254780536

254780536

acyl-carrier-protein S-malonyltransferase

GeneID in NCBI database:8209532Locus tag:CLIBASIA_02115
Protein GI in NCBI database:254780536Protein Accession:YP_003064949.1
Gene range:+(744229, 745173)Protein Length:314aa
Gene description:acyl-carrier-protein S-malonyltransferase
COG prediction:[I] (acyl-carrier-protein) S-malonyltransferase
KEGG prediction:acyl-carrier-protein S-malonyltransferase; K00645 [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
SEED prediction:Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39)
Pathway involved in KEGG:Fatty acid biosynthesis [PATH:las00061]
Subsystem involved in SEED:Fatty Acid Biosynthesis FASII
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSIVG
cEEEEEEccccccHHHHHHHHHHHcHHHHHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHcccccEEEEEEEcccccEEEEccHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHcccccccccEEEEcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHccccccEEcccHHHHHHHHHHHcc
ccEEEEEcccccccccccHHHHHHcHHHHHHHHHHHHHHcccHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHcccccEEEEEEEEccEEEEEEEHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHccccccccccEEccccccEcccHHHHHHHHHHHHHccEEHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEcccHHHHHHHcHHHcc
mstvltfpgqgsqvigmgrdlydsfpeARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNglcvkrdisyvagHSLGEYTALCAAKAFSLSDTIRLVRARGKsmqeavppglGSMVAIIGLDDCVVDSICAQASRVGIceiandngggqVVISGLQDAVKCAADTclnkgakravflpvsapfhsslmtpVSKVMKWMLDsvtkqdpvvpilpnfcaspvssiDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDkslsavsiskvEDIDLALRSIVG
mstvltfpgqgsqvigmGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKsmqeavppgLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETIQWfanhgvksvyeVGSGKVLTGLAKRidkslsavsiskvedidlalrsivg
MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSIVG
MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSIVG
MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSIVG
MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSIV*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSIVG
MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSIVG
MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSIVG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target314 acyl-carrier-protein S-malonyltransferase [Candidatus L
315122865314 acyl-carrier-protein S-malonyltransferase [Candidatus L 1 1e-155
307322235314 malonyl CoA-acyl carrier protein transacylase [Sinorhiz 1 1e-111
15964894314 acyl-carrier-protein S-malonyltransferase [Sinorhizobiu 1 1e-110
307300965314 malonyl CoA-acyl carrier protein transacylase [Sinorhiz 1 1e-110
209548659314 malonyl CoA-acyl carrier protein transacylase [Rhizobiu 1 1e-109
222085441313 malonyl CoA-acyl carrier protein transacylase [Agrobact 1 1e-108
227821463314 malonyl-CoA:acyl carrier protein transacylase [Sinorhiz 1 1e-107
325292473314 malonyl-CoA:acyl carrier protein transacylase [Agrobact 1 1e-107
150395968314 malonyl CoA-acyl carrier protein transacylase [Sinorhiz 1 1e-107
116251323314 malonyl CoA-acyl carrier protein transacylase [Rhizobiu 1 1e-107
>gi|315122865|ref|YP_004063354.1| acyl-carrier-protein S-malonyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 314 Back     alignment and organism information
 Score =  551 bits (1421), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 259/314 (82%), Positives = 287/314 (91%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+ VLTFPGQGSQ++GMGRDL +SFPEARLVFEEVDHTLNQ+LSDLMWNG QEELT T N
Sbjct: 1   MAIVLTFPGQGSQIVGMGRDLCESFPEARLVFEEVDHTLNQHLSDLMWNGPQEELTVTYN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPALTAVSMAFIRVMEKNGLC +RDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG
Sbjct: 61  AQPALTAVSMAFIRVMEKNGLCFERDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           KSMQEAVPPGLG M AIIGLDD  V+  C QAS++GIC+IANDNGGGQ+VISG+QDAVKC
Sbjct: 121 KSMQEAVPPGLGGMAAIIGLDDRAVEFACEQASKIGICQIANDNGGGQIVISGMQDAVKC 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D+CL KGA+RAVFLPVSAPFHSSLM PVSKVM+ ML  + KQDPVVP+LPN CASPVS
Sbjct: 181 AVDSCLEKGARRAVFLPVSAPFHSSLMAPVSKVMQNMLGDIQKQDPVVPVLPNVCASPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            IDEIS+LLVEQVT RVRWRETIQWFANHG+  +YE+GSGKVLTGLAKRIDKS+SA+S+ 
Sbjct: 241 DIDEISKLLVEQVTARVRWRETIQWFANHGMTHIYEIGSGKVLTGLAKRIDKSISAISVD 300

