254780537

254780537

periplasmic solute binding protein

GeneID in NCBI database:8209533Locus tag:CLIBASIA_02120
Protein GI in NCBI database:254780537Protein Accession:YP_003064950.1
Gene range:-(742844, 743728)Protein Length:294aa
Gene description:periplasmic solute binding protein
COG prediction:[P] ABC-type metal ion transport system, periplasmic component/surface adhesin
KEGG prediction:periplasmic solute binding protein; K11604 manganese/iron transport system substrate-binding protein
SEED prediction:Manganese ABC transporter, periplasmic-binding protein SitA
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MLRYFICLLFSYIPMSASATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETNASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTLF
cHHHHHHHHHHHHHccccccccccEEEEEcHHHHHHHHHHcccccEEEEEcccccccccccccHHHHHHHHHccEEEEEccccHHHHHHHHHHccccccEEEEccccccccccccccccccccccEEEcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHHHHHHHc
cHHHHHHHHHHHHcccccccccccEEEEccHHHHHHHHHHHHHHcEEEEccccccccccccccHHHHHHHHHccEEEEcccccccccHHHHHHHccccEEEEHHHHcEEEEccccccccccEcccHHHcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHHHHHHHc
MLRYFICLLFsyipmsasattQKKVVLSSFSIIGDITQNIAKDLVTVTTLVeagndshsyqvTSADAIKIQNADLILCNGLHLEETYMKYFTNlkkgtkiitvtdginpigvsedtsvdsepnphawMSLTNAMIYIENIRKALtaldpsnakkyELNAREYSEKIRNSILPlktriekvdpekrwfvtseGCLVYLAedfgfkslylwpinsdserspsmMRHAINQMRSHKIKFifsestnsdqpakQVAYETNASYGGVlyvdslskpdgpaptylDLLRFSLTKIVDTLF
MLRYFICLLFSYIPMSASATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVsedtsvdsepNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNareysekirnsilplktriekvdpekrwFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETNASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTLF
MLRYFICLLFSYIPMSASATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETNASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTLF
*LRYFICLLFSYIPMS****TQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPI*********SEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETNASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTLF
MLRYFICLLFSYIPMSASATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSE*********QVAYETNASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTLF
MLRYFICLLFSYIPMSASATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETNASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTLF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MLRYFICLLFSYIPMSASATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETNASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTLF
MLRYFICLLFSYIPMSASATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETNASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTLF
MLRYFICLLFSYIPMSASATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETNASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTLF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target294 periplasmic solute binding protein [Candidatus Liberiba
254780717294 zinc uptake ABC transporter [Candidatus Liberibact 2e-09
254780981122 hypothetical protein CLIBASIA_04410 [Candidatus Li 0.040
>gi|254780717|ref|YP_003065130.1| zinc uptake ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 294 Back     alignment
 Score = 54.7 bits (130), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 115/263 (43%), Gaps = 10/263 (3%)

Query: 26  VLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEE 85
           V+ S   I  I   I + + T   LV+  +  H Y +  ++A+ ++NAD+I   G  +E 
Sbjct: 26  VVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEMES 85

Query: 86  TYMKYFTNLKKGTKIITVTDG--INPIGVSEDTS--VDSEPNP-HAWMSLTNAMIYIENI 140
             +K   +L K + ++T++    ++ I + ++ S   DSE +  H W++  N       I
Sbjct: 86  FLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSHFHDSEADDLHLWLNPLNVQYIAHVI 145

Query: 141 RKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEGCLVYLAED 200
              L   DP N   YE N  E+  ++      L + ++ V  EK+  +       Y A  
Sbjct: 146 AMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELHSILQPV--EKKKIIVFHEAYRYFASH 203

Query: 201 FGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETNASYG 260
           +   S+  +P++       + +R+  +++ S KI  +F       +  + +  +T     
Sbjct: 204 YNL-SIVTFPMSHSVFMGAASLRNIRSKIISDKISCLFYGPEFDSKIIRSITNDTGV-MS 261

Query: 261 GVLYVDSLSKPDGPAPTYLDLLR 283
            +L  + +   +GP   Y  L+R
Sbjct: 262 AILDPEGMLIAEGPE-LYFQLMR 283

>gi|254780981|ref|YP_003065394.1| hypothetical protein CLIBASIA_04410 [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Back     alignment
 Score = 30.4 bits (67), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 89  KYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIENIRKALTALD 148
           KYFT L     ++ V+  INP G+ ED ++ S P PH  +   +A    EN +K L+  +
Sbjct: 3   KYFTILT----MLFVSSAINPCGIEED-NLKSSPLPHIALESLSA----ENEKKELSEHE 53

Query: 149 PSNAKKYELNAREYSE 164
               +  E   +++SE
Sbjct: 54  KKVIESQENPKKQFSE 69

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target294 periplasmic solute binding protein [Candidatus Liberiba
315122866299 periplasmic solute binding protein [Candidatus Liberiba 1 1e-110
332717132296 iron ABC transporter, substrate binding protein [Agroba 1 1e-76
154245155324 periplasmic solute binding protein [Xanthobacter autotr 1 9e-76
37526563306 Iron (chelated) ABC transporter, periplasmic-binding pr 1 1e-75
283786717305 iron ABC transporter substrate-binding protein [Citroba 1 2e-75
253989344304 iron (chelated) ABC transporter periplasmic-binding pro 1 3e-75
170718287293 periplasmic solute binding protein [Haemophilus somnus 1 1e-74
113460474286 chelated iron ABC transporter periplasmic-binding prote 1 1e-74
159186177299 ABC transporter, substrate binding protein (iron) [Agro 1 3e-74
116253624310 iron ABC transporter substrate binding protein [Rhizobi 1 3e-74
>gi|315122866|ref|YP_004063355.1| periplasmic solute binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 299 Back     alignment and organism information
 Score =  401 bits (1030), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/297 (64%), Positives = 235/297 (79%), Gaps = 4/297 (1%)

