254780535

254780535

3-ketoacyl-(acyl-carrier-protein) reductase

GeneID in NCBI database:8209531Locus tag:CLIBASIA_02110
Protein GI in NCBI database:254780535Protein Accession:YP_003064948.1
Gene range:+(745186, 745929)Protein Length:247aa
Gene description:3-ketoacyl-(acyl-carrier-protein) reductase
COG prediction:[I] [Q] [R] Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
KEGG prediction:3-ketoacyl-(acyl-carrier-protein) reductase; K00059 3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
SEED prediction:3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
Pathway involved in KEGG:Fatty acid biosynthesis [PATH:las00061]
Biosynthesis of unsaturated fatty acids [PATH:las01040]
Subsystem involved in SEED:Fatty Acid Biosynthesis FASII
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVNCVAPGFIGSDMTVNLTEDQKGKIISSIPMKRMGAVDDIAAAVLYLSSLEASYVTGQTIHVNGGMAMI
cccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccccEEEEccccccc
cccccccEEEEcccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHcccccEEEEcccccccccHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccEEEEEEcccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccEccHHHHcccHHHHHHHHccccccccEcHHHHHHHHHHHHccccccccccEEEEcccHHHc
mfdltgkkalvtgasGSIGLAIAKILYKQgasvglhgtsqEKLEKVAKNFddvdrfllfpanfsdrVSVEYLSKRVneemggvdilvnnagivrdSLFMRARYEDWDDVLSVNLTSAFLLTRQLVPLMIRNRFGRVINITSVvgftgnagqvnycaaksglTGFTKALAQEtgrrnvtvncvapgfigsdmtvnltedqkgkiissipmkrmgavDDIAAAVLYLSSLEAsyvtgqtihvnggmami
mfdltgkkALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLlfpanfsdrvsVEYLSKRVneemggvdilvnnaGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVNCVAPGFIGSDMTVNLTEDQKGKIISSIPMKRMGAVDDIAAAVLYLSSLEASYVTGQTIHVNGGMAMI
MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVNCVAPGFIGSDMTVNLTEDQKGKIISSIPMKRMGAVDDIAAAVLYLSSLEASYVTGQTIHVNGGMAMI
****TGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVNCVAPGFIGSDMTVNLTEDQKGKIISSIPMKRMGAVDDIAAAVLYLSSLEASYVTGQTIHVNGGMAMI
MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVNCVAPGFIGSDMTVNLTEDQKGKIISSIPMKRMGAVDDIAAAVLYLSSLEASYVTGQTIHVNGGMAMI
***LTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVNCVAPGFIGSDMTVNLTEDQKGKIISSIPMKRMGAVDDIAAAVLYLSSLEASYVTGQTIHVNGGMAMI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxx
iiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVNCVAPGFIGSDMTVNLTEDQKGKIISSIPMKRMGAVDDIAAAVLYLSSLEASYVTGQTIHVNGGMAMI
MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVNCVAPGFIGSDMTVNLTEDQKGKIISSIPMKRMGAVDDIAAAVLYLSSLEASYVTGQTIHVNGGMAMI
MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVNCVAPGFIGSDMTVNLTEDQKGKIISSIPMKRMGAVDDIAAAVLYLSSLEASYVTGQTIHVNGGMAMI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target247 3-ketoacyl-(acyl-carrier-protein) reductase [Candidatus
254780337257 oxidoreductase protein [Candidatus Liberibacter as 7e-14
254780462267 enoyl-(acyl carrier protein) reductase [Candidatus 2e-13
254781166284 enoyl-(acyl carrier protein) reductase [Candidatus 5e-07
>gi|254780337|ref|YP_003064750.1| oxidoreductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 68.9 bits (167), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 94/191 (49%), Gaps = 2/191 (1%)

Query: 3   DLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFL-LFPA 61
           +L  + ALVTG+S  IG   A  L + GA V   G S  +LEK+      +++ + +F  
Sbjct: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74

Query: 62  NFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRD-SLFMRARYEDWDDVLSVNLTSAFLL 120
           +  D  ++E     + +  G +DIL+ NAGI+   S   + + + + DV+SVN+ + + +
Sbjct: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134

Query: 121 TRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVN 180
            R   P + ++  GR I ++S   +        Y A+K+ +    +  ++ET    + V 
Sbjct: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194

Query: 181 CVAPGFIGSDM 191
            + PG   + M
Sbjct: 195 NIDPGPTRTSM 205

>gi|254780462|ref|YP_003064875.1| enoyl-(acyl carrier protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 267 Back     alignment
 Score = 67.4 bits (163), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 121/260 (46%), Gaps = 26/260 (10%)

Query: 4   LTGKKALVTGASG--SIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPA 61
           L GK+ L+ G +   SI   IAK+L+  GA +      +   +++      VD   + P 
Sbjct: 5   LKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMIPC 64

Query: 62  NFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDW--DDVLSVNLTSAFL 119
           N  D  S++ L +R+ E    +D +V++     D   +R  Y +   D+ +   L S F 
Sbjct: 65  NVEDPSSMDLLFERIKERWETLDFVVHSIAF-SDKNELRGPYYNTSRDNFIQTMLVSCFS 123

Query: 120 LTR------QLVPLMIRNRFGRVINITSVVGFTGNAGQV-NYCA---AKSGLTGFTKALA 169
            T       QL+P       G +I +T    + G+   V NY A   AKS L   TK LA
Sbjct: 124 FTEIVRRAAQLMP-----HGGAMITLT----YGGSMRVVPNYNAMAPAKSALESSTKYLA 174

Query: 170 QETGRRNVTVNCVAPGFIGSDMTVNLT--EDQKGKIISSIPMKRMGAVDDIAAAVLYLSS 227
            + G  N+ +N ++ G + +    +++   D       + P+KR  +++DI  + LYL S
Sbjct: 175 CDYGGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSALYLLS 234

