKDIDVSVYDASGTISTKKFKLATTSGAWLKAANATFDQAKGIATIPVPLPAAP*****************AASATYIRMGNSDIWVRATTKNSITSDPGYTNSTVAKVGNTHYYVDTESTTLDSRKDLPKEIDSGYSMVTLNITRHANTDAYNEKLAMEEMVSFIDTQIKCATAAAGKIGSISSRIHLQEDFIKLMRDAVEKGVGRLVDADMASESTRLSALQTQQQLAVQALSIVNNSTARILSLFRG
**SILTNHSAMSASQKLRDINYNLEVVQDRVSSGLRVSDAADNAAYWSIAQIMKSDNGALSAVSDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITAGVERGTDSKSIQSEITQLQSQLRDIARGSSFNGENWLRTDLGSSTASIAKSVIGSFIRDDNGKVQITTIDYYLDPETVLLDSSTDGTERYGLLDRNHKIKVEPQVLKDIDVSVYDASGTISTKKFKLATTSGAWLKAANATFDQAKGIATIPVPLPAAPAAPNTTSGTSGSKSPSVAASATYIRMGNSDIWVRATTKNSITSDPGYTNSTVAKVGNTHYYVDTESTTLDSRKDLPKEIDSGYSMVTLNITRHANTDAYNEKLAMEEMVSFIDTQIKCATAAAGKIGSISSRIHLQEDFIKLMRDAVEKGVGRLVDADMASESTRLSALQTQQQLAVQALSIVNNSTARILSLFRG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSILTNHSAMSASQKLRDINYNLEVVQDRVSSGLRVSDAADNAAYWSIAQIMKSDNGALSAVSDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITAGVERGTDSKSIQSEITQLQSQLRDIARGSSFNGENWLRTDLGSSTASIAKSVIGSFIRDDNGKVQITTIDYYLDPETVLLDSSTDGTERYGLLDRNHKIKVEPQVLKDIDVSVYDASGTISTKKFKLATTSGAWLKAANATFDQAKGIATIPVPLPAAPAAPNTTSGTSGSKSPSVAASATYIRMGNSDIWVRATTKNSITSDPGYTNSTVAKVGNTHYYVDTESTTLDSRKDLPKEIDSGYSMVTLNITRHANTDAYNEKLAMEEMVSFIDTQIKCATAAAGKIGSISSRIHLQEDFIKLMRDAVEKGVGRLVDADMASESTRLSALQTQQQLAVQALSIVNNSTARILSLFRG
MTSILTNHSAMSASQKLRDINYNLEVVQDRVSSGLRVSDAADNAAYWSIAQIMKSDNGALSAVSDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITAGVERGTDSKSIQSEITQLQSQLRDIARGSSFNGENWLRTDLGSSTASIAKSVIGSFIRDDNGKVQITTIDYYLDPETVLLDSSTDGTERYGLLDRNHKIKVEPQVLKDIDVSVYDASGTISTKKFKLATTSGAWLKAANATFDQAKGIATIPVPLPAAPAAPNTTSGTSGSKSPSVAASATYIRMGNSDIWVRATTKNSITSDPGYTNSTVAKVGNTHYYVDTESTTLDSRKDLPKEIDSGYSMVTLNITRHANTDAYNEKLAMEEMVSFIDTQIKCATAAAGKIGSISSRIHLQEDFIKLMRDAVEKGVGRLVDADMASESTRLSALQTQQQLAVQALSIVNNSTARILSLFRG
MTSILTNHSAMSASQKLRDINYNLEVVQDRVSSGLRVSDAADNAAYWSIAQIMKSDNGALSAVSDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITAGVERGTDSKSIQSEITQLQSQLRDIARGSSFNGENWLRTDLGSSTASIAKSVIGSFIRDDNGKVQITTIDYYLDPETVLLDSSTDGTERYGLLDRNHKIKVEPQVLKDIDVSVYDASGTISTKKFKLATTSGAWLKAANATFDQAKGIATIPVPLPAAPAAPNTTSGTSGSKSPSVAASATYIRMGNSDIWVRATTKNSITSDPGYTNSTVAKVGNTHYYVDTESTTLDSRKDLPKEIDSGYSMVTLNITRHANTDAYNEKLAMEEMVSFIDTQIKCATAAAGKIGSISSRIHLQEDFIKLMRDAVEKGVGRLVDADMASESTRLSALQTQQQLAVQALSIVNNSTARILSLFRG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target452 flagellin domain-containing protein [Candidatus Liberib
315122277457 flagellin domain-containing protein [Candidatus Liberib 1 1e-146
13124736395 RecName: Full=Flagellin A Length = 395 1 3e-76
307318919395 flagellin domain protein [Sinorhizobium meliloti AK83] 1 3e-76
159184370430 flagellin protein FlaD [Agrobacterium tumefaciens str. 1 6e-76
152221395 flagellin A (flaA) [Sinorhizobium meliloti] Length = 39 1 7e-76
150395492395 flagellin domain-containing protein [Sinorhizobium medi 1 1e-75
15964422394 flagellin A protein [Sinorhizobium meliloti 1021] Lengt 1 3e-75
15964424401 flagellin D protein [Sinorhizobium meliloti 1021] Lengt 1 9e-74
17380397395 RecName: Full=Flagellin B Length = 395 1 2e-73
307318920395 flagellin domain protein [Sinorhizobium meliloti AK83] 1 3e-73
>gi|315122277|ref|YP_004062766.1| flagellin domain-containing protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 457 Back     alignment and organism information
 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 280/460 (60%), Positives = 351/460 (76%), Gaps = 11/460 (2%)

Query: 1   MTSILTNHSAMSASQKLRDINYNLEVVQDRVSSGLRVSDAADNAAYWSIAQIMKSDNGAL 60
           MTSILTN  AMSASQKLR INYNLEVVQDRVSSGLRV+D++DNAAYWSIA++MKSDN AL
Sbjct: 1   MTSILTNLPAMSASQKLRAINYNLEVVQDRVSSGLRVADSSDNAAYWSIAKMMKSDNAAL 60

Query: 61  SAVSDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITAGVERGTDSKSIQSEITQLQSQLR 120
           SAVSDAIGLGSSKVDIAKAGM ++I V+S+IK K+ A  E GTD+ S+Q+EI+QLQ QL 
Sbjct: 61  SAVSDAIGLGSSKVDIAKAGMDESIKVLSSIKEKLVAATEHGTDAHSVQAEISQLQQQLG 120