Query: 1   MLRYFICLLFSYI---PMSASATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDS 57
           M R F  L F Y    P+S S   QKK+VLSSFS+I DIT+NIAK+LV  TT+V  GND+
Sbjct: 1   MFRCFSYLFFIYFMFFPISPSTAQQKKIVLSSFSVITDITKNIAKNLVVATTIVGPGNDA 60

Query: 58  HSYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTS 117
           H YQ+T++DAIKI+ ADLILCNGL LEE++MKYF NLKK TK+ITVTDGI PI +S++ +
Sbjct: 61  HEYQITASDAIKIKEADLILCNGLKLEESFMKYFVNLKKDTKLITVTDGITPISMSDNAN 120

Query: 118 VD-SEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTR 176
               +PNPH+W+S+ N  IYI+NI KAL  LDP NA++YE NA+EY +KI   +LPLK R
Sbjct: 121 DPYKDPNPHSWVSIKNVAIYIQNISKALKELDPGNAEEYERNAKEYIQKIEEVLLPLKDR 180

Query: 177 IEKVDPEKRWFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKF 236
           I+ + PEKRWFVTSEGCLVYLA D   K LYLWP+NS  ERSP  +R AINQ+R HKI+F
Sbjct: 181 IDNLSPEKRWFVTSEGCLVYLARDLNLKVLYLWPVNSAFERSPLKIRDAINQIRKHKIRF 240

Query: 237 IFSESTNSDQPAKQVAYETNASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTL 293
           IFSESTNSDQPAKQ+A +TNASYGGVLY+D++SK +GPAPTYLDLL+++LT I D L
Sbjct: 241 IFSESTNSDQPAKQIARDTNASYGGVLYIDTISKSNGPAPTYLDLLKYNLTLIADRL 297


