254780534

254780534

acyl carrier protein

GeneID in NCBI database:8209530Locus tag:CLIBASIA_02105
Protein GI in NCBI database:254780534Protein Accession:YP_003064947.1
Gene range:+(746145, 746402)Protein Length:85aa
Gene description:acyl carrier protein
COG prediction:[I] [Q] Acyl carrier protein
KEGG prediction:acpP; acyl carrier protein; K02078 acyl carrier protein
SEED prediction:Acyl carrier protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Glycerolipid and Glycerophospholipid Metabolism in Bacteria;
Fatty Acid Biosynthesis FASII
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80-----
MPNANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAVDFIRKAKQTN
ccccHHHHHHHHHHHHHHHHccccHHHccccccHHHHccccHHHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHHHcc
ccccHHHHHHHHHHHHHHHHccccccccccccEHHHHccccHHHHHHHHHHHHHHccccccHHHHHHccEHHHHHHHccHccccc
MPNANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEkfsleipeesankiLTVKDAVDFIRKAKQTN
MPNANDDVFEAVKEVILSqltsvkedqIVESARFIEELGADSLDVVELVMIFEEKfsleipeesankiltvkdAVDFIRKAKQTN
MPNANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAVDFIRKAKQTN
******D***AVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAVDF*RK*****
MPNANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAVDFIRKAKQTN
**NANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAVDFIRKA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPNANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAVDFIRKAKQTN
MPNANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAVDFIRKAKQTN
MPNANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAVDFIRKAKQTN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target85 acyl carrier protein [Candidatus Liberibacter asiaticus
31512286384 acyl carrier protein [Candidatus Liberibacter solanacea 1 1e-21
14489904977 acyl carrier protein (ACP) [Magnetospirillum gryphiswal 1 6e-16
119657081134 transit peptide-acyl carrier protein fusion protein [sy 1 7e-16
8635708278 acyl carrier protein [Rhizobium etli CFN 42] Length = 7 1 1e-15
391297079 RecName: Full=Acyl carrier protein; Short=ACP Length = 1 1e-15
20996487179 acyl carrier protein [Rhodospirillum centenum SW] Lengt 1 1e-15
8331120677 acyl carrier protein [Magnetospirillum magneticum AMB-1 1 2e-15
22214814278 acyl carrier protein [Agrobacterium vitis S4] Length = 1 3e-15
15918461378 acyl carrier protein [Agrobacterium tumefaciens str. C5 1 3e-15
28895851479 acyl carrier protein [Azospirillum sp. B510] Length = 7 1 4e-15
>gi|315122863|ref|YP_004063352.1| acyl carrier protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 84 Back     alignment and organism information
 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 64/83 (77%), Gaps = 1/83 (1%)

Query: 1  MPNANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEI 60
          M N N+DVF ++K +++  L  VKE+Q+VESARFIE+LGADSLD VELVM FEEKF LEI
Sbjct: 1  MANDNEDVFTSIKAIVIDHL-GVKEEQVVESARFIEDLGADSLDTVELVMTFEEKFKLEI 59