Query: 121 DIARGSSFNGENWLRTDLGSSTASIAKSVIGSFIRDDNGKVQITTIDYYLDPETVLLDSS 180
           DIA+GSSFNGENWLR  L + ++SI+KSV+ SFIRD++G+VQ+TTIDY LD  T+L D+S
Sbjct: 121 DIAQGSSFNGENWLRASLVTPSSSISKSVVSSFIRDESGQVQVTTIDYNLDSNTLLFDTS 180

Query: 181 TDGTERYGLLDRNHKIKVEPQVLKDIDVSVYDASGTISTKKFKLATTSGAWLKAANATFD 240
             G  RYGLLD+ H+I V+PQ + +I++S  D++  + T K  LAT SGAWLKAA ATF+
Sbjct: 181 GQGG-RYGLLDKKHQISVQPQKMSEIEISYLDSNAKLQTIKKDLATASGAWLKAAGATFN 239

Query: 241 QAKGIATIPVPLPAAPAAPNTTSGTSGSKSPSVAASATYIRMGNSDIWVRATTKNSITSD 300
           Q KG+A +P   P    + + +  +S   SPS      YIR+GN D WV+ T     +S 
Sbjct: 240 QEKGVAILPKN-PVVSPSSSPSFPSSSPSSPSSQDKIIYIRVGNQDQWVKGTDSGDYSST 298

Query: 301 PGYTNST--------VAKVGNTHYYVDTESTTLDSRKDLPKEIDSGYSMVTLNITRHANT 352
               + +        V +  +  YY+D  + TLD+RK + + +D  YS+VTL+IT+H+N 
Sbjct: 299 LSSDSKSSSPKKAVAVTQYDDKSYYIDASAVTLDNRK-VEQTMDLDYSIVTLDITKHSND 357

Query: 353 DAYNEKLAMEEMVSFIDTQIKCATAAAGKIGSISSRIHLQEDFIKLMRDAVEKGVGRLVD 412
             YNE   M+EM+SFID ++K  T+AAGKIGSISSRIHLQEDF+K MRDAVEKG+GRLVD
Sbjct: 358 SMYNEATTMKEMLSFIDQKLKLVTSAAGKIGSISSRIHLQEDFVKFMRDAVEKGIGRLVD 417

Query: 413 ADMASESTRLSALQTQQQLAVQALSIVNNSTARILSLFRG 452
           ADMA ES++LSALQTQQQLA+QALSIVNNSTA+ILSLFRG
Sbjct: 418 ADMADESSKLSALQTQQQLAIQALSIVNNSTAKILSLFRG 457


