254780539

254780539

ABC transporter, membrane spanning protein (iron)

GeneID in NCBI database:8209535Locus tag:CLIBASIA_02130
Protein GI in NCBI database:254780539Protein Accession:YP_003064952.1
Gene range:-(741176, 741997)Protein Length:273aa
Gene description:ABC transporter, membrane spanning protein (iron)
COG prediction:[P] ABC-type Mn2+/Zn2+ transport systems, permease components
KEGG prediction:ABC transporter, membrane spanning protein (iron); K11605 manganese/iron transport system permease protein
SEED prediction:Manganese ABC transporter, inner membrane permease protein SitC
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM7 TM-Helix
TOPPRED7 TM-Helix
HMMTOP6 TM-Helix
MEMSAT9 TM-Helix
MEMSAT_SVM8 TM-Helix
PHOBIUS7 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
MINQILEPFTYNYMNTAIWMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGIVVCHRLNIPLSVGATISGMLATGIMVKIKETTKLREDVAIAVVYIIFYSFAMFMLSLSPSAVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISYFLDCSPGGIIVIIETSLFLLCLFFFSKQYRTS
cHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccc
cHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHEEEEccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEHEHcccccHHHHHHHHHHHHHHHHHHcccccccc
minqilepftynymNTAIWMSTLIGCVCGLLSAYLILKGWssigngishaiFPGIVVChrlniplsvgATISGMLATGIMVKIKETTKLREDVAIAVVYIIFYSFAMFMLSLSPSAVYVENIFLgntlsmsrsdTIQVLIITFSVACIVYMKWKDFVLLFFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISYFldcspggiIVIIETSLFLLCLFFfskqyrts
MINQILEPFTYNYMNTAIWMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGIVVCHRLNIPLSVGATISGMLATGIMVKIKETTKLREDVAIAVVYIIFYSFAMFMLSLSPSAVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISYFLDCSPGGIIVIIETSLFLLCLFFFSKQYRTS
MINQILEPFTYNYMNTAIWMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGIVVCHRLNIPLSVGATISGMLATGIMVKIKETTKLREDVAIAVVYIIFYSFAMFMLSLSPSAVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISYFLDCSPGGIIVIIETSlfllclfffSKQYRTS
MINQILEPFTYNYMNTAIWMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGIVVCHRLNIPLSVGATISGMLATGIMVKIKETTKLREDVAIAVVYIIFYSFAMFMLSLSPSAVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISYFLDCSPGGIIVIIETSLFLLCLFF*SKQ****
MINQILEPFTYNYMNTAIWMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGIVVCHRLNIPLSVGATISGMLATGIMVKIKETTKLREDVAIAVVYIIFYSFAMFMLSLSPSAVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISYFLDCSPGGIIVIIETSLFLLCLFFFSKQYRTS
MINQILEPFTYNYMNTAIWMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGIVVCHRLNIPLSVGATISGMLATGIMVKIKETTKLREDVAIAVVYIIFYSFAMFMLSLSPSAVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISYFLDCSPGGIIVIIETSLFLLCLFFFSK*****
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiii
xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiii
ooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiii
ooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHooooooo
ooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINQILEPFTYNYMNTAIWMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGIVVCHRLNIPLSVGATISGMLATGIMVKIKETTKLREDVAIAVVYIIFYSFAMFMLSLSPSAVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISYFLDCSPGGIIVIIETSLFLLCLFFFSKQYRTS
MINQILEPFTYNYMNTAIWMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGIVVCHRLNIPLSVGATISGMLATGIMVKIKETTKLREDVAIAVVYIIFYSFAMFMLSLSPSAVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISYFLDCSPGGIIVIIETSLFLLCLFFFSKQYRTS
MINQILEPFTYNYMNTAIWMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGIVVCHRLNIPLSVGATISGMLATGIMVKIKETTKLREDVAIAVVYIIFYSFAMFMLSLSPSAVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISYFLDCSPGGIIVIIETSLFLLCLFFFSKQYRTS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target273 ABC transporter, membrane spanning protein (iron) [Cand
254780540277 ABC transporter, membrane spanning protein (iron t 1e-36
254780719260 zinc uptake ABC transporter, permease protein [Can 5e-11
>gi|254780540|ref|YP_003064953.1| ABC transporter, membrane spanning protein (iron transport) [Candidatus Liberibacter asiaticus str. psy62] Length = 277 Back     alignment
 Score =  144 bits (364), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/260 (31%), Positives = 151/260 (58%)