Query: 61 PEESANKILTVKDAVDFIRKAKQ 83
          PEE AN I TV DAV FI  AK 
Sbjct: 60 PEEVANTIFTVGDAVKFINSAKN 82


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|144899049|emb|CAM75913.1| acyl carrier protein (ACP) [Magnetospirillum gryphiswaldense MSR-1] Length = 77 Back     alignment and organism information
>gi|119657081|gb|ABL86666.1| transit peptide-acyl carrier protein fusion protein [synthetic construct] Length = 134 Back     alignment and organism information
>gi|86357082|ref|YP_468974.1| acyl carrier protein [Rhizobium etli CFN 42] Length = 78 Back     alignment and organism information
>gi|3912970|sp|P94123|ACP_AZOBR RecName: Full=Acyl carrier protein; Short=ACP Length = 79 Back     alignment and organism information
>gi|209964871|ref|YP_002297786.1| acyl carrier protein [Rhodospirillum centenum SW] Length = 79 Back     alignment and organism information
>gi|83311206|ref|YP_421470.1| acyl carrier protein [Magnetospirillum magneticum AMB-1] Length = 77 Back     alignment and organism information
>gi|222148142|ref|YP_002549099.1| acyl carrier protein [Agrobacterium vitis S4] Length = 78 Back     alignment and organism information
>gi|159184613|ref|NP_529008.1| acyl carrier protein [Agrobacterium tumefaciens str. C58] Length = 78 Back     alignment and organism information
>gi|288958514|ref|YP_003448855.1| acyl carrier protein [Azospirillum sp. B510] Length = 79 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target85 acyl carrier protein [Candidatus Liberibacter asiaticus
PRK0098278 PRK00982, acpP, acyl carrier protein; Provisional 2e-17
PTZ00171148 PTZ00171, PTZ00171, acyl carrier protein; Provisional 8e-15
TIGR0051777 TIGR00517, acyl_carrier, acyl carrier protein 4e-14
KOG1748131 KOG1748, KOG1748, KOG1748, Acyl carrier protein/NADH-ub 2e-11
COG023680 COG0236, AcpP, Acyl carrier protein [Lipid metabolism / 1e-06
PRK0817282 PRK08172, PRK08172, putative acyl carrier protein IacP; 8e-05
PRK1244980 PRK12449, PRK12449, acyl carrier protein; Provisional 1e-04
pfam0055067 pfam00550, PP-binding, Phosphopantetheine attachment si 6e-04
CHL0012482 CHL00124, acpP, acyl carrier protein; Validated 6e-13
>gnl|CDD|179197 PRK00982, acpP, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|185496 PTZ00171, PTZ00171, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|129608 TIGR00517, acyl_carrier, acyl carrier protein Back     alignment and domain information
>gnl|CDD|36959 KOG1748, KOG1748, KOG1748, Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit [Energy production and conversion, Lipid transport and metabolism, Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|30585 COG0236, AcpP, Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|181266 PRK08172, PRK08172, putative acyl carrier protein IacP; Validated Back     alignment and domain information
>gnl|CDD|183533 PRK12449, PRK12449, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|144221 pfam00550, PP-binding, Phosphopantetheine attachment site Back     alignment and domain information
>gnl|CDD|177047 CHL00124, acpP, acyl carrier protein; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 85 acyl carrier protein [Candidatus Liberibacter asiaticus
CHL0012484 acpP acyl carrier protein; Validated 99.88
PRK1244980 acyl carrier protein; Provisional 99.88
PTZ00171150 acyl carrier protein; Provisional 99.87
PRK0535082 acyl carrier protein; Provisional 99.85
PRK0817275 acyl carrier protein; Validated 99.85
PRK0098278 acpP acyl carrier protein; Provisional 99.83
KOG1748131 consensus 99.8
PRK0588385 acyl carrier protein; Validated 99.7
COG023680 AcpP Acyl carrier protein [Lipid metabolism / Secondary 99.64
PRK0650893 acyl carrier protein; Provisional 99.6
TIGR0051777 acyl_carrier acyl carrier protein; InterPro: IPR003231 99.49
PRK0763991 acyl carrier protein; Provisional 99.2
PRK0918489 acyl carrier protein; Provisional 99.18
PRK0711779 acyl carrier protein; Validated 99.13
pfam0055067 PP-binding Phosphopantetheine attachment site. A 4'-pho 98.98
PRK0708183 acyl carrier protein; Provisional 98.95
smart0082386 PKS_PP Phosphopantetheine attachment site. Phosphopante 98.93
PRK0582880 acyl carrier protein; Validated 98.6
PRK06060705 acyl-CoA synthetase; Validated 98.57
PRK0508778 D-alanine--poly(phosphoribitol) ligase subunit 2; Valid 98.49
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase 98.34
PRK056914334 peptide synthase; Validated 98.31
PRK10252 1293 entF enterobactin synthase subunit F; Provisional 98.07
PRK05691 4334 peptide synthase; Validated 98.04
TIGR02813 2773 omega_3_PfaA polyketide-type polyunsaturated fatty acid 98.03
PRK123165154 peptide synthase; Provisional 97.9
TIGR02813 2773 omega_3_PfaA polyketide-type polyunsaturated fatty acid 97.85
PRK12467 3951 peptide synthase; Provisional 97.66
KOG1202 2376 consensus 97.02
PRK12467 3951 peptide synthase; Provisional 96.91
TIGR0168873 dltC D-alanyl carrier protein; InterPro: IPR003230 Thes 96.81
pfam07377110 DUF1493 Protein of unknown function (DUF1493). This fam 96.32
PRK12316 5154 peptide synthase; Provisional 95.84
COG343374 Aryl carrier domain [Secondary metabolites biosynthesis 95.57
>CHL00124 acpP acyl carrier protein; Validated Back     alignment and domain information
>PRK12449 acyl carrier protein; Provisional Back     alignment and domain information
>PTZ00171 acyl carrier protein; Provisional Back     alignment and domain information
>PRK05350 acyl carrier protein; Provisional Back     alignment and domain information
>PRK08172 acyl carrier protein; Validated Back     alignment and domain information
>PRK00982 acpP acyl carrier protein; Provisional Back     alignment and domain information
>KOG1748 consensus Back     alignment and domain information
>PRK05883 acyl carrier protein; Validated Back     alignment and domain information
>COG0236 AcpP Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06508 acyl carrier protein; Provisional Back     alignment and domain information
>TIGR00517 acyl_carrier acyl carrier protein; InterPro: IPR003231 There are two types of fatty acid synthase systems Back     alignment and domain information
>PRK07639 acyl carrier protein; Provisional Back     alignment and domain information
>PRK09184 acyl carrier protein; Provisional Back     alignment and domain information
>PRK07117 acyl carrier protein; Validated Back     alignment and domain information
>pfam00550 PP-binding Phosphopantetheine attachment site Back     alignment and domain information
>PRK07081 acyl carrier protein; Provisional Back     alignment and domain information
>smart00823 PKS_PP Phosphopantetheine attachment site Back     alignment and domain information
>PRK05828 acyl carrier protein; Validated Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05087 D-alanine--poly(phosphoribitol) ligase subunit 2; Validated Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA; InterPro: IPR004432 Members of this entry represent PfaA, which is involved in omega-3 polyunsaturated fatty acid biosynthesis, for example PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9 Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA; InterPro: IPR004432 Members of this entry represent PfaA, which is involved in omega-3 polyunsaturated fatty acid biosynthesis, for example PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9 Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>KOG1202 consensus Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>TIGR01688 dltC D-alanyl carrier protein; InterPro: IPR003230 These proteins are involved in the biosynthesis of D-alanyl-lipoteichoic acid in bacteria Back     alignment and domain information
>pfam07377 DUF1493 Protein of unknown function (DUF1493) Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>COG3433 Aryl carrier domain [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target85 acyl carrier protein [Candidatus Liberibacter asiaticus
3ejb_A97 Crystal Structure Of P450bioi In Complex With Tetra 2e-16
2l3v_A79 Nmr Structure Of Acyl Carrier Protein From Brucella 3e-15
2ehs_A77 Crystal Structure Of Acyl Carrier Protein From Aqui 6e-15
1x3o_A80 Crystal Structure Of The Acyl Carrier Protein From 7e-15
2qnw_A82 Toxoplasma Gondii Apicoplast-Targeted Acyl Carrier 1e-14
2l0q_A80 Nmr Solution Structure Of Vibrio Harveyi Acyl Carri 2e-14
1t8k_A77 Crystal Structure Of Apo Acyl Carrier Protein From 5e-14
1l0h_A78 Crystal Structure Of Butyryl-Acp From E.Coli Length 5e-14
2k92_A77 Structural Modification Of Acyl Carrier Protein By 6e-14
1l0i_A78 Crystal Structure Of Butyryl-Acp I62m Mutant Length 8e-14
1f80_D81 Holo-(Acyl Carrier Protein) Synthase In Complex Wit 1e-13
2kwl_A84 Solution Structure Of Acyl Carrier Protein From Bor 3e-13
2x2b_A78 Crystal Structure Of Malonyl-Acp (Acyl Carrier Prot 5e-13
3gzl_A81 Crystal Structure Of Holo Pfacp Disulfide-Linked Di 6e-13
2fq0_A79 Solution Structure Of Major Conformation Of Holo-Ac 9e-13
2dnw_A99 Solution Structure Of Rsgi Ruh-059, An Acp Domain O 1e-12
1hy8_A76 Solution Structure Of B. Subtilis Acyl Carrier Prot 2e-12
1klp_A115 The Solution Structure Of Acyl Carrier Protein From 3e-11
2cnr_A82 Structural Studies On The Interaction Of Scfas Acp 7e-11
2koo_A81 Nmr Solution Structures Of Hexanoyl-Acp From The St 5e-10
2l4b_A88 Solution Structure Of A Putative Acyl Carrier Prote 5e-09
2ava_A82 Solution Structure Of Stearoyl-Acyl Carrier Protein 2e-07
2cgq_A113 A Putative Acyl Carrier Protein(Rv0033) From Mycoba 2e-06
3lmo_A101 Crystal Structure Of Specialized Acyl Carrier Prote 3e-05
3ce7_A107 Crystal Structure Of Toxoplasma Specific Mitochodri 3e-04
2kwm_A86 Solution Nmr Structure Of Holo Acyl Carrier Protein 0.003
2kjs_A87 Solution Nmr Structure Of Gmet_2339 From Geobacter 0.004
>gi|209156735|pdb|3EJB|A Chain A, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 97 Back     alignment and structure
 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 38/75 (50%), Positives = 54/75 (72%), Gaps = 1/75 (1%)