Query: 228 LEASYVTGQTIHVNGGMAMI 247
             ++ VTG+  +V+ G  ++
Sbjct: 235 YLSNGVTGEIHYVDCGYNIV 254

>gi|254781166|ref|YP_003065579.1| enoyl-(acyl carrier protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 284 Back     alignment
 Score = 46.2 bits (108), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 122/254 (48%), Gaps = 19/254 (7%)

Query: 7   KKALVTGASG--SIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFS 64
           K+ +V G +   S+  +IAK+ +  GA V L        +++    + +D F+    N S
Sbjct: 11  KRGIVLGVANNRSLAWSIAKMCHAAGAKVALTWQGDATKKRIEGLVEGMDFFMAGHCNVS 70

Query: 65  DRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARY-----EDWDDVLSVNLTSAFL 119
           +  +++ + + + +E G +D LV+ A    D   +   Y     E++ + + V++ S   
Sbjct: 71  NSETIDDVFRNLEKEWGTIDFLVH-AIAFSDKAELTGPYINTTRENFLNTMDVSVYSFTA 129

Query: 120 LTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYC--AAKSGLTGFTKALAQETGRRN- 176
           L  +   LM  N+ G ++ +T  +G        N C   AK+ L    + LA + GR++ 
Sbjct: 130 LAARASSLM--NKGGSMLTLT-YLGADKVMPHYN-CMGPAKAALQSAVRYLAMDLGRQSG 185

Query: 177 VTVNCVAPGFIGSDMTVNLTEDQ---KGKIISSIPMKRMGAVDDIAAAVLYLSSLEASYV 233
           + VN ++ G   +  +  +++ +   K    +S P+ R    D++A + LYL S  +S V
Sbjct: 186 IRVNALSAGPAKTLASSGISDFRYILKWNEYNS-PLGRNITHDEVAKSALYLLSDFSSGV 244

Query: 234 TGQTIHVNGGMAMI 247
           TG+  +V+ G  ++
Sbjct: 245 TGECHYVDAGYHIV 258

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target247 3-ketoacyl-(acyl-carrier-protein) reductase [Candidatus
315122864247 3-ketoacyl-(acyl-carrier-protein) reductase [Candidatus 1 1e-117
121602121245 3-ketoacyl-(acyl-carrier-protein) reductase [Bartonella 1 2e-89
239831327245 3-oxoacyl-(acyl-carrier-protein) reductase [Ochrobactru 1 3e-89
153007916245 3-ketoacyl-(acyl-carrier-protein) reductase [Ochrobactr 1 1e-88
210061031246 Chain A, 2.5a Crystal Structure Of GlucoseRIBITOL DEHYD 1 2e-88
17987760245 3-ketoacyl-(acyl-carrier-protein) reductase [Brucella m 1 2e-88
215261300249 Chain A, 2.1a Crystal Structure Of GlucoseRIBITOL DEHYD 1 2e-88
254718633245 3-oxoacyl-(acyl-carrier-protein) reductase [Brucella sp 1 2e-88
222085442245 3-oxoacyl-(acyl-carrier-protein) reductase [Agrobacteri 1 2e-87
319408310245 3-oxoacyl-(acyl carrierprotein) reductase [Bartonella s 1 1e-86
>gi|315122864|ref|YP_004063353.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 247 Back     alignment and organism information
 Score =  424 bits (1089), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 203/247 (82%), Positives = 220/247 (89%)

Query: 1   MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFP 60
           MFDL GKKALVTGASGSIGLAIAKILYKQGA VGLHGTSQEKLE+VA  FDD  RF LF 
Sbjct: 1   MFDLNGKKALVTGASGSIGLAIAKILYKQGAFVGLHGTSQEKLERVACQFDDSSRFQLFK 60

Query: 61  ANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLL 120
            NFSD  S+E  SKRV  EMG VDILVNNAGIVRDSLFMRA+Y+DW DVL VNLTSAF+L
Sbjct: 61  GNFSDHSSIEEFSKRVGTEMGTVDILVNNAGIVRDSLFMRAQYKDWSDVLCVNLTSAFIL 120

Query: 121 TRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVN 180
           TRQL+P MI+NRFGR+INITSVVGFTGN GQVNYC+ KSGLTGFTKALAQETGRRN+TVN
Sbjct: 121 TRQLIPAMIKNRFGRIINITSVVGFTGNVGQVNYCSTKSGLTGFTKALAQETGRRNITVN 180

Query: 181 CVAPGFIGSDMTVNLTEDQKGKIISSIPMKRMGAVDDIAAAVLYLSSLEASYVTGQTIHV 240
           CVAPGFI SDMT +L E Q+ KI+SS+PMKRMG VDD+A+AVLYLSSLEASY+TGQTIHV
Sbjct: 181 CVAPGFIESDMTASLNEAQQEKIVSSVPMKRMGTVDDVASAVLYLSSLEASYITGQTIHV 240