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|332717132|ref|YP_004444598.1| iron ABC transporter, substrate binding protein [Agrobacterium sp. H13-3] Length = 296 Back     alignment and organism information
>gi|154245155|ref|YP_001416113.1| periplasmic solute binding protein [Xanthobacter autotrophicus Py2] Length = 324 Back     alignment and organism information
>gi|37526563|ref|NP_929907.1| Iron (chelated) ABC transporter, periplasmic-binding protein YfeA [Photorhabdus luminescens subsp. laumondii TTO1] Length = 306 Back     alignment and organism information
>gi|283786717|ref|YP_003366582.1| iron ABC transporter substrate-binding protein [Citrobacter rodentium ICC168] Length = 305 Back     alignment and organism information
>gi|253989344|ref|YP_003040700.1| iron (chelated) ABC transporter periplasmic-binding protein yfea [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949] Length = 304 Back     alignment and organism information
>gi|170718287|ref|YP_001783550.1| periplasmic solute binding protein [Haemophilus somnus 2336] Length = 293 Back     alignment and organism information
>gi|113460474|ref|YP_718536.1| chelated iron ABC transporter periplasmic-binding protein [Haemophilus somnus 129PT] Length = 286 Back     alignment and organism information
>gi|159186177|ref|NP_356186.2| ABC transporter, substrate binding protein (iron) [Agrobacterium tumefaciens str. C58] Length = 299 Back     alignment and organism information
>gi|116253624|ref|YP_769462.1| iron ABC transporter substrate binding protein [Rhizobium leguminosarum bv. viciae 3841] Length = 310 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target294 periplasmic solute binding protein [Candidatus Liberiba
COG0803303 COG0803, LraI, ABC-type metal ion transport system, per 8e-64
pfam01297272 pfam01297, SBP_bac_9, Periplasmic solute binding protei 9e-55
cd01017282 cd01017, AdcA, Metal binding protein AcdA 2e-37
cd01016276 cd01016, TroA, Metal binding protein TroA 3e-32
cd01019286 cd01019, ZnuA, Zinc binding protein ZnuA 7e-24
cd01137287 cd01137, PsaA, Metal binding protein PsaA 3e-82
cd01018266 cd01018, ZntC, Metal binding protein ZntC 2e-24
cd01020264 cd01020, TroA_b, Metal binding protein TroA_b 4e-18
cd01145203 cd01145, TroA_c, Periplasmic binding protein TroA_c 2e-16
cd00636148 cd00636, TroA-like, Helical backbone metal receptor (Tr 2e-04
COG4531318 COG4531, ZnuA, ABC-type Zn2+ transport system, periplas 4e-15
PRK09545311 PRK09545, znuA, high-affinity zinc transporter periplas 3e-07
TIGR03772479 TIGR03772, anch_rpt_subst, anchored repeat ABC transpor 1e-14
TIGR03772 479 TIGR03772, anch_rpt_subst, anchored repeat ABC transpor 8e-08
>gnl|CDD|31146 COG0803, LraI, ABC-type metal ion transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|144773 pfam01297, SBP_bac_9, Periplasmic solute binding protein family Back     alignment and domain information
>gnl|CDD|29736 cd01017, AdcA, Metal binding protein AcdA Back     alignment and domain information
>gnl|CDD|29735 cd01016, TroA, Metal binding protein TroA Back     alignment and domain information
>gnl|CDD|29738 cd01019, ZnuA, Zinc binding protein ZnuA Back     alignment and domain information
>gnl|CDD|29740 cd01137, PsaA, Metal binding protein PsaA Back     alignment and domain information
>gnl|CDD|29737 cd01018, ZntC, Metal binding protein ZntC Back     alignment and domain information
>gnl|CDD|29739 cd01020, TroA_b, Metal binding protein TroA_b Back     alignment and domain information
>gnl|CDD|29748 cd01145, TroA_c, Periplasmic binding protein TroA_c Back     alignment and domain information
>gnl|CDD|29734 cd00636, TroA-like, Helical backbone metal receptor (TroA-like domain) Back     alignment and domain information
>gnl|CDD|34180 COG4531, ZnuA, ABC-type Zn2+ transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|181940 PRK09545, znuA, high-affinity zinc transporter periplasmic component; Reviewed Back     alignment and domain information
>gnl|CDD|163484 TIGR03772, anch_rpt_subst, anchored repeat ABC transporter, substrate-binding protein Back     alignment and domain information
>gnl|CDD|163484 TIGR03772, anch_rpt_subst, anchored repeat ABC transporter, substrate-binding protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 294 periplasmic solute binding protein [Candidatus Liberiba
cd01137287 PsaA Metal binding protein PsaA. These proteins have be 100.0
cd01016276 TroA Metal binding protein TroA. These proteins have be 100.0
PRK09545308 znuA high-affinity zinc transporter periplasmic compone 100.0
cd01017282 AdcA Metal binding protein AcdA. These proteins have be 100.0
cd01019286 ZnuA Zinc binding protein ZnuA. These proteins have bee 100.0
COG0803303 LraI ABC-type metal ion transport system, periplasmic c 100.0
pfam01297272 SBP_bac_9 Periplasmic solute binding protein family. Th 100.0
cd01020264 TroA_b Metal binding protein TroA_b. These proteins are 100.0
cd01018266 ZntC Metal binding protein ZntC. These proteins are pre 100.0
COG4531318 ZnuA ABC-type Zn2+ transport system, periplasmic compon 100.0
TIGR03659289 IsdE heme ABC transporter, heme-binding protein isdE. T 93.76
cd01145203 TroA_c Periplasmic binding protein TroA_c. These protei 100.0
cd00636148 TroA-like Helical backbone metal receptor (TroA-like do 98.36
pfam00148398 Oxidored_nitro Nitrogenase component 1 type Oxidoreduct 94.94
>cd01137 PsaA Metal binding protein PsaA Back     alignment and domain information
>cd01016 TroA Metal binding protein TroA Back     alignment and domain information
>PRK09545 znuA high-affinity zinc transporter periplasmic component; Reviewed Back     alignment and domain information
>cd01017 AdcA Metal binding protein AcdA Back     alignment and domain information
>cd01019 ZnuA Zinc binding protein ZnuA Back     alignment and domain information
>COG0803 LraI ABC-type metal ion transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam01297 SBP_bac_9 Periplasmic solute binding protein family Back     alignment and domain information
>cd01020 TroA_b Metal binding protein TroA_b Back     alignment and domain information
>cd01018 ZntC Metal binding protein ZntC Back     alignment and domain information
>COG4531 ZnuA ABC-type Zn2+ transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03659 IsdE heme ABC transporter, heme-binding protein isdE Back     alignment and domain information
>cd01145 TroA_c Periplasmic binding protein TroA_c Back     alignment and domain information
>cd00636 TroA-like Helical backbone metal receptor (TroA-like domain) Back     alignment and domain information
>pfam00148 Oxidored_nitro Nitrogenase component 1 type Oxidoreductase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target294 periplasmic solute binding protein [Candidatus Liberiba
1psz_A303 Pneumococcal Surface Antigen Psaa Length = 303 2e-54
1xvl_A321 The Three-Dimensional Structure Of Mntc From Synech 3e-53
3hh8_A294 Crystal Structure And Metal Binding Properties Of T 7e-53
1toa_A313 Periplasmic Zinc Binding Protein Troa From Treponem 2e-45
2o1e_A312 Crystal Structure Of The Metal-Dependent Lipoprotei 9e-45
1k0f_A277 Crystal Structure Of Zn(Ii)-Free T. Pallidum Troa L 4e-44
3mfq_A282 A Glance Into The Metal Binding Specificity Of Troa 7e-40
3gi1_A286 Crystal Structure Of The Laminin-Binding Protein Lb 8e-40
3hjt_A287 Structure Of Laminin Binding Protein (Lmb) Of Strep 2e-37
3cx3_A284 Crystal Structure Analysis Of The Streptococcus Pne 3e-36
2xh8_A291 X-Ray Structure Of 119-141 Znua Deletion Mutant Fro 5e-33
2ov1_A260 Crystal Structure Of Apo Form Of Znua With Flexible 1e-32
2xqv_A288 The X-Ray Structure Of The Zn(Ii) Bound Znua From S 1e-31
2osv_A284 Crystal Structure Of Znua From E. Coli Length = 284 5e-31
1pq4_A291 Crystal Structure Of Znua Length = 291 7e-30
2ogw_A310 Structure Of Abc Type Zinc Transporter From E. Coli 1e-29
>gi|7767025|pdb|1PSZ|A Chain A, Pneumococcal Surface Antigen Psaa Length = 303 Back     alignment and structure
 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 91/281 (32%), Positives = 154/281 (54%), Gaps = 5/281 (1%)

Query: 18  SATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLIL 77
           + + QK  V+++ SII DIT+NIA D + + ++V  G D H Y+    D  K   ADLI 
Sbjct: 21  TTSGQKLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIF 80

Query: 78  CNGLHLE----ETYMKYFTNLKK-GTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTN 132
            NG++LE      + K   N KK   K          +   E  +   + +PHAW++L N
Sbjct: 81  YNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLEN 140

Query: 133 AMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEG 192
            +I+ +NI K L+A DP+N + YE N +EY++K+       K +  K+  EK+  VTSEG
Sbjct: 141 GIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEG 200

Query: 193 CLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVA 252
              Y ++ +G  S Y+W IN++ E +P  ++  + ++R  K+  +F ES+  D+P K V+
Sbjct: 201 AFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVS 260

Query: 253 YETNASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTL 293
            +TN      ++ DS+++      +Y  +++++L KI + L
Sbjct: 261 QDTNIPIYAQIFTDSIAEQGKEGDSYYSMMKYNLDKIAEGL 301