Query: 8  VFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANK 67
          + E VK++I  QL  VK++++  +A F+E+LGADSLD VELVM  EE+F  EIP+E A K
Sbjct: 23 IEERVKKIIGEQL-GVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEK 81

Query: 68 ILTVKDAVDFIRKAK 82
          I TV+ A+D+I   +
Sbjct: 82 ITTVQAAIDYINGHQ 96


>gi|308198398|pdb|2L3V|A Chain A, Nmr Structure Of Acyl Carrier Protein From Brucella Melitensis Length = 79 Back     alignment and structure
>gi|158428365|pdb|2EHS|A Chain A, Crystal Structure Of Acyl Carrier Protein From Aquifex Aeolicus (Form 1) Length = 77 Back     alignment and structure
gi|109156923|pdb|1X3O|A Chain A, Crystal Structure Of The Acyl Carrier Protein From Thermus Thermophilus Hb8 Length = 80 Back     alignment and structure
>gi|157836019|pdb|2QNW|A Chain A, Toxoplasma Gondii Apicoplast-Targeted Acyl Carrier Protein Length = 82 Back     alignment and structure
>gi|301015667|pdb|2L0Q|A Chain A, Nmr Solution Structure Of Vibrio Harveyi Acyl Carrier Protein (Acp) Length = 80 Back     alignment and structure
>gi|55669892|pdb|1T8K|A Chain A, Crystal Structure Of Apo Acyl Carrier Protein From E. Coli Length = 77 Back     alignment and structure
gi|28948458|pdb|1L0H|A Chain A, Crystal Structure Of Butyryl-Acp From E.Coli Length = 78 Back     alignment and structure
>gi|221046459|pdb|2K92|A Chain A, Structural Modification Of Acyl Carrier Protein By Butyryl Group Length = 77 Back     alignment and structure
>gi|28948459|pdb|1L0I|A Chain A, Crystal Structure Of Butyryl-Acp I62m Mutant Length = 78 Back     alignment and structure
>gi|14719510|pdb|1F80|D Chain D, Holo-(Acyl Carrier Protein) Synthase In Complex With Holo- (Acyl Carrier Protein) Length = 81 Back     alignment and structure
>gi|295321482|pdb|2KWL|A Chain A, Solution Structure Of Acyl Carrier Protein From Borrelia Bur Length = 84 Back     alignment and structure
>gi|291191011|pdb|2X2B|A Chain A, Crystal Structure Of Malonyl-Acp (Acyl Carrier Protein) From Bacillus Subtilis Length = 78 Back     alignment and structure
>gi|227343866|pdb|3GZL|A Chain A, Crystal Structure Of Holo Pfacp Disulfide-Linked Dimer Length = 81 Back     alignment and structure
>gi|114793856|pdb|2FQ0|A Chain A, Solution Structure Of Major Conformation Of Holo-Acyl Carrier Protein From Malaria Parasite Plasmodium Falciparum Length = 79 Back     alignment and structure
>gi|159164263|pdb|2DNW|A Chain A, Solution Structure Of Rsgi Ruh-059, An Acp Domain Of Acyl Carrier Protein, Mitochondrial [precursor] From Human Cdna Length = 99 Back     alignment and structure
>gi|18655669|pdb|1HY8|A Chain A, Solution Structure Of B. Subtilis Acyl Carrier Protein Length = 76 Back     alignment and structure
>gi|21730498|pdb|1KLP|A Chain A, The Solution Structure Of Acyl Carrier Protein From Mycobacterium Tuberculosis Length = 115 Back     alignment and structure
gi|157881492|pdb|2CNR|A Chain A, Structural Studies On The Interaction Of Scfas Acp With Acps Length = 82 Back     alignment and structure
>gi|303324702|pdb|2KOO|A Chain A, Nmr Solution Structures Of Hexanoyl-Acp From The Streptomyces Coelicolor Fatty Acid Synthase Length = 81 Back     alignment and structure
>gi|311771874|pdb|2L4B|A Chain A, Solution Structure Of A Putative Acyl Carrier Protein From Anaplasma Phagocytophilum. Seattle Structural Genomics Center For Infectious Disease Target Anpha.01018.A Length = 88 Back     alignment and structure
>gi|99031841|pdb|2AVA|A Chain A, Solution Structure Of Stearoyl-Acyl Carrier Protein Length = 82 Back     alignment and structure
>gi|146386420|pdb|2CGQ|A Chain A, A Putative Acyl Carrier Protein(Rv0033) From Mycobacterium Tuberculosis Length = 113 Back     alignment and structure
>gi|288965873|pdb|3LMO|A Chain A, Crystal Structure Of Specialized Acyl Carrier Protein (Rpa2022) From Rhodopseudomonas Palustris, Northeast Structural Genomics Consortium Target Rpr324 Length = 101 Back     alignment and structure
>gi|170785236|pdb|3CE7|A Chain A, Crystal Structure Of Toxoplasma Specific Mitochodrial Acyl Carrier Protein, 59.M03510 Length = 107 Back     alignment and structure
>gi|302565876|pdb|2KWM|A Chain A, Solution Nmr Structure Of Holo Acyl Carrier Protein From Geobacter Metallireducens Refined With Nh Rdcs, Northeast Structural Genomics Consortium Target Gmr141 Length = 86 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target85 acyl carrier protein [Candidatus Liberibacter asiaticus
2kwl_A84 ACP, acyl carrier protein; structural genomics, seattle 2e-12
2l4b_A88 Acyl carrier protein; infectious disease, human granulo 6e-11
2l3v_A79 ACP, acyl carrier protein; structural genomi seattle st 9e-11
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier protein; 1e-10
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A {Bac 2e-10
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis, mit 9e-10
3ce7_A107 Specific mitochodrial acyl carrier protein; malaria, mi 2e-09
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty acid bi 3e-09
2kw2_A101 Specialized acyl carrier protein; structural genomics, 6e-09
3lmo_A101 Specialized acyl carrier protein; alpha-beta protein, s 1e-08
3ejb_A97 Acyl carrier protein; protein-protein complex, cytochro 2e-08
2amw_A83 Hypothetical protein NE2163; all helical protein, struc 4e-08
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier protei 3e-07
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-helix- 4e-07
2kci_A87 Putative acyl carrier protein; alpha, ACP, PCP, structu 1e-06
3gzm_A81 Acyl carrier protein; helix bundle, phosphopantetheine, 1e-06
2ehs_A77 ACP, acyl carrier protein; lipid transport, structural 2e-06
1dv5_A80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle; 2e-06
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosphopan 3e-06
2qnw_A82 Acyl carrier protein; malaria, SGC, structural genomics 4e-06
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolicin, ho 4e-06
1x3o_A80 Acyl carrier protein; structural genomics, riken struct 4e-06
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transport, p 7e-06
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unk 9e-06
1fh1_A92 NODF, nodulation protein F; ROOT nodulation factor, pro 3e-05
1af8_A86 Actinorhodin polyketide synthase acyl carrier protein; 6e-05
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; acyl c 9e-05
1vku_A100 Acyl carrier protein; TM0175, structural genomics, JCSG 0.003
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Length = 84 Back     alignment and structure
 Score = 66.2 bits (162), Expect = 2e-12
 Identities = 38/78 (48%), Positives = 53/78 (67%), Gaps = 1/78 (1%)