Query: 301 KVEDIDLALRSIVG 314
           K+E+IDLAL +I+G
Sbjct: 301 KIENIDLALETIIG 314


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|307322235|ref|ZP_07601603.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium meliloti AK83] Length = 314 Back     alignment and organism information
>gi|15964894|ref|NP_385247.1| acyl-carrier-protein S-malonyltransferase [Sinorhizobium meliloti 1021] Length = 314 Back     alignment and organism information
>gi|307300965|ref|ZP_07580734.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium meliloti BL225C] Length = 314 Back     alignment and organism information
>gi|209548659|ref|YP_002280576.1| malonyl CoA-acyl carrier protein transacylase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 314 Back     alignment and organism information
>gi|222085441|ref|YP_002543971.1| malonyl CoA-acyl carrier protein transacylase [Agrobacterium radiobacter K84] Length = 313 Back     alignment and organism information
>gi|227821463|ref|YP_002825433.1| malonyl-CoA:acyl carrier protein transacylase [Sinorhizobium fredii NGR234] Length = 314 Back     alignment and organism information
>gi|325292473|ref|YP_004278337.1| malonyl-CoA:acyl carrier protein transacylase [Agrobacterium sp. H13-3] Length = 314 Back     alignment and organism information
>gi|150395968|ref|YP_001326435.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium medicae WSM419] Length = 314 Back     alignment and organism information
>gi|116251323|ref|YP_767161.1| malonyl CoA-acyl carrier protein transacylase [Rhizobium leguminosarum bv. viciae 3841] Length = 314 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target314 acyl-carrier-protein S-malonyltransferase [Candidatus L
TIGR00128290 TIGR00128, fabD, malonyl CoA-acyl carrier protein trans 8e-79
PLN02752343 PLN02752, PLN02752, [acyl-carrier protein] S-malonyltra 2e-52
KOG2926386 KOG2926, KOG2926, KOG2926, Malonyl-CoA:ACP transacylase 4e-50
smart00827298 smart00827, PKS_AT, Acyl transferase domain in polyketi 7e-45
TIGR03131295 TIGR03131, malonate_mdcH, malonate decarboxylase, epsil 1e-44
TIGR02813 2582 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturate 5e-32
COG3321 1061 COG3321, COG3321, Polyketide synthase modules and relat 1e-31
COG0331310 COG0331, FabD, (acyl-carrier-protein) S-malonyltransfer 3e-92
pfam00698319 pfam00698, Acyl_transf_1, Acyl transferase domain 2e-23
KOG1202 2376 KOG1202, KOG1202, KOG1202, Animal-type fatty acid synth 1e-07
>gnl|CDD|161724 TIGR00128, fabD, malonyl CoA-acyl carrier protein transacylase Back     alignment and domain information
>gnl|CDD|178353 PLN02752, PLN02752, [acyl-carrier protein] S-malonyltransferase Back     alignment and domain information
>gnl|CDD|38137 KOG2926, KOG2926, KOG2926, Malonyl-CoA:ACP transacylase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|129060 smart00827, PKS_AT, Acyl transferase domain in polyketide synthase (PKS) enzymes Back     alignment and domain information
>gnl|CDD|132175 TIGR03131, malonate_mdcH, malonate decarboxylase, epsilon subunit Back     alignment and domain information
>gnl|CDD|163029 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>gnl|CDD|33130 COG3321, COG3321, Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|30679 COG0331, FabD, (acyl-carrier-protein) S-malonyltransferase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|144338 pfam00698, Acyl_transf_1, Acyl transferase domain Back     alignment and domain information
>gnl|CDD|36416 KOG1202, KOG1202, KOG1202, Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 314 acyl-carrier-protein S-malonyltransferase [Candidatus L
TIGR00128295 fabD malonyl CoA-acyl carrier protein transacylase; Int 100.0
TIGR03131295 malonate_mdcH malonate decarboxylase, epsilon subunit. 100.0
COG0331310 FabD (acyl-carrier-protein) S-malonyltransferase [Lipid 100.0
pfam00698319 Acyl_transf_1 Acyl transferase domain. 100.0
smart00827298 PKS_AT Acyl transferase domain in polyketide synthase ( 100.0
KOG2926386 consensus 100.0
TIGR02813 2773 omega_3_PfaA polyketide-type polyunsaturated fatty acid 100.0
COG3321 1061 Polyketide synthase modules and related proteins [Secon 100.0
KOG1202 2376 consensus 100.0
TIGR02816538 pfaB_fam PfaB family protein; InterPro: IPR014181 This 99.91
cd07225306 Pat_PNPLA6_PNPLA7 Patatin-like phospholipase domain con 90.49
PRK10279300 hypothetical protein; Provisional 90.35
>TIGR00128 fabD malonyl CoA-acyl carrier protein transacylase; InterPro: IPR004410 Malonyl CoA-acyl carrier protein transacylase 2 Back     alignment and domain information
>TIGR03131 malonate_mdcH malonate decarboxylase, epsilon subunit Back     alignment and domain information
>COG0331 FabD (acyl-carrier-protein) S-malonyltransferase [Lipid metabolism] Back     alignment and domain information
>pfam00698 Acyl_transf_1 Acyl transferase domain Back     alignment and domain information
>smart00827 PKS_AT Acyl transferase domain in polyketide synthase (PKS) enzymes Back     alignment and domain information
>KOG2926 consensus Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA; InterPro: IPR004432 Members of this entry represent PfaA, which is involved in omega-3 polyunsaturated fatty acid biosynthesis, for example PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9 Back     alignment and domain information
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1202 consensus Back     alignment and domain information
>TIGR02816 pfaB_fam PfaB family protein; InterPro: IPR014181 This entry represents a group of proteins based on a Pfam B protein family Back     alignment and domain information
>cd07225 Pat_PNPLA6_PNPLA7 Patatin-like phospholipase domain containing protein 6 and protein 7 Back     alignment and domain information
>PRK10279 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target314 acyl-carrier-protein S-malonyltransferase [Candidatus L
3ezo_A318 Crystal Structure Of Acyl-Carrier-Protein S- Malony 5e-48
2g1h_A308 Structure Of E.Coli Fabd Complexed With Glycerol Le 2e-45
1mla_A309 The Escherichia Coli Malonyl-Coa:acyl Carrier Prote 3e-45
3qat_A318 Crystal Structure Of Acyl-Carrier-Protein-S-Malonyl 2e-44
3hjv_A312 1.7 Angstrom Resolution Crystal Structure Of An Acy 9e-44
3im8_A307 Crystal Structure Of Mcat From Streptococcus Pneumo 7e-43
3h0p_A312 2.0 Angstrom Crystal Structure Of An Acyl Carrier P 9e-42
3k89_A314 Crystal Structure Of Malonyl-Coa:acyl Carrier Prote 5e-41
3ptw_A336 Crystal Structure Of Malonyl Coa-Acyl Carrier Prote 5e-41
2cuy_A305 Crystal Structure Of Malonyl Coa-Acyl Carrier Prote 1e-39
3im9_A316 Crystal Structure Of Mcat From Staphylococcus Aureu 2e-37
2c2n_A339 Structure Of Human Mitochondrial Malonyltransferase 1e-29
2hg4_A917 Structure Of The Ketosynthase-Acyltransferase Didom 4e-29
2cdh_4305 Architecture Of The Thermomyces Lanuginosus Fungal 6e-29
2cf2_B304 Architecture Of Mammalian Fatty Acid Synthase Lengt 6e-29
2h1y_A321 Crystal Structure Of Malonyl-Coa:acyl Carrier Prote 8e-29
1nm2_A317 "malonyl-Coa:acp Transacylase" Length = 317 1e-28
3g87_A394 Crystal Structure Of Malonyl Coa-Acyl Carrier Prote 1e-25
2qc3_A303 Crystal Structure Of Mcat From Mycobacterium Tuberc 4e-25
2qj3_A322 Mycobacterium Tuberculosis Fabd Length = 322 4e-25
3hhd_A 965 Structure Of The Human Fatty Acid Synthase Ks-Mat D 6e-19
2vz8_A 2512 Crystal Structure Of Mammalian Fatty Acid Synthase 6e-19
2jfk_A433 Structure Of The Mat Domain Of Human Fas With Malon 6e-18
2jfd_A425 Structure Of The Mat Domain Of Human Fas Length = 4 6e-18
2qo3_A915 Crystal Structure Of [ks3][at3] Didomain From Modul 4e-32
2uva_G2060 Crystal Structure Of Fatty Acid Synthase From Therm 1e-11
2uv8_H2033 Crystal Structure Of Yeast Fatty Acid Synthase With 5e-08
2vkz_G2051 Structure Of The Cerulenin-Inhibited Fungal Fatty A 5e-08
2pff_B2006 Structural Insights Of Yeast Fatty Acid Synthase Le 8e-04
2uv8_A 1614 Crystal Structure Of Yeast Fatty Acid Synthase With 2e-04
2vkz_A 1887 Structure Of The Cerulenin-Inhibited Fungal Fatty A 2e-04
>gi|212375083|pdb|3EZO|A Chain A, Crystal Structure Of Acyl-Carrier-Protein S- Malonyltransferase From Burkholderia Pseudomallei 1710b Length = 318 Back     alignment and structure
 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 132/313 (42%), Positives = 172/313 (54%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 9   MKFAFVFPGQGSQSVGMLNAFAD-VAVVRETLDEASDALGQDIGKLIADGPADELNLTTN 67

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 68  TQPVMLTAAYACYRAWQQAGGA---QPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 124

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ 
Sbjct: 125 QAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEK 184

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   + VS
Sbjct: 185 ACEIAKEKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVAVVS 244

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 245 DPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 304

Query: 301 KVEDIDLALRSIV 313
               +D AL+   
Sbjct: 305 DPASLDEALKLAA 317