Query: 2   INQILEPFTYNYMNTAIWMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGIVVCHRL 61
           ++ +L P T+  +  +  ++ ++     +LS ++ILK  S  G  ISH++ PGIV+ H  
Sbjct: 5   LHYVLLPLTFPAIQNSFIITVIVVIPMSVLSCFIILKNQSFAGEAISHSVLPGIVLSHMA 64

Query: 62  NIPLSVGATISGMLATGIMVKIKETTKLREDVAIAVVYIIFYSFAMFMLSLSPSAVYVEN 121
            IPL +GA I+GM+ T     +KE +  +ED+ +++V+   ++  + ++    S+++  +
Sbjct: 65  GIPLEIGAFIAGMICTLSAGYLKEKSYFQEDLVLSIVFSGMFAIGIILILKVHSSLHFSH 124

Query: 122 IFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFFDERHAHSVGINVKLLKMLFF 181
           I LG+ L +S+SD I      F     + +K  D +L+ FD  HAHS+ I +KLL   F 
Sbjct: 125 ILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIFDPMHAHSMQIPIKLLHYNFL 184

Query: 182 SLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISY 241
            +L++ IVI  +++GI+L  A ++ PGATA L+SK   T ++ S ++    + +G YIS+
Sbjct: 185 IVLSLIIVISLKSIGIILPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISF 244

Query: 242 FLDCSPGGIIVIIETSLFLL 261
           F++ +    +VI+    F++
Sbjct: 245 FINSAAAPTVVILMAIFFVV 264

>gi|254780719|ref|YP_003065132.1| zinc uptake ABC transporter, permease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 260 Back     alignment
 Score = 59.7 bits (143), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 119/242 (49%), Gaps = 3/242 (1%)

Query: 29  GLLSAYLILKGWSSIGNGISHAIFPGIVVCHRLNIPLSVGATISGMLATGIMVKIKETTK 88
           G L  ++I +  +  G+ I+H+   G+ +     +PL++   +   L + ++++I++   
Sbjct: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80

Query: 89  LREDVAIAVVYIIFYSFAMFMLS-LSPSAVYVENIFLGNTLSMSRSDTIQVLIITFSVAC 147
           L  D  + V+     S A+ +LS +      + +   G+ L+++ +D + +  I F    
Sbjct: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140

Query: 148 IVYMKWKDFVLLFFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITP 207
           I++  WK  +    +   A + G+  + +K++F  + ++ I +  + +GI L+ + +I P
Sbjct: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200

Query: 208 GATAKLMSKSFGTYLVSSSLLGATSSFLGSYISYFLDCSPGGIIVIIETSLFLLCLFFFS 267
             TA+  S S     + ++++G     +G Y S   D   G  I+I  TSLFL  L FF 
Sbjct: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIII--TSLFLFILSFFY 258

Query: 268 KQ 269
           K+
Sbjct: 259 KK 260

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target273 ABC transporter, membrane spanning protein (iron) [Cand
315122868281 ABC transporter, membrane spanning protein (iron) [Cand 1 1e-109
159186175286 ABC transporter, membrane spanning protein (iron) [Agro 1 7e-72
332717130286 iron ABC transporter, membrane spanning protein [Agroba 1 1e-71
241206143286 ABC transporter [Rhizobium leguminosarum bv. trifolii W 1 2e-69
15966781285 putative IRON transport system membrane ABC transporter 1 8e-69
227823619286 putative iron transmembrane ABC transporter component [ 1 1e-68
116253626286 iron ABC transporter [Rhizobium leguminosarum bv. vicia 1 1e-68
307316367285 ABC-3 protein [Sinorhizobium meliloti AK83] Length = 28 1 1e-68
90408803292 putative iron transport system membrane ABC transporter 1 4e-68
154245153294 ABC-3 protein [Xanthobacter autotrophicus Py2] Length = 1 9e-68
>gi|315122868|ref|YP_004063357.1| ABC transporter, membrane spanning protein (iron) [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 281 Back     alignment and organism information
 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 194/272 (71%), Positives = 235/272 (86%), Gaps = 1/272 (0%)