Query: 5  NDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEES 64
          ND++F  V+ +I  QL   KED+I   +RF+E+L ADSLD+ EL+ + EE F  +IPE  
Sbjct: 7  NDEIFSKVRSIISEQL-DKKEDEITTDSRFVEDLNADSLDIYELLYLLEEAFDDKIPENE 65

Query: 65 ANKILTVKDAVDFIRKAK 82
          AN+  TV D V+FI+K K
Sbjct: 66 ANEFETVGDVVNFIKKRK 83


>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Length = 88 Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Length = 79 Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis H37RV} SCOP: a.28.1.1 Length = 115 Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 1hy8_A Length = 81 Back     alignment and structure
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Length = 107 Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynthesis, lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 1l0h_A 2fhs_C 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A Length = 78 Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 3lmo_A Length = 101 Back     alignment and structure
>3lmo_A Specialized acyl carrier protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Rhodopseudomonas palustris} Length = 101 Back     alignment and structure
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Length = 97 Back     alignment and structure
>2amw_A Hypothetical protein NE2163; all helical protein, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Length = 83 Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Length = 95 Back     alignment and structure
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* Length = 82 Back     alignment and structure
>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} PDB: 3gzl_A* 2fq0_A* 2fq2_A* Length = 81 Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.30A {Aquifex aeolicus VF5} PDB: 2eht_A Length = 77 Back     alignment and structure
>1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Length = 80 Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} Length = 82 Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics consortium, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.90A {Toxoplasma gondii RH} Length = 82 Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Length = 83 Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.50A {Thermus thermophilus HB8} Length = 80 Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopantetheine; 1.83A {Mycobacterium tuberculosis} Length = 113 Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, structural genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Length = 105 Back     alignment and structure
>1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Length = 92 Back     alignment and structure
>1af8_A Actinorhodin polyketide synthase acyl carrier protein; solution structure, structure, antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Length = 86 Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Length = 89 Back     alignment and structure
>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 2.00A {Thermotoga maritima MSB8} SCOP: a.28.1.1 Length = 100 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target85 acyl carrier protein [Candidatus Liberibacter asiaticus
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis, mit 99.77
3gzm_A81 Acyl carrier protein; helix bundle, phosphopantetheine, 99.75
2l4b_A88 Acyl carrier protein; infectious disease, human granulo 99.74
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A {Bac 99.74
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty acid bi 99.73
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosphopan 99.71
2ehs_A77 ACP, acyl carrier protein; lipid transport, structural 99.7
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier protein; 99.7
2kwl_A84 ACP, acyl carrier protein; structural genomics, seattle 99.69
2qnw_A82 Acyl carrier protein; malaria, SGC, structural genomics 99.68
1x3o_A80 Acyl carrier protein; structural genomics, riken struct 99.68
3ejb_A97 Acyl carrier protein; protein-protein complex, cytochro 99.65
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-helix- 99.65
2kci_A87 Putative acyl carrier protein; alpha, ACP, PCP, structu 99.59
2l3v_A79 ACP, acyl carrier protein; structural genomi seattle st 99.59
1vku_A100 Acyl carrier protein; TM0175, structural genomics, JCSG 99.59
1dv5_A80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, 99.58
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transport, p 99.55
2kw2_A101 Specialized acyl carrier protein; structural genomics, 99.54
3ce7_A107 Specific mitochodrial acyl carrier protein; malaria, mi 99.53
2amw_A83 Hypothetical protein NE2163; all helical protein, struc 99.44
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unk 99.44
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier protei 99.4
1af8_A86 Actinorhodin polyketide synthase acyl carrier protein; 99.32
2afd_A88 Protein ASL1650; twisted antiparallel helical bundle, a 99.31
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; acyl c 99.25
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolicin, ho 99.13
2ju1_A95 Erythronolide synthase; carrier protein domain, modular 99.09
1fh1_A92 NODF, nodulation protein F; ROOT nodulation factor, pro 99.09
1dny_A91 Non-ribosomal peptide synthetase peptidyl carrier prote 98.9
2cg5_B91 Fatty acid synthase; transferase/hydrolase, transferase 98.79
2cq8_A110 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH, PP- 98.63
2jgp_A 520 Tyrocidine synthetase 3; multifunctional enzyme, antibi 98.61
2roq_A 343 Enterobactin synthetase component F; T-TE, PCP, thioest 98.39
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl carrie 98.16
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantetheine, m 97.62
2fq1_A287 Isochorismatase; ENTB, NRPS, multi-domain, ACP, hydrola 96.17
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.77  E-value=6.7e-19  Score=125.57  Aligned_cols=82  Identities=29%  Similarity=0.545  Sum_probs=78.0