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|13124736|sp|P13118|FLAA2_RHIME RecName: Full=Flagellin A Length = 395 Back     alignment and organism information
>gi|307318919|ref|ZP_07598350.1| flagellin domain protein [Sinorhizobium meliloti AK83] Length = 395 Back     alignment and organism information
>gi|159184370|ref|NP_353593.2| flagellin protein FlaD [Agrobacterium tumefaciens str. C58] Length = 430 Back     alignment and organism information
>gi|152221|gb|AAA26277.1| flagellin A (flaA) [Sinorhizobium meliloti] Length = 395 Back     alignment and organism information
>gi|150395492|ref|YP_001325959.1| flagellin domain-containing protein [Sinorhizobium medicae WSM419] Length = 395 Back     alignment and organism information
>gi|15964422|ref|NP_384775.1| flagellin A protein [Sinorhizobium meliloti 1021] Length = 394 Back     alignment and organism information
>gi|15964424|ref|NP_384777.1| flagellin D protein [Sinorhizobium meliloti 1021] Length = 401 Back     alignment and organism information
>gi|17380397|sp|P13119|FLAB2_RHIME RecName: Full=Flagellin B Length = 395 Back     alignment and organism information
>gi|307318920|ref|ZP_07598351.1| flagellin domain protein [Sinorhizobium meliloti AK83] Length = 395 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target452 flagellin domain-containing protein [Candidatus Liberib
PRK12687311 PRK12687, PRK12687, flagellin; Reviewed 5e-30
COG1344360 COG1344, FlgL, Flagellin and related hook-associated pr 1e-22
PRK12687311 PRK12687, PRK12687, flagellin; Reviewed 1e-19
pfam00669139 pfam00669, Flagellin_N, Bacterial flagellin N-terminal 2e-18
PRK13588514 PRK13588, PRK13588, flagellin B; Provisional 2e-10
PRK08411 572 PRK08411, PRK08411, flagellin; Reviewed 6e-09
PRK12807287 PRK12807, PRK12807, flagellin; Provisional 7e-09
PRK13589 576 PRK13589, PRK13589, flagellin; Provisional 1e-07
PRK08869376 PRK08869, PRK08869, flagellin; Reviewed 2e-07
PRK12806475 PRK12806, PRK12806, flagellin; Provisional 7e-06
PRK12808476 PRK12808, PRK12808, flagellin; Provisional 1e-05
TIGR02550306 TIGR02550, flagell_flgL, flagellar hook-associated prot 1e-04
PRK12802282 PRK12802, PRK12802, flagellin; Provisional 2e-04
PRK12804301 PRK12804, PRK12804, flagellin; Provisional 3e-04
COG1344360 COG1344, FlgL, Flagellin and related hook-associated pr 8e-14
PRK12584510 PRK12584, PRK12584, flagellin A; Reviewed 3e-10
pfam0070084 pfam00700, Flagellin_C, Bacterial flagellin C-terminal 1e-07
PRK12688751 PRK12688, PRK12688, flagellin; Reviewed 0.003
>gnl|CDD|105853 PRK12687, PRK12687, flagellin; Reviewed Back     alignment and domain information
>gnl|CDD|31535 COG1344, FlgL, Flagellin and related hook-associated proteins [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|105853 PRK12687, PRK12687, flagellin; Reviewed Back     alignment and domain information
>gnl|CDD|144315 pfam00669, Flagellin_N, Bacterial flagellin N-terminal helical region Back     alignment and domain information
>gnl|CDD|184167 PRK13588, PRK13588, flagellin B; Provisional Back     alignment and domain information
>gnl|CDD|169431 PRK08411, PRK08411, flagellin; Reviewed Back     alignment and domain information
>gnl|CDD|171737 PRK12807, PRK12807, flagellin; Provisional Back     alignment and domain information
>gnl|CDD|172158 PRK13589, PRK13589, flagellin; Provisional Back     alignment and domain information
>gnl|CDD|181570 PRK08869, PRK08869, flagellin; Reviewed Back     alignment and domain information
>gnl|CDD|183761 PRK12806, PRK12806, flagellin; Provisional Back     alignment and domain information
>gnl|CDD|171738 PRK12808, PRK12808, flagellin; Provisional Back     alignment and domain information
>gnl|CDD|162917 TIGR02550, flagell_flgL, flagellar hook-associated protein 3 Back     alignment and domain information
>gnl|CDD|139237 PRK12802, PRK12802, flagellin; Provisional Back     alignment and domain information
>gnl|CDD|183759 PRK12804, PRK12804, flagellin; Provisional Back     alignment and domain information
>gnl|CDD|31535 COG1344, FlgL, Flagellin and related hook-associated proteins [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|183609 PRK12584, PRK12584, flagellin A; Reviewed Back     alignment and domain information
>gnl|CDD|144340 pfam00700, Flagellin_C, Bacterial flagellin C-terminal helical region Back     alignment and domain information
>gnl|CDD|171664 PRK12688, PRK12688, flagellin; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 452 flagellin domain-containing protein [Candidatus Liberib
PRK08026 566 flagellin; Validated 100.0
PRK08411 573 flagellin; Reviewed 100.0
PRK13589 573 flagellin; Provisional 100.0
PRK12717523 flgL flagellar hook-associated protein FlgL; Provisiona 100.0
PRK12718510 flgL flagellar hook-associated protein FlgL; Provisiona 100.0
PRK08412 777 flgL flagellar hook-associated protein FlgL; Validated 100.0
pfam00669139 Flagellin_N Bacterial flagellin N-terminal helical regi 100.0
PRK13588514 flagellin B; Provisional 100.0
PRK12808460 flagellin; Provisional 100.0
PRK12584510 flagellin A; Reviewed 100.0
PRK12806475 flagellin; Provisional 100.0
PRK06819371 flagellin; Validated 100.0
PRK08869377 flagellin; Reviewed 100.0
PRK12803335 flagellin; Provisional 100.0
PRK12807287 flagellin; Provisional 100.0
PRK12805287 flagellin; Provisional 100.0
PRK06663420 flagellar hook-associated protein FlgL; Validated 100.0
PRK08870403 flgL flagellar hook-associated protein FlgL; Reviewed 100.0
PRK12687311 flagellin; Reviewed 100.0
PRK12802282 flagellin; Provisional 100.0
PRK12804307 flagellin; Provisional 100.0
COG1344360 FlgL Flagellin and related hook-associated proteins [Ce 100.0
PRK07192305 flgL flagellar hook-associated protein FlgL; Reviewed 100.0
PRK07701301 flgL flagellar hook-associated protein FlgL; Validated 100.0
PRK08027317 flgL flagellar hook-associated protein FlgL; Reviewed 100.0
PRK08073287 flgL flagellar hook-associated protein FlgL; Validated 100.0
PRK08913302 flgL flagellar hook-associated protein FlgL; Validated 100.0
TIGR02550393 flagell_flgL flagellar hook-associated protein 3; Inter 100.0
PRK06008348 flgL flagellar hook-associated protein FlgL; Validated 100.0
pfam07164347 consensus 100.0
pfam0070084 Flagellin_C Bacterial flagellin C-terminal helical regi 99.83
PRK08471612 flgK flagellar hook-associated protein FlgK; Validated 97.85
PRK07521482 flgK flagellar hook-associated protein FlgK; Validated 97.59
PRK08147547 flgK flagellar hook-associated protein FlgK; Validated 97.59
PRK12714624 flgK flagellar hook-associated protein FlgK; Provisiona 97.47
PRK07191456 flgK flagellar hook-associated protein FlgK; Validated 97.02
PRK06945649 flgK flagellar hook-associated protein FlgK; Validated 96.94
PRK06665628 flgK flagellar hook-associated protein FlgK; Validated 96.62
TIGR02492495 flgK_ends flagellar hook-associated protein FlgK; Inter 96.5
PRK07739500 flgK flagellar hook-associated protein FlgK; Validated 96.42
COG1256552 FlgK Flagellar hook-associated protein [Cell motility a 95.75
PRK06799431 flgK flagellar hook-associated protein FlgK; Validated 94.92
PRK12715649 flgK flagellar hook-associated protein FlgK; Provisiona 93.5
PRK08871626 flgK flagellar hook-associated protein FlgK; Validated 92.8
PRK12688 888 flagellin; Reviewed 99.67
PRK12632130 flgC flagellar basal body rod protein FlgC; Provisional 92.79
PRK12782138 flgC flagellar basal body rod protein FlgC; Reviewed 91.98
PRK05681139 flgC flagellar basal body rod protein FlgC; Reviewed 91.81
>PRK08026 flagellin; Validated Back     alignment and domain information
>PRK08411 flagellin; Reviewed Back     alignment and domain information
>PRK13589 flagellin; Provisional Back     alignment and domain information
>PRK12717 flgL flagellar hook-associated protein FlgL; Provisional Back     alignment and domain information
>PRK12718 flgL flagellar hook-associated protein FlgL; Provisional Back     alignment and domain information
>PRK08412 flgL flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>pfam00669 Flagellin_N Bacterial flagellin N-terminal helical region Back     alignment and domain information
>PRK13588 flagellin B; Provisional Back     alignment and domain information
>PRK12808 flagellin; Provisional Back     alignment and domain information
>PRK12584 flagellin A; Reviewed Back     alignment and domain information
>PRK12806 flagellin; Provisional Back     alignment and domain information
>PRK06819 flagellin; Validated Back     alignment and domain information
>PRK08869 flagellin; Reviewed Back     alignment and domain information
>PRK12803 flagellin; Provisional Back     alignment and domain information
>PRK12807 flagellin; Provisional Back     alignment and domain information
>PRK12805 flagellin; Provisional Back     alignment and domain information
>PRK06663 flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>PRK08870 flgL flagellar hook-associated protein FlgL; Reviewed Back     alignment and domain information
>PRK12687 flagellin; Reviewed Back     alignment and domain information
>PRK12802 flagellin; Provisional Back     alignment and domain information
>PRK12804 flagellin; Provisional Back     alignment and domain information
>COG1344 FlgL Flagellin and related hook-associated proteins [Cell motility and secretion] Back     alignment and domain information
>PRK07192 flgL flagellar hook-associated protein FlgL; Reviewed Back     alignment and domain information
>PRK07701 flgL flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>PRK08027 flgL flagellar hook-associated protein FlgL; Reviewed Back     alignment and domain information
>PRK08073 flgL flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>PRK08913 flgL flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>TIGR02550 flagell_flgL flagellar hook-associated protein 3; InterPro: IPR013384 FlgL (or HAP3) proteins are flagellar hook-associated proteins encoded in bacterial flagellar operons Back     alignment and domain information
>PRK06008 flgL flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>pfam07164 consensus Back     alignment and domain information
>pfam00700 Flagellin_C Bacterial flagellin C-terminal helical region Back     alignment and domain information
>PRK08471 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK07521 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08147 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK07191 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06945 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06665 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway Back     alignment and domain information
>PRK07739 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>COG1256 FlgK Flagellar hook-associated protein [Cell motility and secretion] Back     alignment and domain information
>PRK06799 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12715 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK08871 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12688 flagellin; Reviewed Back     alignment and domain information
>PRK12632 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12782 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK05681 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target452 flagellin domain-containing protein [Candidatus Liberib
1ucu_A494 R-Type Straight Flagellar Filament Made Of Full-Len 3e-53
3a5x_A494 L-Type Straight Flagellar Filament Made Of Full-Len 2e-52
3k8v_A351 Crysatl Structure Of A Bacterial Cell-Surface Flage 7e-21
3k8w_A326 Crysatl Structure Of A Bacterial Cell-Surface Flage 8e-21
3k8v_A351 Crysatl Structure Of A Bacterial Cell-Surface Flage 3e-13
3k8w_A326 Crysatl Structure Of A Bacterial Cell-Surface Flage 3e-04
2zbi_A292 Crysatl Structure Of A Bacterial Cell-Surface Flage 0.004
1io1_A398 Crystal Structure Of F41 Fragment Of Flagellin Leng 1e-16
1ory_B55 Flagellar Export Chaperone In Complex With Its Cogn 2e-09
2zbi_A292 Crysatl Structure Of A Bacterial Cell-Surface Flage 4e-09
>gi|34810684|pdb|1UCU|A Chain A, R-Type Straight Flagellar Filament Made Of Full-Length Flagellin Length = 494 Back     alignment and structure
 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 68/492 (13%), Positives = 131/492 (26%), Gaps = 43/492 (8%)