>gi|66360618|pdb|1XVL|A Chain A, The Three-Dimensional Structure Of Mntc From Synechocystis 6803 Length = 321 Back     alignment and structure
>gi|5542493|pdb|1TOA|A Chain A, Periplasmic Zinc Binding Protein Troa From Treponema Pallidum Length = 313 Back     alignment and structure
>gi|122921273|pdb|2O1E|A Chain A, Crystal Structure Of The Metal-Dependent Lipoprotein Ycdh From Bacillus Subtilis, Northeast Structural Genomics Target Sr583 Length = 312 Back     alignment and structure
>gi|20663982|pdb|1K0F|A Chain A, Crystal Structure Of Zn(Ii)-Free T. Pallidum Troa Length = 277 Back     alignment and structure
>gi|328877178|pdb|3MFQ|A Chain A, A Glance Into The Metal Binding Specificity Of Troa: Where Elaborate Behaviors Occur In The Active Center Length = 282 Back     alignment and structure
>gi|255311808|pdb|3GI1|A Chain A, Crystal Structure Of The Laminin-Binding Protein Lbp Of Streptococcus Pyogenes Length = 286 Back     alignment and structure
>gi|270047650|pdb|3HJT|A Chain A, Structure Of Laminin Binding Protein (Lmb) Of Streptococcus Agalactiae A Bifunctional Protein With Adhesin And Metal Transporting Activity Length = 287 Back     alignment and structure
>gi|195927500|pdb|3CX3|A Chain A, Crystal Structure Analysis Of The Streptococcus Pneumoniae Adcaii Protein Length = 284 Back     alignment and structure
>gi|330689298|pdb|2XH8|A Chain A, X-Ray Structure Of 119-141 Znua Deletion Mutant From Salmonella Enterica Length = 291 Back     alignment and structure
>gi|152149231|pdb|2OV1|A Chain A, Crystal Structure Of Apo Form Of Znua With Flexible Loop Deletion Length = 260 Back     alignment and structure
>gi|330689303|pdb|2XQV|A Chain A, The X-Ray Structure Of The Zn(Ii) Bound Znua From Salmonella Enterica Length = 288 Back     alignment and structure
>gi|146387330|pdb|2OSV|A Chain A, Crystal Structure Of Znua From E. Coli Length = 284 Back     alignment and structure
>gi|38492833|pdb|1PQ4|A Chain A, Crystal Structure Of Znua Length = 291 Back     alignment and structure
>gi|134105166|pdb|2OGW|A Chain A, Structure Of Abc Type Zinc Transporter From E. Coli Length = 310 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target294 periplasmic solute binding protein [Candidatus Liberiba
3hh8_A294 Metal ABC transporter substrate-binding lipoprotein; me 2e-55
1xvl_A321 Mn transporter, MNTC protein; manganese, ABC-type trans 2e-52
3gi1_A286 LBP, laminin-binding protein of group A streptococci; z 3e-48
1pq4_A291 Periplasmic binding protein component of AN ABC type zi 9e-47
1toa_A313 Tromp-1, protein (periplasmic binding protein TROA); zi 8e-46
2o1e_A312 YCDH; alpha-beta protein, structural genomics, PSI-2, p 1e-43
3cx3_A284 Lipoprotein; zinc-binding, transport, lipid binding pro 1e-39
2prs_A284 High-affinity zinc uptake system protein ZNUA; protein 1e-38
>1xvl_A Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP} SCOP: c.92.2.2 Length = 321 Back     alignment and structure
>3gi1_A LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_A Length = 286 Back     alignment and structure
>1pq4_A Periplasmic binding protein component of AN ABC type zinc uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP} SCOP: c.92.2.2 PDB: 2ov3_A 2ov1_A Length = 291 Back     alignment and structure
>1toa_A Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC transporter; 1.80A {Treponema pallidum} SCOP: c.92.2.2 PDB: 1k0f_A Length = 313 Back     alignment and structure
>2o1e_A YCDH; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.60A {Bacillus subtilis} Length = 312 Back     alignment and structure
>3cx3_A Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae} Length = 284 Back     alignment and structure
>2prs_A High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_A Length = 284 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target294 periplasmic solute binding protein [Candidatus Liberiba
1xvl_A321 Mn transporter, MNTC protein; manganese, ABC-type trans 100.0
1toa_A313 Tromp-1, protein (periplasmic binding protein TROA); zi 100.0
3hh8_A294 Metal ABC transporter substrate-binding lipoprotein; me 100.0
2o1e_A312 YCDH; alpha-beta protein, structural genomics, PSI-2, p 100.0
3gi1_A286 LBP, laminin-binding protein of group A streptococci; z 100.0
3cx3_A284 Lipoprotein; zinc-binding, transport, lipid binding pro 100.0
1pq4_A291 Periplasmic binding protein component of AN ABC type zi 100.0
2prs_A284 High-affinity zinc uptake system protein ZNUA; protein 100.0
>1xvl_A Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP} SCOP: c.92.2.2 Back     alignment and structure
Probab=100.00  E-value=0  Score=474.63  Aligned_cols=272  Identities=42%  Similarity=0.771  Sum_probs=253.8

Q ss_pred             CCCCCEEEEECHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCCC
Q ss_conf             35882899975289999998518914899962688980120227124577603789999887610689999974235575
Q gi|254780537|r   20 TTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTK   99 (294)
Q Consensus        20 ~~~~~~Vv~s~~pl~~iv~~I~gd~v~V~~li~~g~dpH~ye~tp~d~~~i~~Adliv~~G~~~E~~~~~~~~~~~~~~~   99 (294)
                      ..++++||||++||+|+|++|+||+|+|++|+|+|.|||+|+|+|+|+++|++||+|||||.+||+|+.+++.+... ..
T Consensus        42 ~~~~~~VVaT~~~l~d~a~~I~Gd~v~V~~lvp~g~dPH~yep~p~d~~~l~~ADlvv~~G~~~E~~l~~~~~~~~~-~~  120 (321)
T 1xvl_A           42 TEEKKKVLTTFTVLADMVQNVAGDKLVVESITRIGAEIHGYEPTPSDIVKAQDADLILYNGMNLERWFEQFLGNVKD-VP  120 (321)
T ss_dssp             CCCCCEEEESSHHHHHHHHHHHTTTSEEEESSCSSCCCSSCCCCHHHHHHHHTCSEEEECCTTSSTTHHHHHHTSSS-CC
T ss_pred             CCCCCEEEEECHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCHHHHHHHHCCCEEEEECCCHHHHHHHHHHHCCC-CC
T ss_conf             78986899987499999999818826999806999795467689999999966999999488507899999863566-64