Query: 241 NGGMAMI 247
           NGGMAMI
Sbjct: 241 NGGMAMI 247


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|121602121|ref|YP_988812.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Bartonella bacilliformis KC583] Length = 245 Back     alignment and organism information
>gi|239831327|ref|ZP_04679656.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Ochrobactrum intermedium LMG 3301] Length = 245 Back     alignment and organism information
>gi|153007916|ref|YP_001369131.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Ochrobactrum anthropi ATCC 49188] Length = 245 Back     alignment and organism information
>gi|210061031|pdb|3EMK|A Chain A, 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE From Brucella Melitensis Length = 246 Back     alignment and organism information
>gi|17987760|ref|NP_540394.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Brucella melitensis bv. 1 str. 16M] Length = 245 Back     alignment and organism information
>gi|215261300|pdb|3ENN|A Chain A, 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE From Brucella Melitensis (P43212) Length = 249 Back     alignment and organism information
>gi|254718633|ref|ZP_05180444.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Brucella sp. 83/13] Length = 245 Back     alignment and organism information
>gi|222085442|ref|YP_002543972.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Agrobacterium radiobacter K84] Length = 245 Back     alignment and organism information
>gi|319408310|emb|CBI81963.1| 3-oxoacyl-(acyl carrierprotein) reductase [Bartonella schoenbuchensis R1] Length = 245 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target247 3-ketoacyl-(acyl-carrier-protein) reductase [Candidatus
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) r 3e-92
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 4e-90
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-prot 3e-86
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 1e-82
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 7e-71
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) r 5e-68
TIGR01829242 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase 4e-63
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisio 7e-60
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 8e-56
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 3e-50
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Provisio 1e-49
COG1028251 COG1028, FabG, Dehydrogenases with different specificit 5e-49
PRK08213259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisio 6e-49
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Provisio 1e-48
PRK12935247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisio 6e-48
PRK12938246 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisio 3e-47
PRK12429258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Pr 8e-47
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase 2e-45
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Provisio 4e-45
PRK08217253 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 7e-45
TIGR01963255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 1e-44
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase 1e-42
PRK07097265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisio 5e-42
PRK12743256 PRK12743, PRK12743, oxidoreductase; Provisional 1e-41
TIGR01831239 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-protein) r 1e-41
PRK06124256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisio 5e-41
KOG0725270 KOG0725, KOG0725, KOG0725, Reductases with broad range 5e-40
PRK09135249 PRK09135, PRK09135, pteridine reductase; Provisional 8e-40
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Provisio 1e-39
PRK07774250 PRK07774, PRK07774, short chain dehydrogenase; Provisio 1e-38
PRK07063260 PRK07063, PRK07063, short chain dehydrogenase; Provisio 3e-38
PRK13394262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Pr 4e-38
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Provisio 7e-38
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase 7e-38
PRK07478254 PRK07478, PRK07478, short chain dehydrogenase; Provisio 1e-37
PRK08261450 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 2e-37
COG0300265 COG0300, DltE, Short-chain dehydrogenases of various su 4e-37
PRK08085254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisio 7e-37
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Provisio 9e-37
TIGR03206250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA 2e-36
PRK12384259 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; 3e-36
PRK09242257 PRK09242, PRK09242, tropinone reductase; Provisional 3e-36
PRK08277278 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisi 4e-36
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Validate 7e-36
PRK06171266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenas 2e-35
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Provisio 3e-35
PRK08993253 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase 3e-35
PRK08220252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydroge 4e-35
PRK08589272 PRK08589, PRK08589, short chain dehydrogenase; Validate 2e-34
PRK06701290 PRK06701, PRK06701, short chain dehydrogenase; Provisio 2e-34
PRK07890258 PRK07890, PRK07890, short chain dehydrogenase; Provisio 2e-34
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenase of 6e-34
PRK08936261 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisiona 7e-34
PRK06550235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 8e-34
PRK07814263 PRK07814, PRK07814, short chain dehydrogenase; Provisio 9e-34
PRK08324681 PRK08324, PRK08324, short chain dehydrogenase; Validate 1e-33
PRK12745256 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) r 3e-33
PRK06463255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 4e-33
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Provisio 6e-33
PRK07069251 PRK07069, PRK07069, short chain dehydrogenase; Validate 9e-33
PRK07577234 PRK07577, PRK07577, short chain dehydrogenase; Provisio 9e-33
KOG1205282 KOG1205, KOG1205, KOG1205, Predicted dehydrogenase [Sec 1e-32
PRK06523260 PRK06523, PRK06523, short chain dehydrogenase; Provisio 4e-32
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Provisio 1e-31
PRK07523255 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisio 1e-31
PRK07035252 PRK07035, PRK07035, short chain dehydrogenase; Provisio 2e-31
PRK06057255 PRK06057, PRK06057, short chain dehydrogenase; Provisio 3e-31
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Provisio 4e-31
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Provisio 6e-31
PRK07856252 PRK07856, PRK07856, short chain dehydrogenase; Provisio 1e-30
PRK07067257 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional 5e-30
PRK06484520 PRK06484, PRK06484, short chain dehydrogenase; Validate 1e-29
PRK06113255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenas 1e-29
PRK12746254 PRK12746, PRK12746, short chain dehydrogenase; Provisio 1e-29
PRK08265261 PRK08265, PRK08265, short chain dehydrogenase; Provisio 1e-29
PRK06114254 PRK06114, PRK06114, short chain dehydrogenase; Provisio 2e-29
PRK06500249 PRK06500, PRK06500, short chain dehydrogenase; Provisio 3e-29