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCHHHCCCCCCHHHHCCCCHHHHHHHHHHHHHHHCCCCCHHHHHCCCCHHHHHHHHHHH
Q ss_conf             87858999999999999836999988487867454206571009999999999838834888985058899999999985
Q gi|254780534|r    2 PNANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAVDFIRKA   81 (85)
Q Consensus         2 ~~t~~ei~~~v~~ii~~~l~~~~~~~i~~ds~l~~dLg~DSLd~vel~~~lE~~f~i~i~~~~~~~~~Tv~dlv~~I~~~   81 (85)
                      |||.++|.++|++++++.+ +++++.++++++|.+|||||||++++++..+|++||++||++++.++.||+++++||.+|
T Consensus        10 pmt~~eI~~~V~~iv~~~~-~i~~~~i~~d~~l~~dlg~DSl~~~elv~~iE~~fgi~i~~~~l~~~~Tv~~lv~~I~~k   88 (99)
T 2dnw_A           10 PLTLEGIQDRVLYVLKLYD-KIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADK   88 (99)
T ss_dssp             CCCHHHHHHHHHHHHHHCT-TSCTTTCCTTCCCCCCCCCCHHHHHHHHHHHHHHTTCCCCHHHHTTCCSHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHH-CCCHHHCCCCCCHHHHCCCCHHHHHHHHHHHHHHHCCCCCHHHHHCCCCHHHHHHHHHHC
T ss_conf             8899999999999999884-999988799985688749757999999999999988996999997389999999999977


Q ss_pred             HHC
Q ss_conf             537
Q gi|254780534|r   82 KQT   84 (85)
Q Consensus        82 ~~~   84 (85)
                      +..
T Consensus        89 ~~~   91 (99)
T 2dnw_A           89 KDV   91 (99)
T ss_dssp             CCS
T ss_pred             CCC
T ss_conf             787



>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} PDB: 3gzl_A* 2fq0_A* 2fq2_A* Back     alignment and structure
>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynthesis, lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 1l0h_A 2fhs_C 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.30A {Aquifex aeolicus VF5} PDB: 2eht_A Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis H37RV} SCOP: a.28.1.1 Back     alignment and structure
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics consortium, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.90A {Toxoplasma gondii RH} Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.50A {Thermus thermophilus HB8} Back     alignment and structure
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Back     alignment and structure
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Back     alignment and structure
>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 2.00A {Thermotoga maritima MSB8} SCOP: a.28.1.1 Back     alignment and structure
>1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopantetheine; 1.83A {Mycobacterium tuberculosis} Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 3lmo_A Back     alignment and structure
>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Back     alignment and structure
>2amw_A Hypothetical protein NE2163; all helical protein, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, structural genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Back     alignment and structure
>1af8_A Actinorhodin polyketide synthase acyl carrier protein; solution structure, structure, antibiotic biosynthesis; NMR {Streptomyces coelicolor A3} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein family, structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Back     alignment and structure
>2ju1_A Erythronolide synthase; carrier protein domain, modular polyketide synthase, alpha- helical bundle, acyltransferase; NMR {Saccharopolyspora erythraea} PDB: 2ju2_A Back     alignment and structure
>1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Back     alignment and structure
>1dny_A Non-ribosomal peptide synthetase peptidyl carrier protein; four-helix bundle, modular enzyme, domain, flexible region; NMR {Brevibacillus brevis} SCOP: a.28.1.2 PDB: 2gdw_A 2gdx_A 2gdy_A 2k2q_A Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase/hydrolase, transferase/hydrolase (complex), fatty acid biosynthesis, phosphopantetheine transferase, FAsn, ACP; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Back     alignment and structure
>2cq8_A 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH, PP-binding, acyl carrier protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jgp_A Tyrocidine synthetase 3; multifunctional enzyme, antibiotic biosynthesis, condensation domain, peptide bond formation, ligase, antibiotics; 1.85A {Brevibacillus brevis} Back     alignment and structure
>2roq_A Enterobactin synthetase component F; T-TE, PCP, thioesterase, peptidyl carrier protein, thiolation domain, non-ribosomal peptide synthetase; NMR {Escherichia coli} Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, termination module, phosphopantetheine; 2.6A {Bacillus subtilis} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2fq1_A Isochorismatase; ENTB, NRPS, multi-domain, ACP, hydrolase; 2.30A {Escherichia coli} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 85 acyl carrier protein [Candidatus Liberibacter asiaticus
d1f80d_74 a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [ 1e-10
d1t8ka_77 a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [T 1e-09
d1klpa_115 a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuber 6e-08
d1dv5a_80 a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacill 4e-07
d1nq4a_95 a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl 2e-06
d1or5a_82 a.28.1.1 (A:) Frenolicin polyketide synthase acyl carri 7e-06
d2af8a_86 a.28.1.1 (A:) Actinorhodin polyketide synthase acyl car 4e-05
d1vkua_85 a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima 3e-04
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Length = 74 Back     information, alignment and structure

class: All alpha proteins
fold: Acyl carrier protein-like
superfamily: ACP-like
family: Acyl-carrier protein (ACP)
domain: Acyl carrier protein
species: Bacillus subtilis [TaxId: 1423]
 Score = 58.6 bits (142), Expect = 1e-10
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 1/73 (1%)