Query: 3   SILTNHSAMSASQKLRDINYNLEVVQDRVSSGLRVSDAADNAAYWSIAQIMKSDNGALSA 62
            I TN  ++     L      L    +R+SSGLR++ A D+AA  +IA    ++   L+ 
Sbjct: 3   VINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANRFTANIKGLTQ 62

Query: 63  VSDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITAGVERGTDS---KSIQSEITQLQSQL 119
            S     G S     +  +++  + +  ++                 SIQ+EITQ  +++
Sbjct: 63  ASRNANDGISIAQTTEGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEI 122

Query: 120 RDIARGSSFNGENWLRTDLGSSTASIAKSVIGSFIRDDNGKVQITTIDYYLDPETVLLDS 179
             ++  + FNG   L  D   +    A       I       Q   +D     +   +  
Sbjct: 123 DRVSGQTQFNGVKVLAQDNTLTIQVGANDGETIDIDLKQINSQTLGLDTLNVQQKYKVSD 182

Query: 180 STDGTERYGLLDRNHKIKVEPQVLKDIDVSVYDASGTISTKKFKLATTSGAWLKAANATF 239
           +      Y                  +  +     G +          +   +       
Sbjct: 183 TAATVTGYADTTIALDNSTFKASATGLGGTDQKIDGDLKFDDTTGKYYAKVTVTGGTGKD 242

Query: 240 DQAKGIATIPVPLPAAPAAPNTTSGTSGSKSPSVAASATYIRMGNSDIWVRATTKNSITS 299
              +                 +        + +       +   +      A T   +T 
Sbjct: 243 GYYEVSVDKTNGEVTLAGGATSPLTGGLPATATEDVKNVQVANADLTEAKAALTAAGVTG 302

Query: 300 DPGYTNSTVAKVGNTHYYVDTESTTLDSRKDLPKEIDSGYSMVTLNITRHANTDAY---- 355
                  +                  D      +  D   S+ T   T    T       
Sbjct: 303 TASVVKMSYTDNNGKTIDGGLAVKVGDDYYSATQNKDGSISINTTKYTADDGTSKTALNK 362

Query: 356 ------------------------------------NEKLAMEEMVSFIDTQIKCATAAA 379
                                                     E  +  ID  +       
Sbjct: 363 LGGADGKTEVVSIGGKTYAASKAEGHNFKAQPDLAEAAATTTENPLQKIDAALAQVDTLR 422

Query: 380 GKIGSISSRIHLQEDFIKLMRDAVEKGVGRLVDADMASESTRLSALQTQQQLAVQALSIV 439
             +G++ +R +     +    + +     R+ D+D A+E + +S  Q  QQ     L+  
Sbjct: 423 SDLGAVQNRFNSAITNLGNTVNNLTSVRSRIEDSDYATEVSNMSRAQILQQAGTSVLAQA 482