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 3e-29
PRK06398258 PRK06398, PRK06398, aldose dehydrogenase; Validated 8e-29
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Provisio 8e-29
PRK12748256 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) r 9e-29
PRK07576264 PRK07576, PRK07576, short chain dehydrogenase; Provisio 1e-28
PRK07062265 PRK07062, PRK07062, short chain dehydrogenase; Provisio 2e-28
PRK07792306 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 3e-28
PRK08339263 PRK08339, PRK08339, short chain dehydrogenase; Provisio 7e-28
PRK06123248 PRK06123, PRK06123, short chain dehydrogenase; Provisio 9e-28
PRK09730247 PRK09730, PRK09730, putative NAD(P)-binding oxidoreduct 2e-27
PRK07074257 PRK07074, PRK07074, short chain dehydrogenase; Provisio 2e-27
PRK06128300 PRK06128, PRK06128, oxidoreductase; Provisional 4e-27
PRK06949258 PRK06949, PRK06949, short chain dehydrogenase; Provisio 4e-27
PRK08628258 PRK08628, PRK08628, short chain dehydrogenase; Provisio 7e-27
PRK08643256 PRK08643, PRK08643, acetoin reductase; Validated 8e-27
PRK08642253 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 1e-26
PRK07791286 PRK07791, PRK07791, short chain dehydrogenase; Provisio 2e-26
PRK07677252 PRK07677, PRK07677, short chain dehydrogenase; Provisio 2e-26
KOG1207245 KOG1207, KOG1207, KOG1207, Diacetyl reductase/L-xylulos 3e-26
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Provisio 3e-26
PRK12747252 PRK12747, PRK12747, short chain dehydrogenase; Provisio 3e-26
PRK06198260 PRK06198, PRK06198, short chain dehydrogenase; Provisio 5e-26
PRK09186256 PRK09186, PRK09186, flagellin modification protein A; P 9e-26
PRK05717255 PRK05717, PRK05717, oxidoreductase; Validated 3e-25
PRK07831262 PRK07831, PRK07831, short chain dehydrogenase; Provisio 4e-25
PRK08063250 PRK08063, PRK08063, enoyl-(acyl carrier protein) reduct 5e-25
PRK07985294 PRK07985, PRK07985, oxidoreductase; Provisional 1e-24
PRK06181263 PRK06181, PRK06181, short chain dehydrogenase; Provisio 1e-24
KOG1199260 KOG1199, KOG1199, KOG1199, Short-chain alcohol dehydrog 2e-24
TIGR02632676 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldol 3e-24
PRK12859256 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) r 5e-24
PRK09134258 PRK09134, PRK09134, short chain dehydrogenase; Provisio 6e-24
PLN02253280 PLN02253, PLN02253, xanthoxin dehydrogenase 1e-23
PRK12823260 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carb 8e-23
PRK07825273 PRK07825, PRK07825, short chain dehydrogenase; Provisio 3e-22
PRK08945247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier prot 3e-22
PRK06077252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 6e-22
PRK06947248 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisiona 2e-21
PRK05650270 PRK05650, PRK05650, short chain dehydrogenase; Provisio 2e-21
PRK06125259 PRK06125, PRK06125, short chain dehydrogenase; Provisio 2e-21
PRK08340259 PRK08340, PRK08340, glucose-1-dehydrogenase; Provisiona 9e-21
PRK08267260 PRK08267, PRK08267, short chain dehydrogenase; Provisio 4e-20
PRK12742237 PRK12742, PRK12742, oxidoreductase; Provisional 6e-20
PRK06200263 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylprop 1e-19
PRK05786238 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 1e-19
COG0623259 COG0623, FabI, Enoyl-[acyl-carrier-protein] 5e-19
PRK12744257 PRK12744, PRK12744, short chain dehydrogenase; Provisio 4e-17
PRK10538248 PRK10538, PRK10538, malonic semialdehyde reductase; Pro 5e-17
PRK05875276 PRK05875, PRK05875, short chain dehydrogenase; Provisio 1e-16
TIGR03325262 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3-diol 2e-16
PRK08416260 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenas 5e-15
PRK07370258 PRK07370, PRK07370, enoyl-(acyl carrier protein) reduct 9e-15
PRK06483236 PRK06483, PRK06483, dihydromonapterin reductase; Provis 4e-14
TIGR02685267 TIGR02685, pter_reduc_Leis, pteridine reductase 1e-13
PRK07041230 PRK07041, PRK07041, short chain dehydrogenase; Provisio 1e-12
PRK08703239 PRK08703, PRK08703, short chain dehydrogenase; Provisio 9e-12
PRK08415274 PRK08415, PRK08415, enoyl-(acyl carrier protein) reduct 2e-11
PRK07775274 PRK07775, PRK07775, short chain dehydrogenase; Provisio 1e-10
PRK07889256 PRK07889, PRK07889, enoyl-(acyl carrier protein) reduct 9e-10
PRK06505271 PRK06505, PRK06505, enoyl-(acyl carrier protein) reduct 9e-09
PLN02730303 PLN02730, PLN02730, enoyl-[acyl-carrier-protein] reduct 1e-08
PRK05884223 PRK05884, PRK05884, short chain dehydrogenase; Provisio 1e-08
PRK06603260 PRK06603, PRK06603, enoyl-(acyl carrier protein) reduct 3e-08
PRK06300299 PRK06300, PRK06300, enoyl-(acyl carrier protein) reduct 6e-08
PRK07533258 PRK07533, PRK07533, enoyl-(acyl carrier protein) reduct 2e-07
PRK08159272 PRK08159, PRK08159, enoyl-(acyl carrier protein) reduct 4e-07
PRK08594257 PRK08594, PRK08594, enoyl-(acyl carrier protein) reduct 7e-07
PRK08690261 PRK08690, PRK08690, enoyl-(acyl carrier protein) reduct 5e-06
PRK07984262 PRK07984, PRK07984, enoyl-(acyl carrier protein) reduct 2e-05
PRK06997260 PRK06997, PRK06997, enoyl-(acyl carrier protein) reduct 8e-04
KOG1200256 KOG1200, KOG1200, KOG1200, Mitochondrial/plastidial bet 3e-54
PRK07666239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 2e-35
PRK09072263 PRK09072, PRK09072, short chain dehydrogenase; Provisio 8e-31
KOG1201300 KOG1201, KOG1201, KOG1201, Hydroxysteroid 17-beta dehyd 1e-29
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 1e-27
PRK08219227 PRK08219, PRK08219, short chain dehydrogenase; Provisio 2e-26
PRK05872296 PRK05872, PRK05872, short chain dehydrogenase; Provisio 1e-25
KOG4169261 KOG4169, KOG4169, KOG4169, 15-hydroxyprostaglandin dehy 6e-25
KOG1014312 KOG1014, KOG1014, KOG1014, 17 beta-hydroxysteroid dehyd 1e-23
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Provisio 3e-22
PRK05866293 PRK05866, PRK05866, short chain dehydrogenase; Provisio 8e-21
KOG1208314 KOG1208, KOG1208, KOG1208, Dehydrogenases with differen 1e-20
KOG1210331 KOG1210, KOG1210, KOG1210, Predicted 3-ketosphinganine 2e-19
COG3967245 COG3967, DltE, Short-chain dehydrogenase involved in D- 2e-19
PRK07109334 PRK07109, PRK07109, short chain dehydrogenase; Provisio 1e-18
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Validate 2e-18
KOG1610322 KOG1610, KOG1610, KOG1610, Corticosteroid 11-beta-dehyd 8e-18
PRK06179270 PRK06179, PRK06179, short chain dehydrogenase; Provisio 2e-17
PRK05855582 PRK05855, PRK05855, short chain dehydrogenase; Validate 3e-17
PRK07024257 PRK07024, PRK07024, short chain dehydrogenase; Provisio 2e-16
PRK06180277 PRK06180, PRK06180, short chain dehydrogenase; Provisio 1e-15
PRK07832272 PRK07832, PRK07832, short chain dehydrogenase; Provisio 4e-15
PRK06914280 PRK06914, PRK06914, short chain dehydrogenase; Provisio 8e-15
PRK08263275 PRK08263, PRK08263, short chain dehydrogenase; Provisio 3e-14
PRK06182273 PRK06182, PRK06182, short chain dehydrogenase; Validate 3e-14
PRK05693274 PRK05693, PRK05693, short chain dehydrogenase; Provisio 4e-14
PRK06194287 PRK06194, PRK06194, hypothetical protein; Provisional 8e-14
PRK05876275 PRK05876, PRK05876, short chain dehydrogenase; Provisio 3e-12
KOG1204253 KOG1204, KOG1204, KOG1204, Predicted dehydrogenase [Sec 6e-12