Query: 7  DVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESAN 66
          D  E V ++I+ +L  V E  +   A F E+LGAD LDVVELVM  E++F +EI +E A 
Sbjct: 3  DTLERVTKIIVDRL-GVDEADVKLEASFKEDLGADXLDVVELVMELEDEFDMEISDEDAE 61

Query: 67 KILTVKDAVDFIR 79
          KI TV DAV++I+
Sbjct: 62 KIATVGDAVNYIQ 74


>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Length = 77 Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Length = 115 Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Length = 80 Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Length = 95 Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Length = 82 Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Length = 86 Back     information, alignment and structure
>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Length = 85 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target85 acyl carrier protein [Candidatus Liberibacter asiaticus
d1t8ka_77 Acyl carrier protein {Escherichia coli [TaxId: 562]} 99.75
d1klpa_115 Acyl carrier protein {Mycobacterium tuberculosis [TaxId 99.71
d1f80d_74 Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} 99.69
d1vkua_85 Acyl carrier protein {Thermotoga maritima [TaxId: 2336] 99.58
d1dv5a_80 apo-D-alanyl carrier protein {Lactobacillus casei [TaxI 99.49
d1nq4a_95 Oxytetracycline polyketide synthase acyl carrier {Strep 99.42
d2jq4a183 Hypothetical protein Atu2571 {Agrobacterium tumefaciens 99.36
d2af8a_86 Actinorhodin polyketide synthase acyl carrier protein, 99.33
d1or5a_82 Frenolicin polyketide synthase acyl carrier protein, Fr 99.22
d2gdwa176 Peptidyl carrier protein (PCP), thioester domain {Bacil 98.71
d2pnga176 Type I fatty acid synthase ACP domain {Rat (Rattus norv 98.68
>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Acyl carrier protein-like
superfamily: ACP-like
family: Acyl-carrier protein (ACP)
domain: Acyl carrier protein
species: Escherichia coli [TaxId: 562]
Probab=99.75  E-value=1.3e-18  Score=122.58  Aligned_cols=75  Identities=51%  Similarity=0.784  Sum_probs=71.9

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHCCCCCCHHHHCCCCHHHHHHHHHHHHHHHCCCCCHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             9999999999998369999884878674542065710099999999998388348889850588999999999855
Q gi|254780534|r    7 DVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAVDFIRKAK   82 (85)
Q Consensus         7 ei~~~v~~ii~~~l~~~~~~~i~~ds~l~~dLg~DSLd~vel~~~lE~~f~i~i~~~~~~~~~Tv~dlv~~I~~~~   82 (85)
                      +|+++|++|+++.+ ++++++++++++|.+|||||||+.+|++..+|++||++||++++.++.||+++++||++|+
T Consensus         2 ~I~~~v~~iia~~l-~i~~~~i~~~~~l~~dLg~DSl~~~el~~~iE~~f~i~i~~~~~~~~~Tv~dlv~~i~~~~   76 (77)
T d1t8ka_           2 TIEERVKKIIGEQL-GVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQ   76 (77)
T ss_dssp             CHHHHHHHHHHHHH-TCCGGGCCTTCBTTTTTCCCHHHHHHHHHHHHHHHTCCCCHHHHTTCCBHHHHHHHHHHTC
T ss_pred             CHHHHHHHHHHHHH-CCCHHHCCCCCCCHHCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHCCCHHHHHHHHHHCC
T ss_conf             39999999999998-8898776999860120244624899999999998689989999871899999999998760



>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Back     information, alignment and structure
>d2gdwa1 a.28.1.2 (A:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 85 acyl carrier protein [Candidatus Liberibacter asia
2qnw_A_82 (A:) Acyl carrier protein; malaria, SGC, structura 9e-09
2kci_A_1-6363 (A:1-63) Putative acyl carrier protein; alpha, ACP 3e-08
2amw_A_83 (A:) Hypothetical protein NE2163; all helical prot 3e-08
3ejb_A_97 (A:) Acyl carrier protein; protein-protein complex 5e-08
1x3o_A_80 (A:) Acyl carrier protein; structural genomics, ri 6e-08
1f80_D_81 (D:) Acyl carrier protein; transferase; HET: PN2; 8e-08
2dnw_A_99 (A:) Acyl carrier protein; ACP, fatty acid biosynt 9e-08
3gzm_A_81 (A:) Acyl carrier protein; helix bundle, phosphopa 1e-07
3lmo_A_101 (A:) Specialized acyl carrier protein; alpha-beta 1e-07
2uv9_A_40-205166 (A:40-205) Fatty acid synthase alpha subunits; fun 2e-07
1dv5_A_80 (A:) APO-DCP, APO-D-alanyl carrier protein; 3-heli 2e-07
2ehs_A_77 (A:) ACP, acyl carrier protein; lipid transport, s 2e-07
1l0i_A_78 (A:) Acyl carrier protein; acyl chain binding, fat 3e-07
2ava_A_82 (A:) ACP I, acyl carrier protein I, chloroplast; f 4e-07
1klp_A_115 (A:) ACP, ACPM, meromycolate extension acyl carrie 8e-07
2cnr_A_82 (A:) FAS, ACP, acyl carrier protein; polykdetide, 9e-07
1vku_A_100 (A:) Acyl carrier protein; TM0175, structural geno 5e-06
2cgq_A_113 (A:) Acyl carrier protein ACPA; RV0033, protein tr 5e-06
1af8_A_86 (A:) Actinorhodin polyketide synthase acyl carrier 3e-05
2ju1_A_95 (A:) Erythronolide synthase; carrier protein domai 4e-05
1nq4_A_95 (A:) Oxytetracycline polyketide synthase acyl carr 2e-04
2afd_A_88 (A:) Protein ASL1650; twisted antiparallel helical 3e-04
2jq4_A_105 (A:) AGR_C_4658P, hypothetical protein ATU2571; AT 4e-04
1fh1_A_92 (A:) NODF, nodulation protein F; ROOT nodulation f 6e-04
1or5_A_83 (A:) Acyl carrier protein; ACP, biosynthesis, fren 0.003
>2qnw_A (A:) Acyl carrier protein; malaria, SGC, structural genomics consortium, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.90A {Toxoplasma gondii RH}Length = 82 Back     alignment and structure
 Score = 53.6 bits (129), Expect = 9e-09
 Identities = 37/77 (48%), Positives = 52/77 (67%), Gaps = 1/77 (1%)