Query: 440 NNSTARILSLFR 451
           N     +LSL R
Sbjct: 483 NQVPQNVLSLLR 494


>gi|291191082|pdb|3A5X|A Chain A, L-Type Straight Flagellar Filament Made Of Full-Length Flagellin Length = 494 Back     alignment and structure
>gi|308198489|pdb|3K8V|A Chain A, Crysatl Structure Of A Bacterial Cell-Surface Flagellin N20c20 Length = 351 Back     alignment and structure
>gi|308198491|pdb|3K8W|A Chain A, Crysatl Structure Of A Bacterial Cell-Surface Flagellin N20c45 Length = 326 Back     alignment and structure
>gi|308198489|pdb|3K8V|A Chain A, Crysatl Structure Of A Bacterial Cell-Surface Flagellin N20c20 Length = 351 Back     alignment and structure
>gi|308198491|pdb|3K8W|A Chain A, Crysatl Structure Of A Bacterial Cell-Surface Flagellin N20c45 Length = 326 Back     alignment and structure
>gi|167013356|pdb|2ZBI|A Chain A, Crysatl Structure Of A Bacterial Cell-Surface Flagellin Length = 292 Back     alignment and structure
>gi|13786773|pdb|1IO1|A Chain A, Crystal Structure Of F41 Fragment Of Flagellin Length = 398 Back     alignment and structure
>gi|37927279|pdb|1ORY|B Chain B, Flagellar Export Chaperone In Complex With Its Cognate Binding Partner Length = 55 Back     alignment and structure
>gi|167013356|pdb|2ZBI|A Chain A, Crysatl Structure Of A Bacterial Cell-Surface Flagellin Length = 292 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target452 flagellin domain-containing protein [Candidatus Liberib
1ucu_A494 Phase 1 flagellin; flagellar filament, cryo-electron mi 2e-25
3k8w_A326 Flagellin homolog; flagellum, structural protein, bacte 4e-13
1ory_B55 Flagellin; flagellar chaperone, cytosolic export chaper 6e-04
>1ucu_A Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} SCOP: e.32.1.1 Length = 494 Back     alignment and structure
 Score =  112 bits (280), Expect = 2e-25
 Identities = 75/491 (15%), Positives = 152/491 (30%), Gaps = 43/491 (8%)

Query: 4   ILTNHSAMSASQKLRDINYNLEVVQDRVSSGLRVSDAADNAAYWSIAQIMKSDNGALSAV 63
           I TN  ++     L      L    +R+SSGLR++ A D+AA  +IA    ++   L+  
Sbjct: 4   INTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANRFTANIKGLTQA 63

Query: 64  SDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITA---GVERGTDSKSIQSEITQLQSQLR 120
           S     G S     +  +++  + +  ++             +D  SIQ+EITQ  +++ 
Sbjct: 64  SRNANDGISIAQTTEGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEID 123

Query: 121 DIARGSSFNGENWLRTDLG---SSTASIAKSVIGSFIRDDNGKVQITTIDYYLDPETVLL 177
            ++  + FNG   L  D        A+  +++     + ++  + + T++     +    
Sbjct: 124 RVSGQTQFNGVKVLAQDNTLTIQVGANDGETIDIDLKQINSQTLGLDTLNVQQKYKVSDT 183

Query: 178 DSSTDGTERYGLLDRNHKIKVEPQVLKDIDVSVYDASGTISTKKFKLATTSGAWLKAANA 237
            ++  G     +   N   K     L   D  +        T     A  +       + 
Sbjct: 184 AATVTGYADTTIALDNSTFKASATGLGGTDQKIDGDLKFDDTTGKYYAKVTVTGGTGKDG 243

Query: 238 TFDQAKGIATIPVPLPAAPAAPNTTSG--------------------------------- 264
            ++ +       V L     +P T                                    
Sbjct: 244 YYEVSVDKTNGEVTLAGGATSPLTGGLPATATEDVKNVQVANADLTEAKAALTAAGVTGT 303

Query: 265 TSGSKSPSVAASATYIRMGNSDIWVRATTKNSITSDPGYTNSTVAKVGNTHYYVDTESTT 324
            S  K      +   I  G +          +   D   + +T     +        +  
Sbjct: 304 ASVVKMSYTDNNGKTIDGGLAVKVGDDYYSATQNKDGSISINTTKYTADDGTSKTALNKL 363

Query: 325 LDSRKDLPKEIDSGYSM----VTLNITRHANTDAYNEKLAMEEMVSFIDTQIKCATAAAG 380
             +          G +        +  +     A       E  +  ID  +        
Sbjct: 364 GGADGKTEVVSIGGKTYAASKAEGHNFKAQPDLAEAAATTTENPLQKIDAALAQVDTLRS 423

Query: 381 KIGSISSRIHLQEDFIKLMRDAVEKGVGRLVDADMASESTRLSALQTQQQLAVQALSIVN 440
            +G++ +R +     +    + +     R+ D+D A+E + +S  Q  QQ     L+  N
Sbjct: 424 DLGAVQNRFNSAITNLGNTVNNLTSVRSRIEDSDYATEVSNMSRAQILQQAGTSVLAQAN 483

Query: 441 NSTARILSLFR 451
                +LSL R
Sbjct: 484 QVPQNVLSLLR 494


>3k8w_A Flagellin homolog; flagellum, structural protein, bacterial flagellu; 1.70A {Sphingomonas SP} PDB: 2zbi_A 3k8v_A Length = 326 Back     alignment and structure
>1ory_B Flagellin; flagellar chaperone, cytosolic export chaperone, FLIS, FLIC; 2.45A {Aquifex aeolicus} Length = 55 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target452 flagellin domain-containing protein [Candidatus Liberib
1ucu_A494 Phase 1 flagellin; flagellar filament, cryo-electron mi 100.0
3k8w_A326 Flagellin homolog; flagellum, structural protein, bacte 100.0
2d4x_A248 Flagellar HOOK-associated protein 3; multi-domain prote 100.0
3k1i_C178 HP1076, putative uncharacterized protein; CO-chaperone, 92.43
1io1_A398 Phase 1 flagellin; beta-folium, structural protein; 2.0 100.0
3k1h_A158 HP1076, putative uncharacterized protein; FLIS interact 99.33
1ory_B55 Flagellin; flagellar chaperone, cytosolic export chaper 99.52
2d4y_A463 HAP1, flagellar HOOK-associated protein 1; multi-domain 95.3
>1ucu_A Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} SCOP: e.32.1.1 PDB: 3a5x_A Back     alignment and structure
Probab=100.00  E-value=0  Score=483.03  Aligned_cols=447  Identities=17%  Similarity=0.149  Sum_probs=239.8