Q ss_pred             CCCCCCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHC
Q ss_conf             21112374202221001233463011122135678999999999864318889999998998630145533789988630
Q gi|254780537|r  100 IITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEK  179 (294)
Q Consensus       100 ~i~~~~~i~~~~~~~~~~~~~~~dpH~Wldp~~~~~~a~~I~~~L~~~dP~~~~~y~~N~~~~~~~l~~l~~~~~~~~~~  179 (294)
                      ++.+.+++...... ++++++..|||+|+||.|++.++++|++.|+++||+++++|++|+++|.++|++++.+++..+++
T Consensus       121 ~~~~~~~~~~~~~~-~~~~~~~~dPH~Wldp~~~~~~a~~I~~~L~~~dP~~~~~y~~n~~~~~~~l~~l~~~~~~~l~~  199 (321)
T 1xvl_A          121 SVVLTEGIEPIPIA-DGPYTDKPNPHAWMSPRNALVYVENIRQAFVELDPDNAKYYNANAAVYSEQLKAIDRQLGADLEQ  199 (321)
T ss_dssp             EEETTTTCCCCBCC-SSSSTTSBCCCGGGSHHHHHHHHHHHHHHHHHHCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             EEEEECCCCCCCCC-CCCCCCCCCCEEECCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             26750465665545-67764467750505999999999999999987684214789999999999999999999999730


Q ss_pred             CCCCCCEEEEECCCCHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHCCCE
Q ss_conf             78447369982665214577529728872268864000789999999762016971899827899799999999829934
Q gi|254780537|r  180 VDPEKRWFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETNASY  259 (294)
Q Consensus       180 ~p~~~~~~v~~H~af~Y~~~~yGl~~~~~~~~~~~~eps~~~l~~~~~~ik~~~v~~if~e~~~~~~~~~~ia~e~~~~~  259 (294)
                      +|.++|.|+++|++|+||+++|||++.++...+++.+|||++|+++++.||+++|+|||+|++.+++.++.|++++++++
T Consensus       200 ~~~~~~~~v~~H~af~Y~~~~ygl~~~~~~~~~~~~eps~~~l~~l~~~ik~~~v~~if~e~~~~~~~~~~la~e~~~~~  279 (321)
T 1xvl_A          200 VPANQRFLVSCEGAFSYLARDYGMEEIYMWPINAEQQFTPKQVQTVIEEVKTNNVPTIFCESTVSDKGQKQVAQATGARF  279 (321)
T ss_dssp             SCGGGCEEEEEESTTHHHHHHTTCEEEEEESSSSSCSCCHHHHHHHHHHHHTTTCSEEEEETTSCSHHHHHHHTTTCCEE
T ss_pred             CCCCCCEEEEECCHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHCCCC
T ss_conf             56666179982717899999869936751365775667899999999999864983899728989499999999859971


Q ss_pred             EEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             4432012378777886899999999999998620
Q gi|254780537|r  260 GGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTL  293 (294)
Q Consensus       260 ~~~~~~d~l~~~~~~~~~Y~~~m~~N~~~l~~aL  293 (294)
                      ...+++|+|+..++++++|++||++|+++|++||
T Consensus       280 ~~~~~~d~l~~~~~~~~~Y~~~m~~N~~~l~~aL  313 (321)
T 1xvl_A          280 GGNLYVDSLSTEEGPVPTFLDLLEYDARVITNGL  313 (321)
T ss_dssp             EEEECSSCCCCSSSSCCSHHHHHHHHHHHHHTTS
T ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             3632103688889886789999999999999997



>1toa_A Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC transporter; 1.80A {Treponema pallidum} SCOP: c.92.2.2 PDB: 1k0f_A Back     alignment and structure
>2o1e_A YCDH; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.60A {Bacillus subtilis} Back     alignment and structure
>3gi1_A LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_A Back     alignment and structure
>3cx3_A Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae} Back     alignment and structure
>1pq4_A Periplasmic binding protein component of AN ABC type zinc uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP} SCOP: c.92.2.2 PDB: 2ov3_A 2ov1_A Back     alignment and structure
>2prs_A High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 294 periplasmic solute binding protein [Candidatus Liberiba
d1xvla1279 c.92.2.2 (A:49-327) Mn transporter MntC {Synechocystis 1e-49
d1psza_286 c.92.2.2 (A:) Pneumococcal surface antigen PssA {Pneumo 4e-47
d1toaa_277 c.92.2.2 (A:) Periplasmic zinc binding protein TroA {Tr 1e-44
d1pq4a_289 c.92.2.2 (A:) Periplasmic zinc binding protein ZnuA {Sy 2e-37
>d1xvla1 c.92.2.2 (A:49-327) Mn transporter MntC {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 279 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Chelatase-like
superfamily: "Helical backbone" metal receptor
family: TroA-like
domain: Mn transporter MntC
species: Synechocystis sp. pcc 6803 [TaxId: 1148]
 Score =  190 bits (484), Expect = 1e-49
 Identities = 114/274 (41%), Positives = 177/274 (64%), Gaps = 2/274 (0%)

Query: 20  TTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCN 79
           T +KK VL++F+++ D+ QN+A D + V ++   G + H Y+ T +D +K Q+ADLIL N
Sbjct: 3   TEEKKKVLTTFTVLADMVQNVAGDKLVVESITRIGAEIHGYEPTPSDIVKAQDADLILYN 62

Query: 80  GLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIEN 139
           G++LE  + ++  N+K     + +T+GI PI +++      +PNPHAWMS  NA++Y+EN
Sbjct: 63  GMNLERWFEQFLGNVKD-VPSVVLTEGIEPIPIADGP-YTDKPNPHAWMSPRNALVYVEN 120

Query: 140 IRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEGCLVYLAE 199
           IR+A   LDP NAK Y  NA  YSE+++     L   +E+V   +R+ V+ EG   YLA 
Sbjct: 121 IRQAFVELDPDNAKYYNANAAVYSEQLKAIDRQLGADLEQVPANQRFLVSCEGAFSYLAR 180