Query: 1   MINQILEPFTYNYMNTAIWMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGIVVCHR 60
           + + +LEPFTYNYM TAIW+S +IGCVCGLLS+YLILKGWSSIGNGISHAIF GIV C++
Sbjct: 10  LFDLLLEPFTYNYMTTAIWISMVIGCVCGLLSSYLILKGWSSIGNGISHAIFLGIVGCYK 69

Query: 61  LNIPLSVGATISGMLATGIMVKIKETTKLREDVAIAVVYIIFYSFAMFMLSLSPSAVYVE 120
           L IP+S+GAT+SGMLAT +M+KIKE TKLREDV+IAVVY+IFYSFAMF LSLSP+ VY+E
Sbjct: 70  LGIPMSIGATVSGMLATSLMIKIKEKTKLREDVSIAVVYLIFYSFAMFFLSLSPNDVYIE 129

Query: 121 NIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFFDERHAHSVGINVKLLKMLF 180
           ++FLGN L +S++D +QVL I F V  IV +K KDF+LLFFDE HAHS+G+NVK LK LF
Sbjct: 130 SVFLGNVLFLSKADILQVLFIAFLVLSIVLIKRKDFILLFFDEAHAHSIGMNVKFLKNLF 189

Query: 181 FSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYIS 240
           F+LLTIT+V+G QTVG+LLVIATVITPGATA+L++KSFG+YL  SS LGA S F G+Y S
Sbjct: 190 FALLTITVVVGLQTVGLLLVIATVITPGATARLLTKSFGSYLFLSSFLGAASGFFGAYTS 249

Query: 241 YFLDCSPGGIIVIIETSLFLLCLFFFSKQYRT 272
           YFLDC PGG+IV+IET+LFLL L +F KQ +T
Sbjct: 250 YFLDCGPGGMIVLIETALFLLSLLYF-KQCKT 280