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             74045799999999999999999999999851223688313899999999999999999999998999999999999999
Q gi|254780531|r    2 TSILTNHSAMSASQKLRDINYNLEVVQDRVSSGLRVSDAADNAAYWSIAQIMKSDNGALSAVSDAIGLGSSKVDIAKAGM   81 (452)
Q Consensus         2 ~~i~tn~~~~~al~~l~~~~~~l~~~~~qlstGkri~~~sDdp~~~~~~~~l~~~~~~~~q~~~n~~~a~~~l~~ae~~l   81 (452)
                      ++|+||+++++++++|++.+++|.++||||||||||++|+|||++++++++||+++.+++||+||+.++++||+++|++|
T Consensus         2 ~~i~tn~~~~~~~~~l~~~~~~l~~~~~~lssG~ri~~~sDdp~~~~~~~~l~~~~~~~~q~~~n~~~a~s~l~~ae~~L   81 (494)
T 1ucu_A            2 QVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANRFTANIKGLTQASRNANDGISIAQTTEGAL   81 (494)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCTTTSCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             09975199999999999999999999998601586588320589999999999999999999998999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCC---CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             999999999999875303776---30356788999999999998630012110013566654322334332221112333
Q gi|254780531|r   82 SKAIDVMSTIKNKITAGVERG---TDSKSIQSEITQLQSQLRDIARGSSFNGENWLRTDLGSSTASIAKSVIGSFIRDDN  158 (452)
Q Consensus        82 ~~~~~~l~r~relavqa~n~~---~dr~a~~~e~~~l~~~i~~ian~t~~nG~~l~~g~~~~~~~~~~~~~~~~~~~~~~  158 (452)
                      +++.++|+|||||+||++|++   .||++++.|+++|++||++|+++++|||+|||+|+.....+.+.............
T Consensus        82 ~~v~~~L~r~relavqaan~~~s~~dr~ai~~ei~~l~~~i~~ia~~t~fnG~~Lf~G~~~~~~~~g~~~~~~~~~~~~~  161 (494)
T 1ucu_A           82 NEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVSGQTQFNGVKVLAQDNTLTIQVGANDGETIDIDLKQ  161 (494)
T ss_dssp             HHHHHHHHHHHHHHHHHTCTTCCHHHHHHHHHHHHHHHHHHHHHHHHCCBTTBCTTTSCEEEEEECSSSTTCEEEEEECC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHCCCCCCEEEEEECCCCEEEEECCC
T ss_conf             99999999999999976168876455777788999988777776545421413320114542278752157225640233


Q ss_pred             CCCCCCC-CCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             3322222-2222135433333--221111111112233322345443------322211112222112222222221111
Q gi|254780531|r  159 GKVQITT-IDYYLDPETVLLD--SSTDGTERYGLLDRNHKIKVEPQV------LKDIDVSVYDASGTISTKKFKLATTSG  229 (452)
Q Consensus       159 ~~~~~~~-~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~  229 (452)
                      ....... .............  ........................      .................. ... ....
T Consensus       162 ~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~-~~~~  239 (494)
T 1ucu_A          162 INSQTLGLDTLNVQQKYKVSDTAATVTGYADTTIALDNSTFKASATGLGGTDQKIDGDLKFDDTTGKYYAK-VTV-TGGT  239 (494)
T ss_dssp             CSTTTTTCTTCCCCCCCEEEEEECCCCSEEEEEEECBCTTSTTTCGGGCSSEEEECSSEEEETTTTEEEEE-EEE-ETCS
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCC-EEE-ECCC
T ss_conf             33222465310134444555420010023310233024421111234323221013320222011100000-122-0132


Q ss_pred             CCCCCCCCCCCCCCCCCCC------CCCCCCCCC-------CCCCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1111111101001122210------123333443-------322222332222210000012234444321100123321
Q gi|254780531|r  230 AWLKAANATFDQAKGIATI------PVPLPAAPA-------APNTTSGTSGSKSPSVAASATYIRMGNSDIWVRATTKNS  296 (452)
Q Consensus       230 ~~~~~~~~~~~~~~~~~~~------~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  296 (452)
                      ...................      .........       .................... ..................
T Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~-~~~~~~~~~~~~~~~~~~  318 (494)
T 1ucu_A          240 GKDGYYEVSVDKTNGEVTLAGGATSPLTGGLPATATEDVKNVQVANADLTEAKAALTAAGV-TGTASVVKMSYTDNNGKT  318 (494)
T ss_dssp             SCCEEEEEEECTTTCBEEESTTCSSCCTTSSCTTCCEEESEEEEEGGGTHHHHHHHHHTTC-CSCEEEEEEEEECTTSCE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCC-CCCCCEEEEEECCCCCEE
T ss_conf             4332212222445553000234433333443220223334310023332223321000243-332210001320332101


Q ss_pred             CCCCCCC-------C-----CCCCC--CCCCCCCCCCCCCCCC--CCCCCCC-----CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1100000-------0-----00111--1111122344443322--3222333-----22222100000122334443210
Q gi|254780531|r  297 ITSDPGY-------T-----NSTVA--KVGNTHYYVDTESTTL--DSRKDLP-----KEIDSGYSMVTLNITRHANTDAY  355 (452)
Q Consensus       297 ~~~~~~~-------~-----~~~~~--~~~~~~~~~~~~~~~~--~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~  355 (452)
                      .......       .     .....  ................  .......     .......................
T Consensus       319 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  398 (494)
T 1ucu_A          319 IDGGLAVKVGDDYYSATQNKDGSISINTTKYTADDGTSKTALNKLGGADGKTEVVSIGGKTYAASKAEGHNFKAQPDLAE  398 (494)
T ss_dssp             EEEEEEEEETTEEEEEEECTTSCEEECBCCEECSSSSEECCBCEEESTTSCEEEEEETTEEEEHHHHTTCBTTTSCCCCC
T ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCHHCCCCCHHHHHHHHHCCCCCCHHHHH
T ss_conf             01443223342100012344543123442000222034432100112234320000343111123332011221001213