>gi|109157753|pdb|2G1H|A Chain A, Structure Of E.Coli Fabd Complexed With Glycerol Length = 308 Back     alignment and structure
gi|157831981|pdb|1MLA|A Chain A, The Escherichia Coli Malonyl-Coa:acyl Carrier Protein Transacylase At 1.5-Angstroms Resolution. Crystal Structure Of A Fatty Acid Synthase Component Length = 309 Back     alignment and structure
>gi|320089963|pdb|3QAT|A Chain A, Crystal Structure Of Acyl-Carrier-Protein-S-Malonyltransferase From Bartonella Henselae Length = 318 Back     alignment and structure
>gi|239782135|pdb|3HJV|A Chain A, 1.7 Angstrom Resolution Crystal Structure Of An Acyl Carrier Protein S-Malonyltransferase From Vibrio Cholerae O1 Biovar Eltor Str. N16961 Length = 312 Back     alignment and structure
>gi|298508361|pdb|3IM8|A Chain A, Crystal Structure Of Mcat From Streptococcus Pneumoniae Length = 307 Back     alignment and structure
>gi|227343886|pdb|3H0P|A Chain A, 2.0 Angstrom Crystal Structure Of An Acyl Carrier Protein S- Malonyltransferase From Salmonella Typhimurium. Length = 312 Back     alignment and structure
>gi|262118781|pdb|3K89|A Chain A, Structure Of X. Oryzae Pv. Oryzae Kacc10331, Xoo0880(Fabd) Complexed With Glycerol Length = 314 Back     alignment and structure
>gi|315113832|pdb|3PTW|A Chain A, Crystal Structure Of Malonyl Coa-Acyl Carrier Protein Transacylase From Clostridium Perfringens Atcc 13124 Length = 336 Back     alignment and structure
gi|110591069|pdb|2CUY|A Chain A, Crystal Structure Of Malonyl Coa-Acyl Carrier Protein Transacylase From Thermus Thermophilus Hb8 Length = 305 Back     alignment and structure
>gi|298508362|pdb|3IM9|A Chain A, Crystal Structure Of Mcat From Staphylococcus Aureus Length = 316 Back     alignment and structure
>gi|88192537|pdb|2C2N|A Chain A, Structure Of Human Mitochondrial Malonyltransferase Length = 339 Back     alignment and structure
>gi|112491326|pdb|2HG4|A Chain A, Structure Of The Ketosynthase-Acyltransferase Didomain Of Module 5 From Debs. Length = 917 Back     alignment and structure
>gi|93279066|pdb|2CDH|4 Chain 4, Architecture Of The Thermomyces Lanuginosus Fungal Fatty Acid Synthase At 5 Angstrom Resolution. Length = 305 Back     alignment and structure
>gi|93279103|pdb|2CF2|B Chain B, Architecture Of Mammalian Fatty Acid Synthase Length = 304 Back     alignment and structure
>gi|149241803|pdb|2H1Y|A Chain A, Crystal Structure Of Malonyl-Coa:acyl Carrier Protein Transacylase (Mcat) From Helicobacter Pylori Length = 321 Back     alignment and structure
>gi|28374075|pdb|1NM2|A Chain A, "malonyl-Coa:acp Transacylase" Length = 317 Back     alignment and structure
>gi|224036444|pdb|3G87|A Chain A, Crystal Structure Of Malonyl Coa-Acyl Carrier Protein Transacylase From Burkholderia Pseudomallei Using Dried Seaweed As Nucleant Or Protease Length = 394 Back     alignment and structure
>gi|158430131|pdb|2QC3|A Chain A, Crystal Structure Of Mcat From Mycobacterium Tuberculosis Length = 303 Back     alignment and structure
>gi|158430232|pdb|2QJ3|A Chain A, Mycobacterium Tuberculosis Fabd Length = 322 Back     alignment and structure
>gi|288562972|pdb|3HHD|A Chain A, Structure Of The Human Fatty Acid Synthase Ks-Mat Didomain As A Framework For Inhibitor Design. Length = 965 Back     alignment and structure
>gi|198443141|pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase Length = 2512 Back     alignment and structure
>gi|145579851|pdb|2JFK|A Chain A, Structure Of The Mat Domain Of Human Fas With Malonyl-Coa Length = 433 Back     alignment and structure
>gi|134104911|pdb|2JFD|A Chain A, Structure Of The Mat Domain Of Human Fas Length = 425 Back     alignment and structure
>gi|158430350|pdb|2QO3|A Chain A, Crystal Structure Of [ks3][at3] Didomain From Module 3 Of 6- Deoxyerthronolide B Synthase Length = 915 Back     alignment and structure
>gi|146387400|pdb|2UVA|G Chain G, Crystal Structure Of Fatty Acid Synthase From Thermomyces Lanuginosus At 3.1 Angstrom Resolution. This File Contains The Beta Subunits Of The Fatty Acid Synthase. The Entire Crystal Structure Consists Of One Heterododecameric Fatty Acid Synthase And Is Described In Remark 400 Length = 2060 Back     alignment and structure
gi|196049655|pdb|2VKZ|G Chain G, Structure Of The Cerulenin-Inhibited Fungal Fatty Acid Synthase Type I Multienzyme Complex Length = 2051 Back     alignment and structure
>gi|152149308|pdb|2PFF|B Chain B, Structural Insights Of Yeast Fatty Acid Synthase Length = 2006 Back     alignment and structure
>gi|146387388|pdb|2UV8|A Chain A, Crystal Structure Of Yeast Fatty Acid Synthase With Stalled Acyl Carrier Protein At 3.1 Angstrom Resolution Length = 1614 Back     alignment and structure
gi|196049652|pdb|2VKZ|A Chain A, Structure Of The Cerulenin-Inhibited Fungal Fatty Acid Synthase Type I Multienzyme Complex Length = 1887 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target314 acyl-carrier-protein S-malonyltransferase [Candidatus L
3im9_A316 MCAT, MCT, malonyl COA-acyl carrier protein transacylas 8e-76
3im8_A307 Malonyl acyl carrier protein transacylase; fatty acid s 6e-75
1mla_A309 Malonyl-coenzyme A acyl carrier protein transacylase; a 8e-71
3ezo_A318 Malonyl COA-acyl carrier protein transacylase; ssgcid, 4e-70
2qo3_A915 Eryaii erythromycin polyketide synthase modules 3 and 4 6e-68
3k89_A314 Malonyl COA-ACP transacylase; bacterial blight, XOO0880 1e-63
2hg4_A917 DEBS, 6-deoxyerythronolide B synthase; ketosynthase, ac 6e-62
1nm2_A317 Malonyl COA:acyl carrier protein malonyltransferase; al 2e-60
2cuy_A305 Malonyl COA-[acyl carrier protein] transacylase; transf 2e-55
3g87_A394 Malonyl COA-acyl carrier protein transacylase; ssgcid, 2e-51
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, megasynt 2e-50
2c2n_A339 Malonyl COA-acyl carrier protein transacylase; mitochon 3e-47
2qc3_A303 MCT, malonyl COA-acyl carrier protein transacylase; mal 2e-43
2h1y_A321 Malonyl coenzyme A-acyl carrier protein transacylase; F 3e-43
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantetheine, m 1e-40
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty acid bio 1e-19
2uva_G2060 Fatty acid synthase beta subunits; fungal, dehydratase, 9e-21
2uv8_G2051 Fatty acid synthase subunit beta (FAS1); fatty acid bio 5e-17
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydratase, 4e-08
2uv8_A1887 Fatty acid synthase subunit alpha (FAS2); fatty acid bi 5e-09
2uv9_A1878 Fatty acid synthase alpha subunits; fungal, dehydratase 1e-08
>3im9_A MCAT, MCT, malonyl COA-acyl carrier protein transacylase; fatty acid synthesis, malonyl-COA: acyl carrier protein TRAN (MCAT), FABD; 1.46A {Staphylococcus aureus} Length = 316 Back     alignment and structure
 Score =  279 bits (714), Expect = 8e-76
 Identities = 103/305 (33%), Positives = 164/305 (53%), Gaps = 7/305 (2%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
             + FPGQG+Q +GM +DL+++  +A  +      TL+ ++ + M+   + +L  T N Q
Sbjct: 12  MAIIFPGQGAQKVGMAQDLFNNNDQATEILTSAAKTLDFDILETMFTDEEGKLGETENTQ 71

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL   S A +            +  +  GHSLGEY++L AA   S  D +++VR RG+ 
Sbjct: 72  PALLTHSSALLAA------LKNLNPDFTMGHSLGEYSSLVAADVLSFEDAVKIVRKRGQL 125

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGI-CEIANDNGGGQVVISGLQDAVKCA 181
           M +A P G+GSM A++GLD   VD IC   S      E AN N  GQ+V+SG +  +   
Sbjct: 126 MAQAFPTGVGSMAAVLGLDFDKVDEICKSLSSDDKIIEPANINCPGQIVVSGHKALIDEL 185