smart00822180 smart00822, PKS_KR, This enzymatic domain is part of ba 1e-11
PRK08278273 PRK08278, PRK08278, short chain dehydrogenase; Provisio 5e-11
KOG1611249 KOG1611, KOG1611, KOG1611, Predicted short chain-type d 7e-11
PRK08017256 PRK08017, PRK08017, oxidoreductase; Provisional 8e-11
PRK06139330 PRK06139, PRK06139, short chain dehydrogenase; Provisio 1e-10
PRK06924251 PRK06924, PRK06924, short chain dehydrogenase; Provisio 2e-10
KOG1209289 KOG1209, KOG1209, KOG1209, 1-Acyl dihydroxyacetone phos 5e-10
PRK05993277 PRK05993, PRK05993, short chain dehydrogenase; Provisio 6e-10
TIGR01500256 TIGR01500, sepiapter_red, sepiapterin reductase 4e-09
PRK08251248 PRK08251, PRK08251, short chain dehydrogenase; Provisio 7e-09
PRK07023243 PRK07023, PRK07023, short chain dehydrogenase; Provisio 7e-09
PRK09291257 PRK09291, PRK09291, short chain dehydrogenase; Provisio 1e-08
PRK08303305 PRK08303, PRK08303, short chain dehydrogenase; Provisio 2e-08
PRK06482276 PRK06482, PRK06482, short chain dehydrogenase; Provisio 3e-08
PRK07102243 PRK07102, PRK07102, short chain dehydrogenase; Provisio 3e-08
PLN02780320 PLN02780, PLN02780, ketoreductase/ oxidoreductase 1e-07
PRK08177225 PRK08177, PRK08177, short chain dehydrogenase; Provisio 5e-06
KOG1478341 KOG1478, KOG1478, KOG1478, 3-keto sterol reductase [Lip 2e-04
PRK08862227 PRK08862, PRK08862, short chain dehydrogenase; Provisio 0.002
pfam08659181 pfam08659, KR, KR domain 2e-11
PRK06196315 PRK06196, PRK06196, oxidoreductase; Provisional 3e-11
PRK05854313 PRK05854, PRK05854, short chain dehydrogenase; Provisio 3e-09
PRK07806248 PRK07806, PRK07806, short chain dehydrogenase; Provisio 2e-08
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases 0.001
pfam01370235 pfam01370, Epimerase, NAD dependent epimerase/dehydrata 0.001
PRK12428241 PRK12428, PRK12428, 3-alpha-hydroxysteroid dehydrogenas 2e-09
PRK06940275 PRK06940, PRK06940, short chain dehydrogenase; Provisio 2e-06
PRK07424406 PRK07424, PRK07424, bifunctional sterol desaturase/shor 9e-06
PRK06197306 PRK06197, PRK06197, short chain dehydrogenase; Provisio 5e-04
PRK06720169 PRK06720, PRK06720, hypothetical protein; Provisional 6e-04
PRK13771334 PRK13771, PRK13771, putative alcohol dehydrogenase; Pro 8e-04
PRK14106 450 PRK14106, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 0.003
cd01078194 cd01078, NAD_bind_H4MPT_DH, NADP binding domain of meth 4e-05
KOG1502327 KOG1502, KOG1502, KOG1502, Flavonol reductase/cinnamoyl 3e-04
TIGR03466328 TIGR03466, HpnA, hopanoid-associated sugar epimerase 0.004
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|180126 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|162551 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|180183 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|183774 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|162550 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|180133 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180897 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|31231 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183776 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|171822 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|183525 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|130891 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181297 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|162628 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180836 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183715 PRK12743, PRK12743, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|130890 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>gnl|CDD|180412 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|35944 KOG0725, KOG0725, KOG0725, Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181112 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180819 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|102201 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181332 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|30648 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional Back     alignment and domain information
>gnl|CDD|181348 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181299 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180661 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|33946 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181389 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183717 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|183777 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181044 PRK07577, PRK07577, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36419 KOG1205, KOG1205, KOG1205, Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168990 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180371 PRK06057, PRK06057, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180930 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181148 PRK07856, PRK07856, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180821 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181336 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180593 PRK06500, PRK06500, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|180553 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183720 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181043 PRK07576, PRK07576, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180818 PRK07062, PRK07062, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181120 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|169389 PRK08339, PRK08339, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182051 PRK09730, PRK09730, putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180773 PRK06949, PRK06949, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated Back     alignment and domain information
>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181119 PRK07791, PRK07791, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181077 PRK07677, PRK07677, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36421 KOG1207, KOG1207, KOG1207, Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183719 PRK12747, PRK12747, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169699 PRK09186, PRK09186, flagellin modification protein A; Provisional Back     alignment and domain information
>gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|181138 PRK07831, PRK07831, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181217 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180447 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36413 KOG1199, KOG1199, KOG1199, Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|183797 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181667 PRK09134, PRK09134, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181591 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|168382 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168153 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168407 PRK06125, PRK06125, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169390 PRK08340, PRK08340, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181338 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183714 PRK12742, PRK12742, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180464 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180258 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|30968 COG0623, FabI, Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>gnl|CDD|183716 PRK12744, PRK12744, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182531 PRK10538, PRK10538, malonic semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|180300 PRK05875, PRK05875, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132368 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>gnl|CDD|181417 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180949 PRK07370, PRK07370, enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|180586 PRK06483, PRK06483, dihydromonapterin reductase; Provisional Back     alignment and domain information
>gnl|CDD|131732 TIGR02685, pter_reduc_Leis, pteridine reductase Back     alignment and domain information
>gnl|CDD|180804 PRK07041, PRK07041, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169556 PRK08703, PRK08703, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181416 PRK08415, PRK08415, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181113 PRK07775, PRK07775, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181158 PRK07889, PRK07889, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180596 PRK06505, PRK06505, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|178331 PLN02730, PLN02730, enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>gnl|CDD|135642 PRK05884, PRK05884, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168626 PRK06603, PRK06603, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180521 PRK06300, PRK06300, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181020 PRK07533, PRK07533, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181260 PRK08159, PRK08159, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181494 PRK08594, PRK08594, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|169553 PRK08690, PRK08690, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181187 PRK07984, PRK07984, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180789 PRK06997, PRK06997, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|36414 KOG1200, KOG1200, KOG1200, Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181073 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181638 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36415 KOG1201, KOG1201, KOG1201, Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|143883 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|181298 PRK08219, PRK08219, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180299 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|39371 KOG4169, KOG4169, KOG4169, 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism, General function prediction only] Back     alignment and domain information
>gnl|CDD|36232 KOG1014, KOG1014, KOG1014, 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180879 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168279 PRK05866, PRK05866, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36422 KOG1208, KOG1208, KOG1208, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|36424 KOG1210, KOG1210, KOG1210, Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|33748 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|180844 PRK07109, PRK07109, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|36823 KOG1610, KOG1610, KOG1610, Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism, General function prediction only] Back     alignment and domain information
>gnl|CDD|180445 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180292 PRK05855, PRK05855, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180797 PRK07024, PRK07024, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181139 PRK07832, PRK07832, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|135637 PRK05876, PRK05876, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36418 KOG1204, KOG1204, KOG1204, Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|129055 smart00822, PKS_KR, This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>gnl|CDD|181349 PRK08278, PRK08278, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36824 KOG1611, KOG1611, KOG1611, Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|181198 PRK08017, PRK08017, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|168417 PRK06139, PRK06139, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180753 PRK06924, PRK06924, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36423 KOG1209, KOG1209, KOG1209, 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|180343 PRK05993, PRK05993, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|162393 TIGR01500, sepiapter_red, sepiapterin reductase Back     alignment and domain information
>gnl|CDD|181324 PRK08251, PRK08251, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180796 PRK07023, PRK07023, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181368 PRK08303, PRK08303, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180585 PRK06482, PRK06482, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180838 PRK07102, PRK07102, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|166421 PLN02780, PLN02780, ketoreductase/ oxidoreductase Back     alignment and domain information
>gnl|CDD|169257 PRK08177, PRK08177, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36691 KOG1478, KOG1478, KOG1478, 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181568 PRK08862, PRK08862, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|149646 pfam08659, KR, KR domain Back     alignment and domain information
>gnl|CDD|180460 PRK06196, PRK06196, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180291 PRK05854, PRK05854, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181126 PRK07806, PRK07806, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|30800 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|144821 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|183524 PRK12428, PRK12428, 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180766 PRK06940, PRK06940, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180973 PRK07424, PRK07424, bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180461 PRK06197, PRK06197, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180669 PRK06720, PRK06720, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184511 PRK14106, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|133446 cd01078, NAD_bind_H4MPT_DH, NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>gnl|CDD|36715 KOG1502, KOG1502, KOG1502, Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 247 3-ketoacyl-(acyl-carrier-protein) reductase [Candidatus
TIGR01830238 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reducta 100.0
PRK08213259 gluconate 5-dehydrogenase; Provisional 100.0
PRK06138252 short chain dehydrogenase; Provisional 100.0
PRK07478254 short chain dehydrogenase; Provisional 100.0
PRK06172253 short chain dehydrogenase; Provisional 100.0
PRK07063259 short chain dehydrogenase; Provisional 100.0
PRK06227256 consensus 100.0