Query: 200 DFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETNASY 259
           D+G + +Y+WPIN++ + +P  ++  I +++++ +  IF EST SD+  KQVA  T A +
Sbjct: 181 DYGMEEIYMWPINAEQQFTPKQVQTVIEEVKTNNVPTIFCESTVSDKGQKQVAQATGARF 240

Query: 260 GGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTL 293
           GG LYVDSLS  +GP PT+LDLL +    I + L
Sbjct: 241 GGNLYVDSLSTEEGPVPTFLDLLEYDARVITNGL 274


>d1psza_ c.92.2.2 (A:) Pneumococcal surface antigen PssA {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} Length = 286 Back     information, alignment and structure
>d1toaa_ c.92.2.2 (A:) Periplasmic zinc binding protein TroA {Treponema pallidum [TaxId: 160]} Length = 277 Back     information, alignment and structure
>d1pq4a_ c.92.2.2 (A:) Periplasmic zinc binding protein ZnuA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 289 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target294 periplasmic solute binding protein [Candidatus Liberiba
d1xvla1279 Mn transporter MntC {Synechocystis sp. pcc 6803 [TaxId: 100.0
d1psza_286 Pneumococcal surface antigen PssA {Pneumococcus (Strept 100.0
d1toaa_277 Periplasmic zinc binding protein TroA {Treponema pallid 100.0
d1pq4a_289 Periplasmic zinc binding protein ZnuA {Synechocystis sp 100.0
>d1xvla1 c.92.2.2 (A:49-327) Mn transporter MntC {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Chelatase-like
superfamily: "Helical backbone" metal receptor
family: TroA-like
domain: Mn transporter MntC
species: Synechocystis sp. pcc 6803 [TaxId: 1148]
Probab=100.00  E-value=0  Score=477.09  Aligned_cols=274  Identities=42%  Similarity=0.761  Sum_probs=253.5

Q ss_pred             CCCCCCEEEEECHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCC
Q ss_conf             33588289997528999999851891489996268898012022712457760378999988761068999997423557
Q gi|254780537|r   19 ATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGT   98 (294)
Q Consensus        19 ~~~~~~~Vv~s~~pl~~iv~~I~gd~v~V~~li~~g~dpH~ye~tp~d~~~i~~Adliv~~G~~~E~~~~~~~~~~~~~~   98 (294)
                      .+.+|++||||++||+++|++|+||+++|++|+|+|.|||+|+|+|+|+++|++|||||+||.+||+|+.+++.+... .
T Consensus         2 ~~~~k~~Vvas~~~l~~iv~~I~Gd~~~V~~l~p~~~dPH~y~~~p~d~~~l~~ADliv~~G~~lE~~l~~~~~~~~~-~   80 (279)
T d1xvla1           2 ETEEKKKVLTTFTVLADMVQNVAGDKLVVESITRIGAEIHGYEPTPSDIVKAQDADLILYNGMNLERWFEQFLGNVKD-V   80 (279)
T ss_dssp             CCCCCCEEEESSHHHHHHHHHHHTTTSEEEESSCSSCCCSSCCCCHHHHHHHHTCSEEEECCTTSSTTHHHHHHTSSS-C
T ss_pred             CCCCCCEEEEECHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHCCEEEECCCCCCHHHHHHHHHCCC-C
T ss_conf             988886799987699999999818844899806989796457689999999973999999799851889998764135-5


Q ss_pred             CCCCCCCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             52111237420222100123346301112213567899999999986431888999999899863014553378998863
Q gi|254780537|r   99 KIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIE  178 (294)
Q Consensus        99 ~~i~~~~~i~~~~~~~~~~~~~~~dpH~Wldp~~~~~~a~~I~~~L~~~dP~~~~~y~~N~~~~~~~l~~l~~~~~~~~~  178 (294)
                      .++.+.++..... ..++++|++.|||+||||.|++.++++|++.|+++||+|+++|++|+++|.++|++++.+++..++
T Consensus        81 ~~~~~~~~~~~~~-~~~~~~~~~~dpH~Wldp~~~~~~a~~Ia~~L~~~dP~~~~~y~~n~~~~~~~l~~l~~~~~~~l~  159 (279)
T d1xvla1          81 PSVVLTEGIEPIP-IADGPYTDKPNPHAWMSPRNALVYVENIRQAFVELDPDNAKYYNANAAVYSEQLKAIDRQLGADLE  159 (279)
T ss_dssp             CEEETTTTCCCCB-CCSSSSTTSBCCCGGGSHHHHHHHHHHHHHHHHHHCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCEECCCCCCCC-CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             4211103545655-445555456774211176889999999999998758554467999899774005665799999996


Q ss_pred             CCCCCCCEEEEECCCCHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHCCC
Q ss_conf             07844736998266521457752972887226886400078999999976201697189982789979999999982993
Q gi|254780537|r  179 KVDPEKRWFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETNAS  258 (294)
Q Consensus       179 ~~p~~~~~~v~~H~af~Y~~~~yGl~~~~~~~~~~~~eps~~~l~~~~~~ik~~~v~~if~e~~~~~~~~~~ia~e~~~~  258 (294)
                      ++|.+++.|+++|++|+||+++|||+++++...+++.+|||++|+++++.||+++|+|||+|++++++.++.|+++++++
T Consensus       160 ~~~~~~~~~v~~H~a~~Yf~~~~gl~~~~~~~~~~~~~ps~~~l~~l~~~ik~~~v~~if~e~~~~~~~~~~ia~~~~~~  239 (279)
T d1xvla1         160 QVPANQRFLVSCEGAFSYLARDYGMEEIYMWPINAEQQFTPKQVQTVIEEVKTNNVPTIFCESTVSDKGQKQVAQATGAR  239 (279)
T ss_dssp             TSCGGGCEEEEEESTTHHHHHHTTCEEEEEESSSSSCSCCHHHHHHHHHHHHTTTCSEEEEETTSCSHHHHHHHTTTCCE
T ss_pred             HCCCCCCEEEEECCCCHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHCCC
T ss_conf             18865528999545301356636962663025688566898899999999875486189824778829999999984997