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +   + GAKR + L VS PFHSSLM  + +     ++    +D   P++ N  A   + 
Sbjct: 186 VEKGKSLGAKRVMPLAVSGPFHSSLMKVIEEDFSSYINQFEWRDAKFPVVQNVNAQGETD 245

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I   +V+Q+   V++  + +W  + GV    E+G GKVL+GL K+I++ +   SI  
Sbjct: 246 KEVIKSNMVKQLYSPVQFINSTEWLIDQGVDHFIEIGPGKVLSGLIKKINRDVKLTSIQT 305

Query: 302 VEDID 306
           +ED+ 
Sbjct: 306 LEDVK 310


>3im8_A Malonyl acyl carrier protein transacylase; fatty acid synthesis, malonyl-COA, acyl carrier protein TRAN (MCAT), FABD, acyltransferase; 2.10A {Streptococcus pneumoniae} Length = 307 Back     alignment and structure
>1mla_A Malonyl-coenzyme A acyl carrier protein transacylase; acyltransferase; 1.50A {Escherichia coli} SCOP: c.19.1.1 d.58.23.1 PDB: 2g2o_A 2g1h_A 2g2y_A 2g2z_A* 3h0p_A 3hjv_A* Length = 309 Back     alignment and structure
>3ezo_A Malonyl COA-acyl carrier protein transacylase; ssgcid, acyl-carrier-protein S-malonyltransferase, acyltransferase, transferase; 2.05A {Burkholderia pseudomallei 1710B} Length = 318 Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3 and 4; ketosynthase, acyltransferase, phosphopantetheine; 2.59A {Saccharopolyspora erythraea} Length = 915 Back     alignment and structure
>3k89_A Malonyl COA-ACP transacylase; bacterial blight, XOO0880, FABD, xanthomonas oryzae PV. oryzae KACC10331; 1.60A {Xanthomonas oryzae PV} PDB: 3een_A Length = 314 Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5; 2.73A {Saccharopolyspora erythraea} Length = 917 Back     alignment and structure
>1nm2_A Malonyl COA:acyl carrier protein malonyltransferase; alpha/beta hydrolase-like core; 2.00A {Streptomyces coelicolor A3} SCOP: c.19.1.1 d.58.23.1 PDB: 2cdh_4 2cf2_B Length = 317 Back     alignment and structure
>2cuy_A Malonyl COA-[acyl carrier protein] transacylase; transferase, structural genomics, NPPSFA; 2.10A {Thermus thermophilus HB8} Length = 305 Back     alignment and structure
>3g87_A Malonyl COA-acyl carrier protein transacylase; ssgcid, niaid, decode biostructures, dried seaweed, acyltransferase, transferase; 2.30A {Burkholderia pseudomallei 1710B} Length = 394 Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Length = 965 Back     alignment and structure
>2c2n_A Malonyl COA-acyl carrier protein transacylase; mitochondrial, malonyltrasferase, fatty acid synthase alternative splicing, lipid synthesis; HET: AE4; 1.55A {Homo sapiens} Length = 339 Back     alignment and structure
>2qc3_A MCT, malonyl COA-acyl carrier protein transacylase; malonyl-COA:ACP transacylase, , nucleophilic attack; 2.30A {Mycobacterium tuberculosis H37RV} PDB: 2qj3_A Length = 303 Back     alignment and structure
>2h1y_A Malonyl coenzyme A-acyl carrier protein transacylase; FABD, MCAT, transferase; 2.50A {Helicobacter pylori SS1} Length = 321 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Length = 2051 Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Length = 2060 Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Length = 2051 Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Length = 2060 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target314 acyl-carrier-protein S-malonyltransferase [Candidatus L
3k89_A314 Malonyl COA-ACP transacylase; bacterial blight, XOO0880 100.0
1mla_A309 Malonyl-coenzyme A acyl carrier protein transacylase; a 100.0
3ezo_A318 Malonyl COA-acyl carrier protein transacylase; ssgcid, 100.0
3im8_A307 Malonyl acyl carrier protein transacylase; fatty acid s 100.0
2c2n_A339 Malonyl COA-acyl carrier protein transacylase; mitochon 100.0
2qo3_A915 Eryaii erythromycin polyketide synthase modules 3 and 4 100.0
2h1y_A321 Malonyl coenzyme A-acyl carrier protein transacylase; F 100.0
2cuy_A305 Malonyl COA-[acyl carrier protein] transacylase; transf 100.0
3im9_A316 MCAT, MCT, malonyl COA-acyl carrier protein transacylas 100.0
1nm2_A317 Malonyl COA:acyl carrier protein malonyltransferase; al 100.0
2qc3_A303 MCT, malonyl COA-acyl carrier protein transacylase; mal 100.0
2hg4_A917 DEBS, 6-deoxyerythronolide B synthase; ketosynthase, ac 100.0
3g87_A394 Malonyl COA-acyl carrier protein transacylase; ssgcid, 100.0
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, megasynt 100.0
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty acid bio 100.0
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantetheine, m 100.0
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydratase, 100.0
2uv8_G2051 Fatty acid synthase subunit beta (FAS1); fatty acid bio 100.0
2uva_G2060 Fatty acid synthase beta subunits; fungal, dehydratase, 100.0
2uv8_A1887 Fatty acid synthase subunit alpha (FAS2); fatty acid bi 99.66
2uv9_A1878 Fatty acid synthase alpha subunits; fungal, dehydratase 99.65
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty acid bi 98.21
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydratase 98.0
>3k89_A Malonyl COA-ACP transacylase; bacterial blight, XOO0880, FABD, xanthomonas oryzae PV. oryzae KACC10331; 1.60A {Xanthomonas oryzae PV} PDB: 3een_A Back     alignment and structure
Probab=100.00  E-value=0  Score=529.82  Aligned_cols=307  Identities=38%  Similarity=0.543  Sum_probs=292.9

Q ss_pred             EEEEECCCCCCCCCCHHHHHHHHCHHHHHHHHHHHHHCCCCHHHHHCCCCHHHHHCHHHHHHHHHHHHHHHHHHHHH-CC
Q ss_conf             19998087333731158999985999999999999883989789853898678304676503456666547899997-18
Q gi|254780536|r    2 STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEK-NG   80 (314)
Q Consensus         2 k~~f~FpGQGsq~~gM~~~L~~~~p~~r~~~~~~~~~l~~~l~~~~~~~~~~~l~~~~~~Qp~i~~~~~a~~~~l~~-~g   80 (314)
                      |+||+|||||+||+|||++||+.+|.||+.++++++.+++++.+++++++++.++++.++||+|++++++++++|++ .|
T Consensus         5 ~iAfvFpGQGsq~~gMg~~L~~~~p~~r~~~~~~~~~lg~~l~~~~~~~~~~~l~~~~~~q~~i~~~~~a~~~~l~~~~G   84 (314)
T 3k89_A            5 TLAFVFPGQGSQSLGMLAELSELHPQIRETFAEASEGAGVDLWALSQGGPEEMLNRTEYTQPALLAAGVAVWRLWTAQRG   84 (314)
T ss_dssp             EEEEEECCTTCCCTTTTHHHHHHCTHHHHHHHHHHHHHTSCHHHHHHHCCHHHHTSHHHHHHHHHHHHHHHHHHHHHTTC
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             98999486066288799999974999999999998763998899961897777502688999999999999999997359