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 100.0
PRK12935247 acetoacetyl-CoA reductase; Provisional 100.0
PRK07523251 gluconate 5-dehydrogenase; Provisional 100.0
PRK06841255 short chain dehydrogenase; Provisional 100.0
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK07097265 gluconate 5-dehydrogenase; Provisional 100.0
PRK06114262 short chain dehydrogenase; Provisional 100.0
PRK08277278 D-mannonate oxidoreductase; Provisional 100.0
PRK08085254 gluconate 5-dehydrogenase; Provisional 100.0
PRK12827251 short chain dehydrogenase; Provisional 100.0
PRK06124259 gluconate 5-dehydrogenase; Provisional 100.0
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 100.0
PRK07067256 sorbitol dehydrogenase; Provisional 100.0
PRK08226263 short chain dehydrogenase; Provisional 100.0
PRK12829264 short chain dehydrogenase; Provisional 100.0
PRK12939250 short chain dehydrogenase; Provisional 100.0
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 100.0
PRK05867253 short chain dehydrogenase; Provisional 100.0
PRK09242258 tropinone reductase; Provisional 100.0
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 100.0
PRK07576260 short chain dehydrogenase; Provisional 100.0
PRK07814263 short chain dehydrogenase; Provisional 100.0
PRK06346251 consensus 100.0
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 100.0
PRK08936261 glucose-1-dehydrogenase; Provisional 100.0
TIGR01829244 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR 100.0
PRK06484530 short chain dehydrogenase; Validated 100.0
PRK07774250 short chain dehydrogenase; Provisional 100.0
PRK08589272 short chain dehydrogenase; Validated 100.0
PRK08265261 short chain dehydrogenase; Provisional 100.0
PRK06949258 short chain dehydrogenase; Provisional 100.0
PRK12824245 acetoacetyl-CoA reductase; Provisional 100.0
PRK07776252 consensus 100.0
PRK07062265 short chain dehydrogenase; Provisional 100.0
PRK08643256 acetoin reductase; Validated 100.0
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 100.0
PRK12938246 acetyacetyl-CoA reductase; Provisional 100.0
PRK06057255 short chain dehydrogenase; Provisional 100.0
PRK05875277 short chain dehydrogenase; Provisional 100.0
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK06484 530 short chain dehydrogenase; Validated 100.0
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 100.0
PRK06198268 short chain dehydrogenase; Provisional 100.0
PRK07479252 consensus 100.0
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK06398256 aldose dehydrogenase; Validated 100.0
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK12743253 acetoin dehydrogenase; Provisional 100.0
PRK06500249 short chain dehydrogenase; Provisional 100.0
PRK12745259 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 100.0
PRK07890258 short chain dehydrogenase; Provisional 100.0
PRK06128300 oxidoreductase; Provisional 100.0
PRK12937245 short chain dehydrogenase; Provisional 100.0
PRK07831261 short chain dehydrogenase; Provisional 100.0
PRK07035252 short chain dehydrogenase; Provisional 100.0
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 100.0
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
TIGR01963258 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR01 100.0
PRK09135249 pteridine reductase; Provisional 100.0
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 100.0
PRK12746254 short chain dehydrogenase; Provisional 100.0
PRK06701289 short chain dehydrogenase; Provisional 100.0
PRK07677254 short chain dehydrogenase; Provisional 100.0
PRK12828239 short chain dehydrogenase; Provisional 100.0
PRK08339263 short chain dehydrogenase; Provisional 100.0
PRK07074256 short chain dehydrogenase; Provisional 100.0
PRK06463254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK08628258 short chain dehydrogenase; Provisional 100.0
PRK06550237 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07060245 short chain dehydrogenase; Provisional 100.0
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK12748257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 100.0
PRK06125259 short chain dehydrogenase; Provisional 100.0
PRK06947252 glucose-1-dehydrogenase; Provisional 100.0
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 100.0
PRK12859257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 100.0
PRK07069251 short chain dehydrogenase; Validated 100.0
PRK07856254 short chain dehydrogenase; Provisional 100.0
PRK05717255 oxidoreductase; Validated 100.0
PRK07985294 oxidoreductase; Provisional 100.0
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 100.0
PRK06123249 short chain dehydrogenase; Provisional 100.0
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 100.0
PRK07791285 short chain dehydrogenase; Provisional 100.0
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK09730247 hypothetical protein; Provisional 100.0
PRK08324676 short chain dehydrogenase; Validated 100.0
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 100.0
PRK08278273 short chain dehydrogenase; Provisional 100.0
PRK08261447 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK12747252 short chain dehydrogenase; Provisional 100.0
PRK06523260 short chain dehydrogenase; Provisional 100.0
PRK07707239 consensus 100.0
PRK09186255 flagellin modification protein A; Provisional 100.0
PRK06077249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK09134256 short chain dehydrogenase; Provisional 100.0
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK07792303 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07370259 enoyl-(acyl carrier protein) reductase; Validated 100.0
PRK07577234 short chain dehydrogenase; Provisional 100.0
TIGR02415258 23BDH acetoin reductases; InterPro: IPR014007 One membe 100.0
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 100.0
PRK07533254 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK12744257 short chain dehydrogenase; Provisional 100.0
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 100.0
PRK08340259 glucose-1-dehydrogenase; Provisional 100.0
PRK07454241 short chain dehydrogenase; Provisional 100.0
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 100.0
PRK08594256 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK07775275 short chain dehydrogenase; Provisional 100.0
PRK12742237 oxidoreductase; Provisional 100.0
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK08303305 short chain dehydrogenase; Provisional 100.0
PRK07041240 short chain dehydrogenase; Provisional 100.0
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK08945245 short chain dehydrogenase; Provisional 100.0
PRK06300298 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
KOG1200256 consensus 100.0
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK07806248 short chain dehydrogenase; Provisional 100.0
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisional 100.0
TIGR01832249 kduD 2-deoxy-D-gluconate 3-dehydrogenase; InterPro: IPR 100.0
PRK07326235 short chain dehydrogenase; Provisional 100.0
PRK08703239 short chain dehydrogenase; Provisional 100.0
PRK06483236 short chain dehydrogenase; Provisional 100.0
PRK10538248 3-hydroxy acid dehydrogenase; Provisional 100.0
KOG0725270 consensus 100.0
PRK06924251 short chain dehydrogenase; Provisional 100.0