Q ss_pred             EEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             444320123787778868999999999999986209
Q gi|254780537|r  259 YGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTLF  294 (294)
Q Consensus       259 ~~~~~~~d~l~~~~~~~~~Y~~~m~~N~~~l~~aL~  294 (294)
                      ++..+++|+|+...+++++|++||+.|+++|.+||-
T Consensus       240 ~~~~~~~d~l~~~~~~~~tY~~~m~~n~~~i~~aL~  275 (279)
T d1xvla1         240 FGGNLYVDSLSTEEGPVPTFLDLLEYDARVITNGLL  275 (279)
T ss_dssp             EEEEECSSCCCCSSSSCCSHHHHHHHHHHHHHTTSS
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             045222036888898866799999999999999964



>d1psza_ c.92.2.2 (A:) Pneumococcal surface antigen PssA {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} Back     information, alignment and structure
>d1toaa_ c.92.2.2 (A:) Periplasmic zinc binding protein TroA {Treponema pallidum [TaxId: 160]} Back     information, alignment and structure
>d1pq4a_ c.92.2.2 (A:) Periplasmic zinc binding protein ZnuA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 294 periplasmic solute binding protein [Candidatus Lib
1pq4_A_1-188_271-291209 (A:1-188,A:271-291) Periplasmic binding protein co 2e-32
1xvl_A_1-201_292-321231 (A:1-201,A:292-321) Mn transporter, MNTC protein; 1e-31
2o1e_A_1-189_284-312218 (A:1-189,A:284-312) YCDH; alpha-beta protein, stru 4e-31
3cx3_A_1-176_262-284199 (A:1-176,A:262-284) Lipoprotein; zinc-binding, tra 4e-31
3hh8_A_1-179179 (A:1-179) Metal ABC transporter substrate-binding 2e-27
3gi1_A_1-177177 (A:1-177) LBP, laminin-binding protein of group A 5e-27
2prs_A_1-172172 (A:1-172) High-affinity zinc uptake system protein 2e-25
1toa_A_1-195195 (A:1-195) Tromp-1, protein (periplasmic binding pr 2e-24
3hh8_A_180-294115 (A:180-294) Metal ABC transporter substrate-bindin 2e-25
1toa_A_196-313118 (A:196-313) Tromp-1, protein (periplasmic binding 9e-23
3gi1_A_178-286109 (A:178-286) LBP, laminin-binding protein of group 3e-22
2prs_A_173-284112 (A:173-284) High-affinity zinc uptake system prote 2e-21
1xvl_A_202-29190 (A:202-291) Mn transporter, MNTC protein; manganes 4e-19
2o1e_A_190-27182 (A:190-271) YCDH; alpha-beta protein, structural g 8e-17
1pq4_A_189-27082 (A:189-270) Periplasmic binding protein component 9e-17
3cx3_A_177-26185 (A:177-261) Lipoprotein; zinc-binding, transport, 3e-16
>1pq4_A (A:1-188,A:271-291) Periplasmic binding protein component of AN ABC type zinc uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP}Length = 209 Back     alignment and structure
 Score =  134 bits (337), Expect = 2e-32
 Identities = 37/187 (19%), Positives = 62/187 (33%), Gaps = 29/187 (15%)

Query: 23  KKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLH 82
              +  S        + I  DLV V+ LV   ND H+Y+        +  A+  +  GL 
Sbjct: 2   AMDITVSIPPQQYFLEKIGGDLVRVSVLVPGNNDPHTYEPKPQQLAALSEAEAYVLIGLG 61

Query: 83  LEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVD----------------------- 119
            E+ +++         K+I    GI P+ + +                            
Sbjct: 62  FEQPWLEKLKAANANMKLIDSAQGITPLEMEKHDHSHGEEEGHDDHSHDGHDHGSESEKE 121

Query: 120 ------SEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPL 173
                    +PH W+S T        I K L  LDP N  +YE N   +  ++      L
Sbjct: 122 KAKGALMVADPHIWLSPTLVKRQATTIAKELAELDPDNRDQYEANLAAFLAELERLNQEL 181

Query: 174 KTRIEKV 180
              ++ +
Sbjct: 182 GQILQPL 188


>1xvl_A (A:1-201,A:292-321) Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP}Length = 231 Back     alignment and structure
>2o1e_A (A:1-189,A:284-312) YCDH; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.60A {Bacillus subtilis}Length = 218 Back     alignment and structure
>3cx3_A (A:1-176,A:262-284) Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae}Length = 199 Back     alignment and structure
>3gi1_A (A:1-177) LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_ALength = 177 Back     alignment and structure
>2prs_A (A:1-172) High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_ALength = 172 Back     alignment and structure
>1toa_A (A:1-195) Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC transporter; 1.80A {Treponema pallidum}Length = 195 Back     alignment and structure
>1toa_A (A:196-313) Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC transporter; 1.80A {Treponema pallidum}Length = 118 Back     alignment and structure
>3gi1_A (A:178-286) LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_ALength = 109 Back     alignment and structure
>2prs_A (A:173-284) High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_ALength = 112 Back     alignment and structure
>1xvl_A (A:202-291) Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP}Length = 90 Back     alignment and structure
>2o1e_A (A:190-271) YCDH; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.60A {Bacillus subtilis}Length = 82 Back     alignment and structure
>1pq4_A (A:189-270) Periplasmic binding protein component of AN ABC type zinc uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP}Length = 82 Back     alignment and structure
>3cx3_A (A:177-261) Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae}Length = 85 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target294 periplasmic solute binding protein [Candidatus Liberiba
1xvl_A_1-201_292-321231 Mn transporter, MNTC protein; manganese, ABC-type 100.0
1pq4_A_1-188_271-291209 Periplasmic binding protein component of AN ABC ty 100.0
1toa_A_1-195195 Tromp-1, protein (periplasmic binding protein TROA 100.0
2o1e_A_1-189_284-312218 YCDH; alpha-beta protein, structural genomics, PSI 100.0
3hh8_A_1-179179 Metal ABC transporter substrate-binding lipoprotei 100.0
3cx3_A_1-176_262-284199 Lipoprotein; zinc-binding, transport, lipid bindin 100.0
2prs_A_1-172172 High-affinity zinc uptake system protein ZNUA; pro 100.0
3gi1_A_1-177177 LBP, laminin-binding protein of group A streptococ 100.0
3hh8_A_180-294115 Metal ABC transporter substrate-binding lipoprotei 99.91
1toa_A_196-313118 Tromp-1, protein (periplasmic binding protein TROA 99.89
3gi1_A_178-286109 LBP, laminin-binding protein of group A streptococ 99.89
2prs_A_173-284112 High-affinity zinc uptake system protein ZNUA; pro 99.86
1xvl_A_202-29190 Mn transporter, MNTC protein; manganese, ABC-type 99.77
2o1e_A_190-27182 YCDH; alpha-beta protein, structural genomics, PSI 99.72
1pq4_A_189-27082 Periplasmic binding protein component of AN ABC ty 99.7
3cx3_A_177-26185 Lipoprotein; zinc-binding, transport, lipid bindin 99.7
>1xvl_A (A:1-201,A:292-321) Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP} Back     alignment and structure
Probab=100.00  E-value=1.3e-41  Score=300.77  Aligned_cols=176  Identities=40%  Similarity=0.653  Sum_probs=154.8