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEE
Q ss_conf             87643544246654420122253178650233333456886531001111222221235035531122344211354200
Q gi|254780536|r   81 LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEI  160 (314)
Q Consensus        81 i~~~~~p~~v~GhSlGE~aAl~~aG~ls~eda~~lv~~R~~~m~~~~~~~~g~M~aV~~~~~~~~~~~~~~~~~~~~~~i  160 (314)
                      +    +|++++|||+|||+|+++||+++++|++++++.|+++|.+..+.++|.|++|.+...+.+++++........++|
T Consensus        85 i----~P~~v~GhSlGE~aAl~~aG~l~~~~a~~l~~~R~~~~~~~~~~~~g~~~av~~~~~~~~~~~~~~~~~~~~v~i  160 (314)
T 3k89_A           85 Q----RPALLAGHSLGEYTALVAAGVLSLHDGAHLVRLRGQFMQAAAPAGVGAMAAVLGAEDAVVLEVCAEAAGSQVVVP  160 (314)
T ss_dssp             C----EEEEEEESTHHHHHHHHHTTSSCHHHHHHHHHHHHHHHHHHSCTTSEEEEEEESCCHHHHHHHHHHHCTTSCEEE
T ss_pred             C----CCCCHHHCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHCCCHHHHHHHHHHHCCCCCCEEE
T ss_conf             9----952100256447999998288657889999999999998356689821013206317899999862145770478


Q ss_pred             CCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             12232221353033112899988888865310035555432342010203788887422232028776542045787100
Q gi|254780536|r  161 ANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS  240 (314)
Q Consensus       161 a~~Ns~~q~visG~~~~l~~~~~~~~~~~~~~~~~L~v~~afHs~lm~~~~~~~~~~l~~i~~~~p~ipi~S~~~g~~~~  240 (314)
                      ||+|+|+|+||||++++++++.+.+++.|++++++|+|++|||||+|+++.++|++.++++.+++|++|+||+++|++++
T Consensus       161 a~~Ns~~~~visG~~~~l~~~~~~l~~~g~~~~~~L~v~~afHs~~~~~~~~~~~~~l~~~~~~~p~ipi~S~~~g~~~~  240 (314)
T 3k89_A          161 ANFNSPGQIVIGGDAAAVDRALALLAERGVRKAVKLAVSVPSHTPLMRDAANQLGEAMAGLSWHAPQIPVVQNVDARVHD  240 (314)
T ss_dssp             EEEEETTEEEEEEEHHHHHHHHHHHHHTTCCCEEECSCCCCTTSGGGHHHHHHHHHHHHTSCCCCCSSCBEETTTTEECC
T ss_pred             EEECCCCCEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCEEEECCCCEEEC
T ss_conf             89868987683378999999999998579967998999888868764421489999985386679875265225632504


Q ss_pred             CCHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCEEECCCHHHHHHHHHHH
Q ss_conf             100233222220448501999999999779989999389879999999873898155239989999999874
Q gi|254780536|r  241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSI  312 (314)
Q Consensus       241 ~~~~~~~~l~~ql~~pV~f~~~i~~l~~~g~~~fiEiGP~~~Lt~l~~~~~~~~~~~~~~~~~~~~~~l~~~  312 (314)
                      +.+.++++|++|+++||+|.++++++.++|++.|||+|||++|++|+|+++++.++.++++.+|+...++.+
T Consensus       241 ~~~~~~~~l~~ql~~pV~f~~~i~~l~~~g~~~fvEiGP~~~L~~lv~~~~~~~~~~~~~~~~~~~~~l~~~  312 (314)
T 3k89_A          241 GSAAIRQALVEQLYLPVQWTGCVQALASQGITRIAECGPGKVLSGLIKRIDKSLDARPLATPADYAGALDAW  312 (314)
T ss_dssp             SHHHHHHHHHHHHHSCEEHHHHHHHHHHTTCCEEEECSSSSHHHHHHHHHCTTSEEEECSSHHHHHHHHHHT
T ss_pred             CCHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHCCCCCEECCCHHHHHHHHHHH
T ss_conf             610258999976567546999999999779999999198189999999883689954438888899999874



>1mla_A Malonyl-coenzyme A acyl carrier protein transacylase; acyltransferase; 1.50A {Escherichia coli} SCOP: c.19.1.1 d.58.23.1 PDB: 2g2o_A 2g1h_A 2g2y_A 2g2z_A* 3h0p_A 3hjv_A* Back     alignment and structure
>3ezo_A Malonyl COA-acyl carrier protein transacylase; ssgcid, acyl-carrier-protein S-malonyltransferase, acyltransferase, transferase; 2.05A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3im8_A Malonyl acyl carrier protein transacylase; fatty acid synthesis, malonyl-COA, acyl carrier protein TRAN (MCAT), FABD, acyltransferase; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>2c2n_A Malonyl COA-acyl carrier protein transacylase; mitochondrial, malonyltrasferase, fatty acid synthase alternative splicing, lipid synthesis; HET: AE4; 1.55A {Homo sapiens} Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3 and 4; ketosynthase, acyltransferase, phosphopantetheine; 2.59A {Saccharopolyspora erythraea} Back     alignment and structure
>2h1y_A Malonyl coenzyme A-acyl carrier protein transacylase; FABD, MCAT, transferase; 2.50A {Helicobacter pylori SS1} Back     alignment and structure
>2cuy_A Malonyl COA-[acyl carrier protein] transacylase; transferase, structural genomics, NPPSFA; 2.10A {Thermus thermophilus HB8} Back     alignment and structure
>3im9_A MCAT, MCT, malonyl COA-acyl carrier protein transacylase; fatty acid synthesis, malonyl-COA: acyl carrier protein TRAN (MCAT), FABD; 1.46A {Staphylococcus aureus} Back     alignment and structure
>1nm2_A Malonyl COA:acyl carrier protein malonyltransferase; alpha/beta hydrolase-like core; 2.00A {Streptomyces coelicolor A3} SCOP: c.19.1.1 d.58.23.1 PDB: 2cdh_4 2cf2_B Back     alignment and structure
>2qc3_A MCT, malonyl COA-acyl carrier protein transacylase; malonyl-COA:ACP transacylase, , nucleophilic attack; 2.30A {Mycobacterium tuberculosis H37RV} PDB: 2qj3_A Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5; 2.73A {Saccharopolyspora erythraea} Back     alignment and structure
>3g87_A Malonyl COA-acyl carrier protein transacylase; ssgcid, niaid, decode biostructures, dried seaweed, acyltransferase, transferase; 2.30A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 314 acyl-carrier-protein S-malonyltransferase [Candidatus L
d1mlaa1235 c.19.1.1 (A:3-127,A:198-307) Catalytic domain of malony 1e-24
d1nm2a1253 c.19.1.1 (A:0-133,A:196-314) Catalytic domain of malony 7e-22
d1mlaa1235 c.19.1.1 (A:3-127,A:198-307) Catalytic domain of malony 3e-21
d1nm2a1253 c.19.1.1 (A:0-133,A:196-314) Catalytic domain of malony 5e-18
d1mlaa270 d.58.23.1 (A:128-197) Probable ACP-binding domain of ma 2e-14
d1nm2a262 d.58.23.1 (A:134-195) Probable ACP-binding domain of ma 1e-08
>d1mlaa1 c.19.1.1 (A:3-127,A:198-307) Catalytic domain of malonyl-CoA ACP transacylase FabD {Escherichia coli [TaxId: 562]} Length = 235 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FabD/lysophospholipase-like
superfamily: FabD/lysophospholipase-like
family: FabD-like
domain: Catalytic domain of malonyl-CoA ACP transacylase FabD
species: Escherichia coli [TaxId: 562]
 Score =  107 bits (269), Expect = 1e-24
 Identities = 55/123 (44%), Positives = 68/123 (55%), Gaps = 3/123 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T   QPAL 
Sbjct: 6   FPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTWQTQPALL 65

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A  RV ++ G    +  + +AGHSLGEY+AL  A     +D +RLV  RGK MQEA
Sbjct: 66  TASVALYRVWQQQGG---KAPAMMAGHSLGEYSALVCAGVIDFADAVRLVEMRGKFMQEA 122