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEECCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             00000578999999999999999999878999999999999999999997306222025899999999999999999999
Q gi|254780531|r  356 NEKLAMEEMVSFIDTQIKCATAAAGKIGSISSRIHLQEDFIKLMRDAVEKGVGRLVDADMASESTRLSALQTQQQLAVQA  435 (452)
Q Consensus       356 ~~~~~~~~al~~id~a~~~v~~~ra~iGa~~nrle~~~~~~~~~~~~~~~~~s~i~D~D~A~e~t~l~~~q~~~Qaa~~~  435 (452)
                      .....+..+|..||.|+++|...|++|||++||||+.++++.+..+|+++++|+|+|+|||||+++|+|+||+||||++|
T Consensus       399 ~t~~~a~~al~~ID~Ai~~V~~~ra~lGA~~nrle~~~~nl~~~~~n~~~~~s~i~DaD~a~e~~~l~~~qi~~Qaa~~~  478 (494)
T 1ucu_A          399 AAATTTENPLQKIDAALAQVDTLRSDLGAVQNRFNSAITNLGNTVNNLTSVRSRIEDSDYATEVSNMSRAQILQQAGTSV  478 (494)
T ss_dssp             CCCSCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCSHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             43788999999999999999999999879999999999999999999999854577140999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHC
Q ss_conf             9999720688987525
Q gi|254780531|r  436 LSIVNNSTARILSLFR  451 (452)
Q Consensus       436 laqan~~~~~vL~L~~  451 (452)
                      |+||||.||.||+|||
T Consensus       479 laqAn~~~q~vl~Ll~  494 (494)
T 1ucu_A          479 LAQANQVPQNVLSLLR  494 (494)
T ss_dssp             HHHHHHHHHHHHTCCC
T ss_pred             HHHHCCCHHHHHHHCC
T ss_conf             9997526789998409



>3k8w_A Flagellin homolog; flagellum, structural protein, bacterial flagellu; 1.70A {Sphingomonas SP} PDB: 2zbi_A 3k8v_A Back     alignment and structure
>2d4x_A Flagellar HOOK-associated protein 3; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3k1i_C HP1076, putative uncharacterized protein; CO-chaperone, chaperone, flagellar system, helicobacter PYLO flagellum; 2.70A {Helicobacter pylori} Back     alignment and structure
>1io1_A Phase 1 flagellin; beta-folium, structural protein; 2.00A {Salmonella typhimurium} SCOP: e.32.1.1 Back     alignment and structure
>3k1h_A HP1076, putative uncharacterized protein; FLIS interacting protein, hypothetical protein, chaperone; 1.74A {Helicobacter pylori} Back     alignment and structure
>1ory_B Flagellin; flagellar chaperone, cytosolic export chaperone, FLIS, FLIC; 2.45A {Aquifex aeolicus} Back     alignment and structure
>2d4y_A HAP1, flagellar HOOK-associated protein 1; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 2.10A {Salmonella typhimurium} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target452 flagellin domain-containing protein [Candidatus Liberib
d1io1a_395 Phase 1 flagellin {Salmonella typhimurium [TaxId: 90371 100.0
>d1io1a_ e.32.1.1 (A:) Phase 1 flagellin {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Phase 1 flagellin
superfamily: Phase 1 flagellin
family: Phase 1 flagellin
domain: Phase 1 flagellin
species: Salmonella typhimurium [TaxId: 90371]
Probab=100.00  E-value=6.3e-37  Score=240.60  Aligned_cols=90  Identities=19%  Similarity=0.260  Sum_probs=82.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC---CCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999998999999999999999999999999999875303776---303567889999999999986300121100
Q gi|254780531|r   56 DNGALSAVSDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITAGVERG---TDSKSIQSEITQLQSQLRDIARGSSFNGEN  132 (452)
Q Consensus        56 ~~~~~~q~~~n~~~a~~~l~~ae~~l~~~~~~l~r~relavqa~n~~---~dr~a~~~e~~~l~~~i~~ian~t~~nG~~  132 (452)
                      +|++|+|++||++++++|||++|++|+++++||+|||||+||++|++   .||++|+.|+++|++||++|+++|+|||++
T Consensus         1 ~i~gl~qa~~N~~d~~s~lqtae~al~~~~~iL~r~reLavqaan~t~~~~dr~ai~~E~~~l~~ei~~ia~~T~fng~~   80 (395)
T d1io1a_           1 NIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVSGQTQFNGVK   80 (395)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCTTCCHHHHHHHHHHHHHHHHHHHHHHHHCCBTTBC
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCEECCCC
T ss_conf             97138899998999999999999999999999999999999850578999999999999999999999999737028802


Q ss_pred             CCCCCCCCCCCCCC
Q ss_conf             13566654322334
Q gi|254780531|r  133 WLRTDLGSSTASIA  146 (452)
Q Consensus       133 l~~g~~~~~~~~~~  146 (452)
                      ||+|+.... ++.+
T Consensus        81 Ll~Gs~~~~-~~~g   93 (395)
T d1io1a_          81 VLAQDNTLT-IQVG   93 (395)
T ss_dssp             TTTSCEEEE-EECS
T ss_pred             CCCCCCCEE-EEEC
T ss_conf             235567258-9724



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 452 flagellin domain-containing protein [Candidatus Li
1ucu_A_41-169_400-454184 (A:41-169,A:400-454) Phase 1 flagellin; flagellar 1e-10
2d4x_A_248 (A:) Flagellar HOOK-associated protein 3; multi-do 2e-08
1io1_A_1-117_348-398168 (A:1-117,A:348-398) Phase 1 flagellin; beta-folium 2e-08
2zbi_A_1-113_232-292174 (A:1-113,A:232-292) Flagellin homolog; flagellum, 4e-08
>1ucu_A (A:41-169,A:400-454) Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium}Length = 184 Back     alignment and structure
 Score = 62.2 bits (151), Expect = 1e-10
 Identities = 21/96 (21%), Positives = 42/96 (43%), Gaps = 3/96 (3%)

Query: 42  DNAAYWSIAQIMKSDNGALSAVSDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITA---G 98
           D+AA  +IA    ++   L+  S     G S     +  +++  + +  ++         
Sbjct: 2   DDAAGQAIANRFTANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQSANS 61

Query: 99  VERGTDSKSIQSEITQLQSQLRDIARGSSFNGENWL 134
               +D  SIQ+EITQ  +++  ++  + FNG   L
Sbjct: 62  TNSQSDLDSIQAEITQRLNEIDRVSGQTQFNGVKVL 97