Q ss_pred             CCCCCEEEEECHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCCC
Q ss_conf             35882899975289999998518914899962688980120227124577603789999887610689999974235575
Q gi|254780537|r   20 TTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTK   99 (294)
Q Consensus        20 ~~~~~~Vv~s~~pl~~iv~~I~gd~v~V~~li~~g~dpH~ye~tp~d~~~i~~Adliv~~G~~~E~~~~~~~~~~~~~~~   99 (294)
                      .+++++||||++|+++++++|+||+++|++|+|+|.|||+|||+|+|+++|++||+|||||.+||+|+.+++.+. ++..
T Consensus        42 ~~~~l~VvaT~~pl~~~vk~IaGd~v~V~~Li~~g~dPH~yeptp~d~~~i~~ADlii~~G~~~e~~l~~~~~~~-~~~~  120 (231)
T 1xvl_A           42 TEEKKKVLTTFTVLADMVQNVAGDKLVVESITRIGAEIHGYEPTPSDIVKAQDADLILYNGMNLERWFEQFLGNV-KDVP  120 (231)
T ss_dssp             CCCCCEEEESSHHHHHHHHHHHTTTSEEEESSCSSCCCSSCCCCHHHHHHHHTCSEEEECCTTSSTTHHHHHHTS-SSCC
T ss_pred             CCCCCEEEEECHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCHHHHHHHHCCCEEEECCCCCCHHHHHHHHHC-CCCC
T ss_conf             789858999775999999998088269998269897953576899999999669999995997308999987633-4554


Q ss_pred             CCCCCCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHC
Q ss_conf             21112374202221001233463011122135678999999999864318889999998998630145533789988630
Q gi|254780537|r  100 IITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEK  179 (294)
Q Consensus       100 ~i~~~~~i~~~~~~~~~~~~~~~dpH~Wldp~~~~~~a~~I~~~L~~~dP~~~~~y~~N~~~~~~~l~~l~~~~~~~~~~  179 (294)
                      ++.+++++......+ +++|++.|||+|+||.|++.++++|++.|+++||+++++|++|+++|.++|++|+.+++..+++
T Consensus       121 ~i~~~~~~~~~~~~~-~~~~~~~dPH~Wldp~~~~~~a~~I~~~L~~~dP~~~~~y~~N~~~~~~~L~~l~~~~~~~~~~  199 (231)
T 1xvl_A          121 SVVLTEGIEPIPIAD-GPYTDKPNPHAWMSPRNALVYVENIRQAFVELDPDNAKYYNANAAVYSEQLKAIDRQLGADLEQ  199 (231)
T ss_dssp             EEETTTTCCCCBCCS-SSSTTSBCCCGGGSHHHHHHHHHHHHHHHHHHCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             CEEECCCCCCCCCCC-CCCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             201113545554346-7653567611101658899999999999876380125799999999997788889999987642


Q ss_pred             CCCCCCEEEEECCCCHHHHH
Q ss_conf             78447369982665214577
Q gi|254780537|r  180 VDPEKRWFVTSEGCLVYLAE  199 (294)
Q Consensus       180 ~p~~~~~~v~~H~af~Y~~~  199 (294)
                      +|.+  .+-++-+-+.|=+|
T Consensus       200 i~~~--~~~~~~~~~~~~~~  217 (231)
T 1xvl_A          200 VPEG--PVPTFLDLLEYDAR  217 (231)
T ss_dssp             SCSS--SCCSHHHHHHHHHH
T ss_pred             CCCC--CCCCHHHHHHHHHH
T ss_conf             7798--86779999999999



>1pq4_A (A:1-188,A:271-291) Periplasmic binding protein component of AN ABC type zinc uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP} Back     alignment and structure
>1toa_A (A:1-195) Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC transporter; 1.80A {Treponema pallidum} Back     alignment and structure
>2o1e_A (A:1-189,A:284-312) YCDH; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.60A {Bacillus subtilis} Back     alignment and structure
>3cx3_A (A:1-176,A:262-284) Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae} Back     alignment and structure
>2prs_A (A:1-172) High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_A Back     alignment and structure
>3gi1_A (A:1-177) LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_A Back     alignment and structure
>1toa_A (A:196-313) Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC transporter; 1.80A {Treponema pallidum} Back     alignment and structure
>3gi1_A (A:178-286) LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_A Back     alignment and structure
>2prs_A (A:173-284) High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_A Back     alignment and structure
>1xvl_A (A:202-291) Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP} Back     alignment and structure
>2o1e_A (A:190-271) YCDH; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.60A {Bacillus subtilis} Back     alignment and structure
>1pq4_A (A:189-270) Periplasmic binding protein component of AN ABC type zinc uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP} Back     alignment and structure
>3cx3_A (A:177-261) Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae} Back     alignment and structure