Query: 127 VPP 129
           VP 
Sbjct: 123 VPE 125


>d1nm2a1 c.19.1.1 (A:0-133,A:196-314) Catalytic domain of malonyl-CoA ACP transacylase FabD {Streptomyces coelicolor A3(2) [TaxId: 100226]} Length = 253 Back     information, alignment and structure
>d1mlaa1 c.19.1.1 (A:3-127,A:198-307) Catalytic domain of malonyl-CoA ACP transacylase FabD {Escherichia coli [TaxId: 562]} Length = 235 Back     information, alignment and structure
>d1nm2a1 c.19.1.1 (A:0-133,A:196-314) Catalytic domain of malonyl-CoA ACP transacylase FabD {Streptomyces coelicolor A3(2) [TaxId: 100226]} Length = 253 Back     information, alignment and structure
>d1mlaa2 d.58.23.1 (A:128-197) Probable ACP-binding domain of malonyl-CoA ACP transacylase {Escherichia coli [TaxId: 562]} Length = 70 Back     information, alignment and structure
>d1nm2a2 d.58.23.1 (A:134-195) Probable ACP-binding domain of malonyl-CoA ACP transacylase {Streptomyces coelicolor A3(2) [TaxId: 100226]} Length = 62 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target314 acyl-carrier-protein S-malonyltransferase [Candidatus L
d1mlaa1235 Catalytic domain of malonyl-CoA ACP transacylase FabD { 100.0
d1nm2a1253 Catalytic domain of malonyl-CoA ACP transacylase FabD { 100.0
d1mlaa270 Probable ACP-binding domain of malonyl-CoA ACP transacy 99.47
d1nm2a262 Probable ACP-binding domain of malonyl-CoA ACP transacy 99.0
>d1mlaa1 c.19.1.1 (A:3-127,A:198-307) Catalytic domain of malonyl-CoA ACP transacylase FabD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FabD/lysophospholipase-like
superfamily: FabD/lysophospholipase-like
family: FabD-like
domain: Catalytic domain of malonyl-CoA ACP transacylase FabD
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=443.35  Aligned_cols=234  Identities=40%  Similarity=0.631  Sum_probs=223.4

Q ss_pred             EEEEECCCCCCCCCCHHHHHHHHCHHHHHHHHHHHHHCCCCHHHHHCCCCHHHHHCHHHHHHHHHHHHHHHHHHHHHC-C
Q ss_conf             199980873337311589999859999999999998839897898538986783046765034566665478999971-8
Q gi|254780536|r    2 STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKN-G   80 (314)
Q Consensus         2 k~~f~FpGQGsq~~gM~~~L~~~~p~~r~~~~~~~~~l~~~l~~~~~~~~~~~l~~~~~~Qp~i~~~~~a~~~~l~~~-g   80 (314)
                      ++||+||||||||+|||++||+++|.||+.++++++++++++.+.++..+.+.+++|.++||+||+++++++++|+++ |
T Consensus         1 q~AfvFpGQGsQ~~gMg~~L~~~~p~~r~~~~~~~~~l~~~l~~~~~~~~~~~~~~t~~~qpai~~~~~al~~~l~~~~g   80 (235)
T d1mlaa1           1 QFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTWQTQPALLTASVALYRVWQQQGG   80 (235)
T ss_dssp             CEEEEECCTTCCCTTTTHHHHHHCHHHHHHHHHHHHHHTSCHHHHHHHCCHHHHTSHHHHHHHHHHHHHHHHHHHHHTTC
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             98999578055188889999977999999999999985987899972476434520799999999999999999998339


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEE
Q ss_conf             87643544246654420122253178650233333456886531001111222221235035531122344211354200
Q gi|254780536|r   81 LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEI  160 (314)
Q Consensus        81 i~~~~~p~~v~GhSlGE~aAl~~aG~ls~eda~~lv~~R~~~m~~~~~~~~g~M~aV~~~~~~~~~~~~~~~~~~~~~~i  160 (314)
                      +    +|++++|||+|||+|+++||++|++|+++++..||++|+++.+                                
T Consensus        81 ~----~p~~v~GhSlGE~aAl~~aG~ls~e~~~~lv~~Rg~~m~~~~~--------------------------------  124 (235)
T d1mlaa1          81 K----APAMMAGHSLGEYSALVCAGVIDFADAVRLVEMRGKFMQEAVP--------------------------------  124 (235)
T ss_dssp             C----CCSEEEESTHHHHHHHHHTTSSCHHHHHHHHHHHHHHHHHHSC--------------------------------
T ss_pred             C----CCEEEEECCCHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCC--------------------------------
T ss_conf             9----7346540331289999975875300089999998888887079--------------------------------


Q ss_pred             CCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             12232221353033112899988888865310035555432342010203788887422232028776542045787100
Q gi|254780536|r  161 ANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS  240 (314)
Q Consensus       161 a~~Ns~~q~visG~~~~l~~~~~~~~~~~~~~~~~L~v~~afHs~lm~~~~~~~~~~l~~i~~~~p~ipi~S~~~g~~~~  240 (314)
                                                            ..|||||+|+++.++|++.++++++++|++|+|||+||++++
T Consensus       125 --------------------------------------~~pfHs~~m~~~~~~~~~~l~~v~~~~p~~pviS~~tg~~~~  166 (235)
T d1mlaa1         125 --------------------------------------EVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCET  166 (235)
T ss_dssp             --------------------------------------TSCTTSGGGHHHHHHHHHHHHTSCCCCCSSCBBCTTTCCBCC
T ss_pred             --------------------------------------CCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCC
T ss_conf             --------------------------------------775223776501899999985688889963488578777788


Q ss_pred             CCHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCEEECCCHHHHHHHH
Q ss_conf             100233222220448501999999999779989999389879999999873898155239989999999
Q gi|254780536|r  241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLAL  309 (314)
Q Consensus       241 ~~~~~~~~l~~ql~~pV~f~~~i~~l~~~g~~~fiEiGP~~~Lt~l~~~~~~~~~~~~~~~~~~~~~~l  309 (314)
                      +.+.++++|++|+++||+|.++|+++.+.|+++|||+|||++|++++|+++++.++.+++++++++.+|
T Consensus       167 ~~~~~~~~l~~ql~~pV~f~~~i~~l~~~g~~~fiEiGP~~~Lt~l~~~i~~~~~~~~v~~~~~l~~al  235 (235)
T d1mlaa1         167 NGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASALNEPSAMAAAL  235 (235)
T ss_dssp             SHHHHHHHHHHHHHSCEEHHHHHHHHHHTTCCEEEECSSSSHHHHHHHHHCTTCEEEECCSHHHHHHHC
T ss_pred             CHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCCEECCCHHHHHHHC
T ss_conf             989999999874028766999999999789999999398688899999980788830059989999759