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159186175|ref|NP_356188.2| ABC transporter, membrane spanning protein (iron) [Agrobacterium tumefaciens str. C58] Length = 286 Back     alignment and organism information
>gi|332717130|ref|YP_004444596.1| iron ABC transporter, membrane spanning protein [Agrobacterium sp. H13-3] Length = 286 Back     alignment and organism information
>gi|241206143|ref|YP_002977239.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 286 Back     alignment and organism information
>gi|15966781|ref|NP_387134.1| putative IRON transport system membrane ABC transporter protein [Sinorhizobium meliloti 1021] Length = 285 Back     alignment and organism information
>gi|227823619|ref|YP_002827592.1| putative iron transmembrane ABC transporter component [Sinorhizobium fredii NGR234] Length = 286 Back     alignment and organism information
>gi|116253626|ref|YP_769464.1| iron ABC transporter [Rhizobium leguminosarum bv. viciae 3841] Length = 286 Back     alignment and organism information
>gi|307316367|ref|ZP_07595811.1| ABC-3 protein [Sinorhizobium meliloti AK83] Length = 285 Back     alignment and organism information
>gi|90408803|ref|ZP_01216947.1| putative iron transport system membrane ABC transporter protein [Psychromonas sp. CNPT3] Length = 292 Back     alignment and organism information
>gi|154245153|ref|YP_001416111.1| ABC-3 protein [Xanthobacter autotrophicus Py2] Length = 294 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target273 ABC transporter, membrane spanning protein (iron) [Cand
COG1108274 COG1108, ZnuB, ABC-type Mn2+/Zn2+ transport systems, pe 2e-44
TIGR03770270 TIGR03770, anch_rpt_perm, anchored repeat-type ABC tran 6e-30
cd06550261 cd06550, TM_ABC_iron-siderophores_like, Transmembrane s 2e-23
PRK09543261 PRK09543, znuB, high-affinity zinc transporter membrane 4e-06
pfam00950258 pfam00950, ABC-3, ABC 3 transport family 6e-51
pfam01032312 pfam01032, FecCD, FecCD transport family 0.004
>gnl|CDD|31305 COG1108, ZnuB, ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163482 TIGR03770, anch_rpt_perm, anchored repeat-type ABC transporter, permease subunit Back     alignment and domain information
>gnl|CDD|119348 cd06550, TM_ABC_iron-siderophores_like, Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+ Back     alignment and domain information
>gnl|CDD|181938 PRK09543, znuB, high-affinity zinc transporter membrane component; Reviewed Back     alignment and domain information
>gnl|CDD|109985 pfam00950, ABC-3, ABC 3 transport family Back     alignment and domain information
>gnl|CDD|144573 pfam01032, FecCD, FecCD transport family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 273 ABC transporter, membrane spanning protein (iron) [Cand
COG1108274 ZnuB ABC-type Mn2+/Zn2+ transport systems, permease com 100.0
pfam00950258 ABC-3 ABC 3 transport family. 100.0
PRK09543261 znuB high-affinity zinc transporter membrane component; 100.0
cd06550261 TM_ABC_iron-siderophores_like Transmembrane subunit (TM 100.0
PRK10440330 iron-enterobactin transporter permease; Provisional 99.93
PRK10577666 iron-hydroxamate transporter permease subunit; Provisio 99.93
PRK10441335 iron-enterobactin transporter membrane protein; Provisi 99.92
PRK03784330 vtamin B12-transporter permease; Provisional 99.92
PRK09777318 fecD iron-dicitrate transporter subunit FecD; Reviewed 99.92
PRK09535366 btuC corrinoid ABC transporter permease; Reviewed 99.91
PRK10577 666 iron-hydroxamate transporter permease subunit; Provisio 99.91
COG0609334 FepD ABC-type Fe3+-siderophore transport system, permea 99.9
pfam01032312 FecCD FecCD transport family. This is a sub-family of b 99.89
PRK11228323 fecC iron-dicitrate transporter permease subunit; Provi 99.89
COG4606321 CeuB ABC-type enterochelin transport system, permease c 99.35
COG4139326 BtuC ABC-type cobalamin transport system, permease comp 98.83
COG4120293 ABC-type uncharacterized transport system, permease com 97.17
COG4779346 FepG ABC-type enterobactin transport system, permease c 99.46
COG4605316 CeuC ABC-type enterochelin transport system, permease c 98.91
pfam02653267 BPD_transp_2 Branched-chain amino acid transport system 97.05
COG1172316 AraH Ribose/xylose/arabinose/galactoside ABC-type trans 96.46
COG4603356 ABC-type uncharacterized transport system, permease com 92.65
TIGR03622283 urea_t_UrtB_arc urea ABC transporter, permease protein 97.9
cd06582272 TM_PBP1_LivH_like Transmembrane subunit (TM) of Escheri 97.48
cd06581268 TM_PBP1_LivM_like Transmembrane subunit (TM) of Escheri 97.44
PRK10740308 branched-chain amino acid transporter permease subunit 97.21
PRK11301416 livM leucine/isoleucine/valine transporter permease sub 96.32
cd06580234 TM_PBP1_transp_TpRbsC_like Transmembrane subunit (TM) o 95.2
TIGR03409291 urea_trans_UrtB urea ABC transporter, permease protein 95.07
PRK09512321 rbsC ribose ABC transporter permease protein; Reviewed 94.54
TIGR03408313 urea_trans_UrtC urea ABC transporter, permease protein 94.41
cd06574266 TM_PBP1_branched-chain-AA_like Transmembrane subunit (T 97.47
cd06579263 TM_PBP1_transp_AraH_like Transmembrane subunit (TM) of 97.42
PRK09478336 mglC beta-methylgalactoside transporter inner membrane 94.58
PRK09699325 D-allose transporter subunit; Provisional 96.95
PRK11285327 araH L-arabinose transporter permease protein; Provisio 96.01
COG0559297 LivH Branched-chain amino acid ABC-type transport syste 95.66
>COG1108 ZnuB ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam00950 ABC-3 ABC 3 transport family Back     alignment and domain information