Query: 6  DDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESA 65
            + E VK+ +++    V   +I   + FI++L ADSLD VELVM FEEKF + IP+E A
Sbjct: 6  RPLLERVKD-VVADQLGVDRARINPESNFIKDLDADSLDSVELVMAFEEKFGVSIPDEEA 64

Query: 66 NKILTVKDAVDFIRKAK 82
          +KI TV+DA+ +I KAK
Sbjct: 65 SKIATVQDALSYIEKAK 81


>2amw_A (A:) Hypothetical protein NE2163; all helical protein, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea}Length = 83 Back     alignment and structure
>3ejb_A (A:) Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli}Length = 97 Back     alignment and structure
>1x3o_A (A:) Acyl carrier protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.50A {Thermus thermophilus HB8}Length = 80 Back     alignment and structure
>1f80_D (D:) Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis}Length = 81 Back     alignment and structure
>2dnw_A (A:) Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens}Length = 99 Back     alignment and structure
>3gzm_A (A:) Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} PDB: 3gzl_A* 2fq0_A* 2fq2_A*Length = 81 Back     alignment and structure
>3lmo_A (A:) Specialized acyl carrier protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Rhodopseudomonas palustris}Length = 101 Back     alignment and structure
>2uv9_A (A:40-205) Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A*Length = 166 Back     alignment and structure
>1dv5_A (A:) APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle; NMR {Lactobacillus casei}Length = 80 Back     alignment and structure
>2ehs_A (A:) ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.30A {Aquifex aeolicus VF5} PDB: 2eht_ALength = 77 Back     alignment and structure
>1l0i_A (A:) Acyl carrier protein; acyl chain binding, fatty acid biosynthesis, lipid transport; HET: PSR; 1.20A {Escherichia coli}Length = 78 Back     alignment and structure
>2ava_A (A:) ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A*Length = 82 Back     alignment and structure
>1klp_A (A:) ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis H37RV}Length = 115 Back     alignment and structure
>2cnr_A (A:) FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor}Length = 82 Back     alignment and structure
>1vku_A (A:) Acyl carrier protein; TM0175, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 2.00A {Thermotoga maritima MSB8}Length = 100 Back     alignment and structure
>2cgq_A (A:) Acyl carrier protein ACPA; RV0033, protein transport, phosphopantetheine; 1.83A {Mycobacterium tuberculosis}Length = 113 Back     alignment and structure
>1af8_A (A:) Actinorhodin polyketide synthase acyl carrier protein; solution structure, structure, antibiotic biosynthesis; NMR {Streptomyces coelicolor}Length = 86 Back     alignment and structure
>2ju1_A (A:) Erythronolide synthase; carrier protein domain, modular polyketide synthase, alpha- helical bundle, acyltransferase; NMR {Saccharopolyspora erythraea} PDB: 2ju2_ALength = 95 Back     alignment and structure
>1nq4_A (A:) Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus}Length = 95 Back     alignment and structure
>2afd_A (A:) Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein family, structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_ALength = 88 Back     alignment and structure
>2jq4_A (A:) AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, structural genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens}Length = 105 Back     alignment and structure
>1fh1_A (A:) NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum}Length = 92 Back     alignment and structure
>1or5_A (A:) Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus}Length = 83 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target85 acyl carrier protein [Candidatus Liberibacter asiaticus
2cnr_A_82 FAS, ACP, acyl carrier protein; polykdetide, phosp 99.56
2qnw_A_82 Acyl carrier protein; malaria, SGC, structural gen 99.55
2amw_A_83 Hypothetical protein NE2163; all helical protein, 99.54
1x3o_A_80 Acyl carrier protein; structural genomics, riken s 99.52
1f80_D_81 Acyl carrier protein; transferase; HET: PN2; 2.30A 99.51
3gzm_A_81 Acyl carrier protein; helix bundle, phosphopanteth 99.51
1klp_A_115 ACP, ACPM, meromycolate extension acyl carrier pro 99.51
2ava_A_82 ACP I, acyl carrier protein I, chloroplast; four-h 99.49
1dv5_A_80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bun 99.46
2kci_A_1-6363 Putative acyl carrier protein; alpha, ACP, PCP, st 99.44
2dnw_A_99 Acyl carrier protein; ACP, fatty acid biosynthesis 99.44
3ejb_A_97 Acyl carrier protein; protein-protein complex, cyt 99.42
2ehs_A_77 ACP, acyl carrier protein; lipid transport, struct 99.42
1l0i_A_78 Acyl carrier protein; acyl chain binding, fatty ac 99.39
1vku_A_100 Acyl carrier protein; TM0175, structural genomics, 99.36
2afd_A_88 Protein ASL1650; twisted antiparallel helical bund 99.29
1nq4_A_95 Oxytetracycline polyketide synthase acyl carrier p 99.28
3lmo_A_101 Specialized acyl carrier protein; alpha-beta prote 99.24
1af8_A_86 Actinorhodin polyketide synthase acyl carrier prot 99.24
2jq4_A_105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 99.24
2cgq_A_113 Acyl carrier protein ACPA; RV0033, protein transpo 99.21
1or5_A_83 Acyl carrier protein; ACP, biosynthesis, frenolici 99.15
2ju1_A_95 Erythronolide synthase; carrier protein domain, mo 99.12
1fh1_A_92 NODF, nodulation protein F; ROOT nodulation factor 99.11
2jgp_A_1-8787 Tyrocidine synthetase 3; multifunctional enzyme, a 98.99
2cq8_A_110 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH 98.97
1dny_A_91 Non-ribosomal peptide synthetase peptidyl carrier 98.91
2roq_A_1-9191 Enterobactin synthetase component F; T-TE, PCP, th 98.88
2cg5_B_91 Fatty acid synthase; transferase/hydrolase, transf 98.81
2vsq_A_956-104186 Surfactin synthetase subunit 3; ligase, peptidyl c 98.75
2uv9_A_40-205166 Fatty acid synthase alpha subunits; fungal, dehydr 98.49
2fq1_A_212-28776 Isochorismatase; ENTB, NRPS, multi-domain, ACP, hy 98.48
2vz8_A_1110-1120_1882-2512 642 Fatty acid synthase; transferase, phosphopantethei 93.85
3ce7_A_38-8447 Specific mitochodrial acyl carrier protein; malari 96.12
>2cnr_A (A:) FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} Back     alignment and structure
Probab=99.56  E-value=8.2e-15  Score=103.52  Aligned_cols=81  Identities=25%  Similarity=0.509  Sum_probs=77.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCHHHCCCCCCHHHHCCCCHHHHHHHHHHHHHHHCCCCCHHHHHCCCCHHHHHHHHHH
Q ss_conf             98785899999999999983699998848786745420657100999999999983883488898505889999999998
Q gi|254780534|r    1 MPNANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAVDFIRK   80 (85)
Q Consensus         1 M~~t~~ei~~~v~~ii~~~l~~~~~~~i~~ds~l~~dLg~DSLd~vel~~~lE~~f~i~i~~~~~~~~~Tv~dlv~~I~~   80 (85)
                      |+++.+++..+|++++++.+ +++++++.++++|.+|||+|||..++++..++++||+++|.+++.++.||+++++||.+
T Consensus         1 ls~~~~~i~~~i~~i~~~~l-~~~~~~i~~~~~~~~dlG~DSl~~~~l~~~i~~~~gi~i~~~~~~~~~Ti~~l~~~i~~   79 (82)
T 2cnr_A            1 MAATQEEIVAGLAEIVNEIA-GIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILD   79 (82)
T ss_dssp             CCCCHHHHHHHHHHHHHHHS-CCCTTTCCTTSBTTTTSCCCHHHHHHHHHHHHGGGTBCCCGGGGGTCSBHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHH-CCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCHHHHHCCCCHHHHHHHHHH
T ss_conf             98989999999999999996-87600032025699880761889999999999998377899998649999999999988