>d1nm2a1 c.19.1.1 (A:0-133,A:196-314) Catalytic domain of malonyl-CoA ACP transacylase FabD {Streptomyces coelicolor A3(2) [TaxId: 100226]} Back     information, alignment and structure
>d1mlaa2 d.58.23.1 (A:128-197) Probable ACP-binding domain of malonyl-CoA ACP transacylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nm2a2 d.58.23.1 (A:134-195) Probable ACP-binding domain of malonyl-CoA ACP transacylase {Streptomyces coelicolor A3(2) [TaxId: 100226]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 314 acyl-carrier-protein S-malonyltransferase [Candida
2pff_B_144-317_429-553299 (B:144-317,B:429-553) Fatty acid synthase subunit 2e-34
2qc3_A_1-128_196-303236 (A:1-128,A:196-303) MCT, malonyl COA-acyl carrier 2e-30
2uv8_G_1644-1697_1754-1829130 (G:1644-1697,G:1754-1829) Fatty acid synthase subu 9e-30
2uva_G_1671-1724_1783-1852_1989-2020156 (G:1671-1724,G:1783-1852,G:1989-2020) Fatty acid s 2e-29
1nm2_A_1-134_202-317250 (A:1-134,A:202-317) Malonyl COA:acyl carrier prote 8e-29
3g87_A_1-124_196-394323 (A:1-124,A:196-394) Malonyl COA-acyl carrier prote 3e-28
3ezo_A_1-132_207-318244 (A:1-132,A:207-318) Malonyl COA-acyl carrier prote 3e-28
2h1y_A_1-139_273-321188 (A:1-139,A:273-321) Malonyl coenzyme A-acyl carrie 6e-28
3k89_A_1-129_203-314241 (A:1-129,A:203-314) Malonyl COA-ACP transacylase; 1e-27
2qo3_A_531-660_730-836237 (A:531-660,A:730-836) Eryaii erythromycin polyketi 2e-27
2c2n_A_1-152_235-339257 (A:1-152,A:235-339) Malonyl COA-acyl carrier prote 2e-26
2hg4_A_550-674_746-852232 (A:550-674,A:746-852) DEBS, 6-deoxyerythronolide B 9e-26
1mla_A_1-126_269-309167 (A:1-126,A:269-309) Malonyl-coenzyme A acyl carrie 1e-25
2cuy_A_1-123_194-305235 (A:1-123,A:194-305) Malonyl COA-[acyl carrier prot 1e-25
2uva_G_135-311_423-557312 (G:135-311,G:423-557) Fatty acid synthase beta sub 9e-25
2vz8_A_488-615_751-788166 (A:488-615,A:751-788) Fatty acid synthase; transfe 7e-24
3hhd_A_490-616_753-789164 (A:490-616,A:753-789) Fatty acid synthase; transfe 1e-22
2pff_B_1616-1771156 (B:1616-1771) Fatty acid synthase subunit beta; fa 2e-18
2qc3_A_1-128_196-303236 (A:1-128,A:196-303) MCT, malonyl COA-acyl carrier 2e-21
1nm2_A_1-134_202-317250 (A:1-134,A:202-317) Malonyl COA:acyl carrier prote 2e-23
3g87_A_1-124_196-394323 (A:1-124,A:196-394) Malonyl COA-acyl carrier prote 1e-13
3k89_A_1-129_203-314241 (A:1-129,A:203-314) Malonyl COA-ACP transacylase; 5e-22
2qo3_A_531-660_730-836237 (A:531-660,A:730-836) Eryaii erythromycin polyketi 1e-15
2c2n_A_1-152_235-339257 (A:1-152,A:235-339) Malonyl COA-acyl carrier prote 1e-16
2hg4_A_550-674_746-852232 (A:550-674,A:746-852) DEBS, 6-deoxyerythronolide B 9e-16
2cuy_A_1-123_194-305235 (A:1-123,A:194-305) Malonyl COA-[acyl carrier prot 2e-21
3ezo_A_1-132_207-318244 (A:1-132,A:207-318) Malonyl COA-acyl carrier prote 2e-22
1mla_A_1-126_269-309167 (A:1-126,A:269-309) Malonyl-coenzyme A acyl carrie 2e-08
2uv8_A_25-9167 (A:25-91) Fatty acid synthase subunit alpha (FAS2) 4e-13
2uv8_G_135-313_492-559247 (G:135-313,G:492-559) Fatty acid synthase subunit 2e-24
1mla_A_127-268142 (A:127-268) Malonyl-coenzyme A acyl carrier protei 1e-23
2uv8_G_330-491162 (G:330-491) Fatty acid synthase subunit beta (FAS1 8e-20
2uva_G_1863-1988126 (G:1863-1988) Fatty acid synthase beta subunits; f 3e-15
2uv8_G_1830-1960131 (G:1830-1960) Fatty acid synthase subunit beta (FA 3e-15
2h1y_A_140-210_261-27283 (A:140-210,A:261-272) Malonyl coenzyme A-acyl carr 2e-15
2uva_G_328-42295 (G:328-422) Fatty acid synthase beta subunits; fun 4e-15
3ezo_A_133-20674 (A:133-206) Malonyl COA-acyl carrier protein trans 6e-15
2pff_B_1801-1915115 (B:1801-1915) Fatty acid synthase subunit beta; fa 7e-15
2pff_B_334-42895 (B:334-428) Fatty acid synthase subunit beta; fatt 2e-14
3k89_A_130-20273 (A:130-202) Malonyl COA-ACP transacylase; bacteria 3e-14
2c2n_A_153-23482 (A:153-234) Malonyl COA-acyl carrier protein trans 3e-14
2qc3_A_129-19567 (A:129-195) MCT, malonyl COA-acyl carrier protein 3e-12
2cuy_A_124-19370 (A:124-193) Malonyl COA-[acyl carrier protein] tra 1e-11
3hhd_A_617-685_744-75278 (A:617-685,A:744-752) Fatty acid synthase; transfe 2e-11
3g87_A_125-19571 (A:125-195) Malonyl COA-acyl carrier protein trans 3e-11
2vz8_A_616-683_742-75077 (A:616-683,A:742-750) Fatty acid synthase; transfe 4e-11
1nm2_A_135-20167 (A:135-201) Malonyl COA:acyl carrier protein malon 6e-11
2qo3_A_661-72969 (A:661-729) Eryaii erythromycin polyketide synthas 2e-10
2hg4_A_675-74571 (A:675-745) DEBS, 6-deoxyerythronolide B synthase; 2e-10
2h1y_A_211-26050 (A:211-260) Malonyl coenzyme A-acyl carrier protei 9e-07
2pff_B_1772-1800_1916-2006120 (B:1772-1800,B:1916-2006) Fatty acid synthase subu 2e-04
>2pff_B (B:144-317,B:429-553) Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae}Length = 299 Back     alignment and structure
 Score =  140 bits (354), Expect = 2e-34
 Identities = 46/343 (13%), Positives = 80/343 (23%), Gaps = 98/343 (28%)

Query: 3   TVLTFPGQGSQVIGMGRD---LYDSFPEARLVFEEVDHTLNQN----------------- 42
            V  F GQG+                     + +    TL++                  
Sbjct: 13  LVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNI 72

Query: 43  ---LSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM-EKNGL---CVKRDISYVAGHSL 95
              L +      ++ L +   + P +  + +A   V  +  G     ++  +    GHS 
Sbjct: 73  LEWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQ 132

Query: 96  GEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV 155
           G  TA+  A+  S       VR     +                                
Sbjct: 133 GLVTAVAIAETDSWESFFVSVRKAITVLFFIGVR--CYEAY------------------P 172

Query: 156 GICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMK 215
               +             L  A             K  V   VS       +        
Sbjct: 173 NTSHL-------------LVPASD--------LINKDLVKNNVSFNAKDIQIPVYD---- 207

Query: 216 WMLDSVTKQDPVVPILPNFCASPVSSIDE-ISRLLVEQVT-GRVRWRETIQWFANHGVKS 273
                             F  S +  +   IS  +V+ +    V+W  T Q+        
Sbjct: 208 -----------------TFDGSDLRVLSGSISERIVDCIIRLPVKWETTTQF----KATH 246

Query: 274 VYEVGSGKV--LTGLAKRIDKSLSAVSISKVEDIDLALRSIVG 314
           + + G G    L  L  R       V +     +D+      G
Sbjct: 247 ILDFGPGGASGLGVLTHRNKDGT-GVRVIVAGTLDINPDDDYG 288