>PRK09543 znuB high-affinity zinc transporter membrane component; Reviewed Back     alignment and domain information
>cd06550 TM_ABC_iron-siderophores_like Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+ Back     alignment and domain information
>PRK10440 iron-enterobactin transporter permease; Provisional Back     alignment and domain information
>PRK10577 iron-hydroxamate transporter permease subunit; Provisional Back     alignment and domain information
>PRK10441 iron-enterobactin transporter membrane protein; Provisional Back     alignment and domain information
>PRK03784 vtamin B12-transporter permease; Provisional Back     alignment and domain information
>PRK09777 fecD iron-dicitrate transporter subunit FecD; Reviewed Back     alignment and domain information
>PRK09535 btuC corrinoid ABC transporter permease; Reviewed Back     alignment and domain information
>PRK10577 iron-hydroxamate transporter permease subunit; Provisional Back     alignment and domain information
>COG0609 FepD ABC-type Fe3+-siderophore transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam01032 FecCD FecCD transport family Back     alignment and domain information
>PRK11228 fecC iron-dicitrate transporter permease subunit; Provisional Back     alignment and domain information
>COG4606 CeuB ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4139 BtuC ABC-type cobalamin transport system, permease component [Coenzyme metabolism] Back     alignment and domain information
>COG4120 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4779 FepG ABC-type enterobactin transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4605 CeuC ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam02653 BPD_transp_2 Branched-chain amino acid transport system / permease component Back     alignment and domain information
>COG1172 AraH Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4603 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR03622 urea_t_UrtB_arc urea ABC transporter, permease protein UrtB Back     alignment and domain information
>cd06582 TM_PBP1_LivH_like Transmembrane subunit (TM) of Escherichia coli LivH and related proteins Back     alignment and domain information
>cd06581 TM_PBP1_LivM_like Transmembrane subunit (TM) of Escherichia coli LivM and related proteins Back     alignment and domain information
>PRK10740 branched-chain amino acid transporter permease subunit LivH; Reviewed Back     alignment and domain information
>PRK11301 livM leucine/isoleucine/valine transporter permease subunit; Provisional Back     alignment and domain information
>cd06580 TM_PBP1_transp_TpRbsC_like Transmembrane subunit (TM) of Treponema pallidum (Tp) RbsC-1, RbsC-2 and related proteins Back     alignment and domain information
>TIGR03409 urea_trans_UrtB urea ABC transporter, permease protein UrtB Back     alignment and domain information
>PRK09512 rbsC ribose ABC transporter permease protein; Reviewed Back     alignment and domain information
>TIGR03408 urea_trans_UrtC urea ABC transporter, permease protein UrtC Back     alignment and domain information
>cd06574 TM_PBP1_branched-chain-AA_like Transmembrane subunit (TM) of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which are involved in the uptake of branched-chain amino acids (AAs), as well as TMs of transporters involved in the uptake of monosaccharides including ribose, galactose, and arabinose Back     alignment and domain information
>cd06579 TM_PBP1_transp_AraH_like Transmembrane subunit (TM) of Escherichia coli AraH and related proteins Back     alignment and domain information
>PRK09478 mglC beta-methylgalactoside transporter inner membrane component; Provisional Back     alignment and domain information
>PRK09699 D-allose transporter subunit; Provisional Back     alignment and domain information
>PRK11285 araH L-arabinose transporter permease protein; Provisional Back     alignment and domain information
>COG0559 LivH Branched-chain amino acid ABC-type transport system, permease components [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target273 ABC transporter, membrane spanning protein (iron) [Cand
2nq2_A337 Hypothetical ABC transporter permease protein HI1471; p 99.9
2qi9_A326 Vitamin B12 import system permease protein BTUC; inner 99.87
>2nq2_A Hypothetical ABC transporter permease protein HI1471; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
Probab=99.90  E-value=3.1e-21  Score=137.27  Aligned_cols=248  Identities=15%  Similarity=0.145  Sum_probs=182.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHHCCCCH---HHHHHHHHHHHHHHHHHHHC-
Q ss_conf             9999999999877799999965899632--------48999999999998314414---56899999999999986310-
Q gi|254780539|r   18 IWMSTLIGCVCGLLSAYLILKGWSSIGN--------GISHAIFPGIVVCHRLNIPL---SVGATISGMLATGIMVKIKE-   85 (273)
Q Consensus        18 ll~~~li~~~~~~lG~~~v~r~~s~~~~--------alsH~~l~Giala~~l~~~~---~~ga~~~~ll~~~li~~l~~-   85 (273)
                      .+++.++|...+.-|...    |+...+        +++..+-.|++++.+++.+.   ......++.........+.. 
T Consensus        66 ~l~a~l~Ga~LavaG~ll----Q~~~rNpLA~P~iLGissGA~lg~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  141 (337)
T 2nq2_A           66 ILTALCVGAGLALSGVVL----QGIFRNPLVNPHIIGVTSGSAFGGTLAIFFGFSLYGLFTSTILFGFGTLALVFLFSFK  141 (337)
T ss_dssp             HHHHHHHHHHHHHHHHHH----HHHTTCTTCCTTTTSHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHHH----HHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999----9865799999066548999999999999984002257899999999999999999996