>2d4x_A (A:) Flagellar HOOK-associated protein 3; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 1.90A {Salmonella typhimurium}Length = 248 Back     alignment and structure
>1io1_A (A:1-117,A:348-398) Phase 1 flagellin; beta-folium, structural protein; 2.00A {Salmonella typhimurium}Length = 168 Back     alignment and structure
>2zbi_A (A:1-113,A:232-292) Flagellin homolog; flagellum, structural protein; 2.00A {Sphingomonas SP}Length = 174 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target452 flagellin domain-containing protein [Candidatus Liberib
1ucu_A_41-169_400-454184 Phase 1 flagellin; flagellar filament, cryo-electr 100.0
2d4x_A_248 Flagellar HOOK-associated protein 3; multi-domain 100.0
2zbi_A_1-113_232-292174 Flagellin homolog; flagellum, structural protein; 99.97
1io1_A_1-117_348-398168 Phase 1 flagellin; beta-folium, structural protein 99.97
1ory_B_55 Flagellin; flagellar chaperone, cytosolic export c 99.55
1ucu_A_1-40_455-49480 Phase 1 flagellin; flagellar filament, cryo-electr 99.35
1ucu_A_1-40_455-49480 Phase 1 flagellin; flagellar filament, cryo-electr 98.41
>1ucu_A (A:41-169,A:400-454) Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} Back     alignment and structure
Probab=100.00  E-value=5.2e-35  Score=231.28  Aligned_cols=181  Identities=17%  Similarity=0.151  Sum_probs=149.6

Q ss_pred             HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC---CCHHHHHHHHHHHHH
Q ss_conf             13899999999999999999999998999999999999999999999999999875303776---303567889999999
Q gi|254780531|r   41 ADNAAYWSIAQIMKSDNGALSAVSDAIGLGSSKVDIAKAGMSKAIDVMSTIKNKITAGVERG---TDSKSIQSEITQLQS  117 (452)
Q Consensus        41 sDdp~~~~~~~~l~~~~~~~~q~~~n~~~a~~~l~~ae~~l~~~~~~l~r~relavqa~n~~---~dr~a~~~e~~~l~~  117 (452)
                      ||||++++++++|++++.+++||.+|++++.+||+++|++|.+++++|+|||||+||++|++   .||.+++.|+++|++
T Consensus         1 SDDpa~~a~s~~l~s~i~~l~q~~~N~~~a~s~lqtae~aL~~i~~iLqrirelavqaangt~s~~dR~ai~~Ei~~L~~   80 (184)
T 1ucu_A            1 KDDAAGQAIANRFTANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLN   80 (184)
T ss_dssp             CSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCTTCCHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             10699999999999999999999999999999999999999999999999999999761688765668888877555555


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99998630012110013566654322334332221112333332222222221354333332211111111122333223
Q gi|254780531|r  118 QLRDIARGSSFNGENWLRTDLGSSTASIAKSVIGSFIRDDNGKVQITTIDYYLDPETVLLDSSTDGTERYGLLDRNHKIK  197 (452)
Q Consensus       118 ~i~~ian~t~~nG~~l~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  197 (452)
                      +|.+|+++++|||+|||+|+.....++..........                                           
T Consensus        81 ei~~ian~T~fnG~~Lf~Gs~~~t~~~~~~~~~~~~~-------------------------------------------  117 (184)
T 1ucu_A           81 EIDRVSGQTQFNGVKVLAQDNTLTIQVGANDGETIDI-------------------------------------------  117 (184)
T ss_dssp             HHHHHHHHCCBTTBCTTTSCEEEEEECSSSTTCEEEE-------------------------------------------
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCEEEE-------------------------------------------
T ss_conf             5555542456655432144554315521444411231-------------------------------------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCC
Q ss_conf             45443322211112222112222222221111111111110100112221012333344332222233222221000001
Q gi|254780531|r  198 VEPQVLKDIDVSVYDASGTISTKKFKLATTSGAWLKAANATFDQAKGIATIPVPLPAAPAAPNTTSGTSGSKSPSVAASA  277 (452)
Q Consensus       198 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  277 (452)
                                          ..                                                          
T Consensus       118 --------------------~~----------------------------------------------------------  119 (184)
T 1ucu_A          118 --------------------DL----------------------------------------------------------  119 (184)
T ss_dssp             --------------------EE----------------------------------------------------------
T ss_pred             --------------------CC----------------------------------------------------------
T ss_conf             --------------------03----------------------------------------------------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22344443211001233211100000000111111112234444332232223332222210000012233444321000
Q gi|254780531|r  278 TYIRMGNSDIWVRATTKNSITSDPGYTNSTVAKVGNTHYYVDTESTTLDSRKDLPKEIDSGYSMVTLNITRHANTDAYNE  357 (452)
Q Consensus       278 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  357 (452)
                                                                                           ..........+
T Consensus       120 ---------------------------------------------------------------------~~~~~~~~~~~  130 (184)
T 1ucu_A          120 ---------------------------------------------------------------------KQINSQTLGLA  130 (184)
T ss_dssp             ---------------------------------------------------------------------CCCSTTTTTCC
T ss_pred             ---------------------------------------------------------------------CCCCCCCCCCH
T ss_conf             ---------------------------------------------------------------------33332223324


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEE
Q ss_conf             000578999999999999999999878999999999999999999997306222
Q gi|254780531|r  358 KLAMEEMVSFIDTQIKCATAAAGKIGSISSRIHLQEDFIKLMRDAVEKGVGRLV  411 (452)
Q Consensus       358 ~~~~~~al~~id~a~~~v~~~ra~iGa~~nrle~~~~~~~~~~~~~~~~~s~i~  411 (452)
                      ...+..+|..||.|+..|...|+++||.|||||+.++++....+|+++++||||
T Consensus       131 ~~~a~~~~~~~d~ai~~~~~~r~~lga~qnrl~~~~~nl~~~~~n~~~a~s~i~  184 (184)
T 1ucu_A          131 ATTTENPLQKIDAALAQVDTLRSDLGAVQNRFNSAITNLGNTVNNLTSVRSRIE  184 (184)
T ss_dssp             CSCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             788999999999999999999999879999999999999999999999854687



>2d4x_A (A:) Flagellar HOOK-associated protein 3; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2zbi_A (A:1-113,A:232-292) Flagellin homolog; flagellum, structural protein; 2.00A {Sphingomonas SP} Back     alignment and structure
>1io1_A (A:1-117,A:348-398) Phase 1 flagellin; beta-folium, structural protein; 2.00A {Salmonella typhimurium} Back     alignment and structure
>1ory_B (B:) Flagellin; flagellar chaperone, cytosolic export chaperone, FLIS, FLIC; 2.45A {Aquifex aeolicus} Back     alignment and structure
>1ucu_A (A:1-40,A:455-494) Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} Back     alignment and structure
>1ucu_A (A:1-40,A:455-494) Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} Back     alignment and structure