>2qc3_A (A:1-128,A:196-303) MCT, malonyl COA-acyl carrier protein transacylase; malonyl-COA:ACP transacylase, , nucleophilic attack; 2.30A {Mycobacterium tuberculosis H37RV} PDB: 2qj3_ALength = 236 Back     alignment and structure
>2uva_G (G:1671-1724,G:1783-1852,G:1989-2020) Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G*Length = 156 Back     alignment and structure
>1nm2_A (A:1-134,A:202-317) Malonyl COA:acyl carrier protein malonyltransferase; alpha/beta hydrolase-like core; 2.00A {Streptomyces coelicolor A3}Length = 250 Back     alignment and structure
>3g87_A (A:1-124,A:196-394) Malonyl COA-acyl carrier protein transacylase; ssgcid, niaid, decode biostructures, dried seaweed, acyltransferase, transferase; 2.30A {Burkholderia pseudomallei 1710B}Length = 323 Back     alignment and structure
>3ezo_A (A:1-132,A:207-318) Malonyl COA-acyl carrier protein transacylase; ssgcid, acyl-carrier-protein S-malonyltransferase, acyltransferase, transferase; 2.05A {Burkholderia pseudomallei 1710B}Length = 244 Back     alignment and structure
>2h1y_A (A:1-139,A:273-321) Malonyl coenzyme A-acyl carrier protein transacylase; FABD, MCAT, transferase; 2.50A {Helicobacter pylori SS1}Length = 188 Back     alignment and structure
>3k89_A (A:1-129,A:203-314) Malonyl COA-ACP transacylase; bacterial blight, XOO0880, FABD, xanthomonas oryzae PV. oryzae KACC10331; 1.60A {Xanthomonas oryzae PV} PDB: 3een_ALength = 241 Back     alignment and structure
>2qo3_A (A:531-660,A:730-836) Eryaii erythromycin polyketide synthase modules 3 and 4; ketosynthase, acyltransferase, phosphopantetheine; 2.59A {Saccharopolyspora erythraea}Length = 237 Back     alignment and structure
>2c2n_A (A:1-152,A:235-339) Malonyl COA-acyl carrier protein transacylase; mitochondrial, malonyltrasferase, fatty acid synthase alternative splicing, lipid synthesis; HET: AE4; 1.55A {Homo sapiens}Length = 257 Back     alignment and structure
>2hg4_A (A:550-674,A:746-852) DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5; 2.73A {Saccharopolyspora erythraea}Length = 232 Back     alignment and structure
>1mla_A (A:1-126,A:269-309) Malonyl-coenzyme A acyl carrier protein transacylase; acyltransferase; 1.50A {Escherichia coli}Length = 167 Back     alignment and structure
>2cuy_A (A:1-123,A:194-305) Malonyl COA-[acyl carrier protein] transacylase; transferase, structural genomics, NPPSFA; 2.10A {Thermus thermophilus HB8}Length = 235 Back     alignment and structure
>2uva_G (G:135-311,G:423-557) Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G*Length = 312 Back     alignment and structure
>2vz8_A (A:488-615,A:751-788) Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A*Length = 166 Back     alignment and structure
>3hhd_A (A:490-616,A:753-789) Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_ALength = 164 Back     alignment and structure
>2pff_B (B:1616-1771) Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae}Length = 156 Back     alignment and structure
>2qc3_A (A:1-128,A:196-303) MCT, malonyl COA-acyl carrier protein transacylase; malonyl-COA:ACP transacylase, , nucleophilic attack; 2.30A {Mycobacterium tuberculosis H37RV} PDB: 2qj3_ALength = 236 Back     alignment and structure
>1nm2_A (A:1-134,A:202-317) Malonyl COA:acyl carrier protein malonyltransferase; alpha/beta hydrolase-like core; 2.00A {Streptomyces coelicolor A3}Length = 250 Back     alignment and structure
>3g87_A (A:1-124,A:196-394) Malonyl COA-acyl carrier protein transacylase; ssgcid, niaid, decode biostructures, dried seaweed, acyltransferase, transferase; 2.30A {Burkholderia pseudomallei 1710B}Length = 323 Back     alignment and structure
>3k89_A (A:1-129,A:203-314) Malonyl COA-ACP transacylase; bacterial blight, XOO0880, FABD, xanthomonas oryzae PV. oryzae KACC10331; 1.60A {Xanthomonas oryzae PV} PDB: 3een_ALength = 241 Back     alignment and structure
>2qo3_A (A:531-660,A:730-836) Eryaii erythromycin polyketide synthase modules 3 and 4; ketosynthase, acyltransferase, phosphopantetheine; 2.59A {Saccharopolyspora erythraea}Length = 237 Back     alignment and structure
>2c2n_A (A:1-152,A:235-339) Malonyl COA-acyl carrier protein transacylase; mitochondrial, malonyltrasferase, fatty acid synthase alternative splicing, lipid synthesis; HET: AE4; 1.55A {Homo sapiens}Length = 257 Back     alignment and structure
>2hg4_A (A:550-674,A:746-852) DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5; 2.73A {Saccharopolyspora erythraea}Length = 232 Back     alignment and structure
>2cuy_A (A:1-123,A:194-305) Malonyl COA-[acyl carrier protein] transacylase; transferase, structural genomics, NPPSFA; 2.10A {Thermus thermophilus HB8}Length = 235 Back     alignment and structure
>3ezo_A (A:1-132,A:207-318) Malonyl COA-acyl carrier protein transacylase; ssgcid, acyl-carrier-protein S-malonyltransferase, acyltransferase, transferase; 2.05A {Burkholderia pseudomallei 1710B}Length = 244 Back     alignment and structure
>1mla_A (A:1-126,A:269-309) Malonyl-coenzyme A acyl carrier protein transacylase; acyltransferase; 1.50A {Escherichia coli}Length = 167 Back     alignment and structure
>2uv8_A (A:25-91) Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A*Length = 67 Back     alignment and structure
>1mla_A (A:127-268) Malonyl-coenzyme A acyl carrier protein transacylase; acyltransferase; 1.50A {Escherichia coli}Length = 142 Back     alignment and structure
>2uva_G (G:1863-1988) Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G*Length = 126 Back     alignment and structure
>2h1y_A (A:140-210,A:261-272) Malonyl coenzyme A-acyl carrier protein transacylase; FABD, MCAT, transferase; 2.50A {Helicobacter pylori SS1}Length = 83 Back     alignment and structure
>2uva_G (G:328-422) Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G*Length = 95 Back     alignment and structure
>3ezo_A (A:133-206) Malonyl COA-acyl carrier protein transacylase; ssgcid, acyl-carrier-protein S-malonyltransferase, acyltransferase, transferase; 2.05A {Burkholderia pseudomallei 1710B}Length = 74 Back     alignment and structure
>2pff_B (B:1801-1915) Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae}Length = 115 Back     alignment and structure
>2pff_B (B:334-428) Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae}Length = 95 Back     alignment and structure
>3k89_A (A:130-202) Malonyl COA-ACP transacylase; bacterial blight, XOO0880, FABD, xanthomonas oryzae PV. oryzae KACC10331; 1.60A {Xanthomonas oryzae PV} PDB: 3een_ALength = 73 Back     alignment and structure
>2c2n_A (A:153-234) Malonyl COA-acyl carrier protein transacylase; mitochondrial, malonyltrasferase, fatty acid synthase alternative splicing, lipid synthesis; HET: AE4; 1.55A {Homo sapiens}Length = 82 Back     alignment and structure
>2qc3_A (A:129-195) MCT, malonyl COA-acyl carrier protein transacylase; malonyl-COA:ACP transacylase, , nucleophilic attack; 2.30A {Mycobacterium tuberculosis H37RV} PDB: 2qj3_ALength = 67 Back     alignment and structure
>2cuy_A (A:124-193) Malonyl COA-[acyl carrier protein] transacylase; transferase, structural genomics, NPPSFA; 2.10A {Thermus thermophilus HB8}Length = 70 Back     alignment and structure