PRK05872296 short chain dehydrogenase; Provisional 100.0
PRK06940277 short chain dehydrogenase; Provisional 100.0
PRK05866290 short chain dehydrogenase; Provisional 100.0
PRK05855582 short chain dehydrogenase; Validated 100.0
PRK07825273 short chain dehydrogenase; Provisional 100.0
PRK06181263 short chain dehydrogenase; Provisional 100.0
PRK06139324 short chain dehydrogenase; Provisional 100.0
PRK06194301 hypothetical protein; Provisional 100.0
PRK07023243 short chain dehydrogenase; Provisional 100.0
PRK08263275 short chain dehydrogenase; Provisional 100.0
PRK05876275 short chain dehydrogenase; Provisional 100.0
PRK08267258 short chain dehydrogenase; Provisional 100.0
PRK06180277 short chain dehydrogenase; Provisional 100.0
PRK07201663 short chain dehydrogenase; Provisional 100.0
PRK06914280 short chain dehydrogenase; Provisional 100.0
PRK06182273 short chain dehydrogenase; Validated 100.0
PRK05650270 short chain dehydrogenase; Provisional 100.0
PRK09072262 short chain dehydrogenase; Provisional 100.0
PRK12428261 3-alpha-hydroxysteroid dehydrogenase; Provisional 100.0
PRK06179270 short chain dehydrogenase; Provisional 100.0
TIGR02632709 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol 100.0
PRK08219226 short chain dehydrogenase; Provisional 100.0
PRK09291257 short chain dehydrogenase; Provisional 100.0
PRK08862227 short chain dehydrogenase; Provisional 100.0
PRK07109338 short chain dehydrogenase; Provisional 100.0
PRK07832272 short chain dehydrogenase; Provisional 100.0
PRK06482276 short chain dehydrogenase; Provisional 100.0
PRK05884223 short chain dehydrogenase; Provisional 100.0
PRK08264235 short chain dehydrogenase; Validated 100.0
PRK09009235 C factor cell-cell signaling protein; Provisional 100.0
COG4221246 Short-chain alcohol dehydrogenase of unknown specificit 100.0
PRK08251248 short chain dehydrogenase; Provisional 100.0
PRK05693274 short chain dehydrogenase; Provisional 100.0
PRK07024256 short chain dehydrogenase; Provisional 100.0
PRK05993277 short chain dehydrogenase; Provisional 100.0
PRK07578199 short chain dehydrogenase; Provisional 100.0
PRK07102243 short chain dehydrogenase; Provisional 100.0
PRK08017256 short chain dehydrogenase; Provisional 100.0
COG1028251 FabG Dehydrogenases with different specificities (relat 100.0
TIGR02685283 pter_reduc_Leis pteridine reductase; InterPro: IPR01405 100.0
PRK05599246 hypothetical protein; Provisional 100.0
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 100.0
KOG1207245 consensus 100.0
PRK07904253 short chain dehydrogenase; Provisional 100.0
PRK06101241 short chain dehydrogenase; Provisional 100.0
PRK08177225 short chain dehydrogenase; Provisional 100.0
PRK06196316 oxidoreductase; Provisional 100.0
KOG1199260 consensus 100.0
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, pu 100.0
PRK06953222 short chain dehydrogenase; Provisional 100.0
COG0623259 FabI Enoyl-[acyl-carrier-protein] 100.0
KOG4169261 consensus 100.0
PRK06197306 short chain dehydrogenase; Provisional 100.0
PRK05854314 short chain dehydrogenase; Provisional 100.0
KOG1208314 consensus 100.0
PRK07453322 protochlorophyllide oxidoreductase; Validated 100.0
KOG1210331 consensus 100.0
KOG1209289 consensus 100.0
pfam08643296 DUF1776 Fungal family of unknown function (DUF1776). Th 99.97
KOG1204253 consensus 99.97
TIGR01500267 sepiapter_red sepiapterin reductase; InterPro: IPR00639 99.94
PRK07424410 bifunctional sterol desaturase/short chain dehydrogenas 99.76
pfam02719280 Polysacc_synt_2 Polysaccharide biosynthesis protein. Th 99.75
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzy 99.69
pfam01073280 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase 99.66
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 99.64
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.63
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 99.62
PRK12367250 short chain dehydrogenase; Provisional 99.61
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.61
KOG1502327 consensus 99.59
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.58
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 99.58
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases [Cell 99.56
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 99.51
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell enve 99.48
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biog 99.33
CHL00194 319 ycf39 Ycf39; Provisional 99.33
TIGR01181340 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: 99.26
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisio 99.22
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 99.15
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.11
KOG4022236 consensus 99.11
KOG1430 361 consensus 99.05
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi 98.99
COG4982 866 3-oxoacyl-[acyl-carrier protein] 98.93
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G 98.81
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase 98.79
PRK07201 663 short chain dehydrogenase; Provisional 98.75
TIGR01214317 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005 98.74
TIGR01746 405 Thioester-redct thioester reductase domain; InterPro: I 98.57
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [Gener 98.24
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases [Cell 98.06
TIGR02197353 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; 98.06
TIGR01777307 yfcH conserved hypothetical protein TIGR01777; InterPro 97.96
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis 97.91
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.86
KOG2865 391 consensus 97.74
KOG1431315 consensus 97.6
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.54
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.52
KOG0747331 consensus 97.49
TIGR01472365 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368 Th 97.26
PRK07531 489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 97.25
PRK13771332 putative alcohol dehydrogenase; Provisional 97.24
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 97.14
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 97.12
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 96.71
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 96.15
PRK09422338 alcohol dehydrogenase; Provisional 96.09
PRK13982476 bifunctional SbtC-like/phosphopantothenoylcysteine deca 96.09
KOG1372376 consensus 95.72
PRK10083339 putative dehydrogenase; Provisional 94.38
KOG1196343 consensus 92.68
KOG1205282 consensus 100.0
KOG1201300 consensus 100.0
pfam08659181 KR KR domain. This enzymatic domain is part of bacteria 100.0
pfam00106167 adh_short short chain dehydrogenase. This family contai 100.0
smart00822180 PKS_KR This enzymatic domain is part of bacterial polyk 100.0
COG3967245 DltE Short-chain dehydrogenase involved in D-alanine es 100.0
KOG1610322 consensus 100.0
KOG1014312 consensus 100.0
KOG1611249 consensus 99.97
KOG1478341 consensus 99.83
TIGR01289321 LPOR light-dependent protochlorophyllide reductase; Int 99.79
TIGR01179341 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synon 99.28
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, 99.21
TIGR02813 2773 omega_3_PfaA polyketide-type polyunsaturated fatty acid 99.21
KOG1371