Q ss_pred             HH
Q ss_conf             55
Q gi|254780534|r   81 AK   82 (85)
Q Consensus        81 ~~   82 (85)
                      ++
T Consensus        80 ~~   81 (82)
T 2cnr_A           80 HQ   81 (82)
T ss_dssp             SB
T ss_pred             CC
T ss_conf             61



>2qnw_A (A:) Acyl carrier protein; malaria, SGC, structural genomics consortium, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.90A {Toxoplasma gondii RH} Back     alignment and structure
>2amw_A (A:) Hypothetical protein NE2163; all helical protein, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>1x3o_A (A:) Acyl carrier protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.50A {Thermus thermophilus HB8} Back     alignment and structure
>1f80_D (D:) Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} Back     alignment and structure
>3gzm_A (A:) Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} PDB: 3gzl_A* 2fq0_A* 2fq2_A* Back     alignment and structure
>1klp_A (A:) ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>2ava_A (A:) ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* Back     alignment and structure
>1dv5_A (A:) APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle; NMR {Lactobacillus casei} Back     alignment and structure
>2dnw_A (A:) Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ejb_A (A:) Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} Back     alignment and structure
>2ehs_A (A:) ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.30A {Aquifex aeolicus VF5} PDB: 2eht_A Back     alignment and structure
>1l0i_A (A:) Acyl carrier protein; acyl chain binding, fatty acid biosynthesis, lipid transport; HET: PSR; 1.20A {Escherichia coli} Back     alignment and structure
>1vku_A (A:) Acyl carrier protein; TM0175, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>2afd_A (A:) Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein family, structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Back     alignment and structure
>1nq4_A (A:) Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} Back     alignment and structure
>3lmo_A (A:) Specialized acyl carrier protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>1af8_A (A:) Actinorhodin polyketide synthase acyl carrier protein; solution structure, structure, antibiotic biosynthesis; NMR {Streptomyces coelicolor} Back     alignment and structure
>2jq4_A (A:) AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, structural genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2cgq_A (A:) Acyl carrier protein ACPA; RV0033, protein transport, phosphopantetheine; 1.83A {Mycobacterium tuberculosis} Back     alignment and structure
>1or5_A (A:) Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} Back     alignment and structure
>2ju1_A (A:) Erythronolide synthase; carrier protein domain, modular polyketide synthase, alpha- helical bundle, acyltransferase; NMR {Saccharopolyspora erythraea} PDB: 2ju2_A Back     alignment and structure
>1fh1_A (A:) NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} Back     alignment and structure
>2jgp_A (A:1-87) Tyrocidine synthetase 3; multifunctional enzyme, antibiotic biosynthesis, condensation domain, peptide bond formation, ligase, antibiotics; 1.85A {Brevibacillus brevis} Back     alignment and structure
>2cq8_A (A:) 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH, PP-binding, acyl carrier protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1dny_A (A:) Non-ribosomal peptide synthetase peptidyl carrier protein; four-helix bundle, modular enzyme, domain, flexible region; NMR {Brevibacillus brevis} Back     alignment and structure
>2roq_A (A:1-91) Enterobactin synthetase component F; T-TE, PCP, thioesterase, peptidyl carrier protein, thiolation domain, non-ribosomal peptide synthetase; NMR {Escherichia coli} Back     alignment and structure
>2cg5_B (B:) Fatty acid synthase; transferase/hydrolase, transferase/hydrolase (complex), fatty acid biosynthesis, phosphopantetheine transferase, FAsn, ACP; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Back     alignment and structure
>2vsq_A (A:956-1041) Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, termination module, phosphopantetheine; 2.6A {Bacillus subtilis} Back     alignment and structure
>2uv9_A (A:40-205) Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2fq1_A (A:212-287) Isochorismatase; ENTB, NRPS, multi-domain, ACP, hydrolase; 2.30A {Escherichia coli} Back     alignment and structure
>2vz8_A (A:1110-1120,A:1882-2512) Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3ce7_A (A:38-84) Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Back     alignment and structure