Q ss_pred             CCCCCHH--HHHHHHHHHHHHHHHHHH-HHHCC---CCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2465115--689999999999999975-21102---22421121153100270001357887679999999988878887
Q gi|254780539|r   86 TTKLRED--VAIAVVYIIFYSFAMFML-SLSPS---AVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLL  159 (273)
Q Consensus        86 ~~~~~~d--~~igi~~~~~~algvlli-s~~~~---~~~l~~~LfG~il~i~~~di~~~~~~~~i~~~~~~~~~r~l~~~  159 (273)
                      +++.+..  ..+|+..+..++....+. ....+   ..+...|++||....+|+|++...+...+......+..|+++..
T Consensus       142 ~~~~~~~~liL~gi~~~~~~~a~~~~~~~l~~~~~~~~~~~~W~~Gs~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~~l  221 (337)
T 2nq2_A          142 FNQRSLLMLILIGMILSGLFSALVSLLQYISDTEEKLPSIVFWLMGSFATSNWEKLLFFFVPFLLCSSILLSLSWRLNLL  221 (337)
T ss_dssp             ----CHHHHHHHHHHHHHHHHHHHHHHHHSSCTTTHHHHHHHHTTCCSTTCCHHHHHHHHHHHHHHHHHHHHTTTGGGGG
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHCCCCHH
T ss_conf             47787217787679999999999999999722488999999985014356884321331121147888888863005621


Q ss_pred             HCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             24688998717871046779999999999999999899999999999999998520898999999999999999999999
Q gi|254780539|r  160 FFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYI  239 (273)
Q Consensus       160 sfD~~~A~~~Gi~v~~~~~l~l~l~al~v~~~v~~vG~llv~allv~Paa~A~~~~~~~~~~~~~s~~~g~~~~~~G~~l  239 (273)
                      .+|||.|++.|+|+++.+...+.+.++.++.++..+|.+-+.++ +.|+.+.+...+++++.++.|.+.|..-......+
T Consensus       222 ~lG~~~A~sLGv~v~~~r~~~l~l~~llta~~vs~~G~I~FvGL-i~Phiar~l~g~~~~~~l~~s~l~Ga~lll~aD~i  300 (337)
T 2nq2_A          222 SLDEKEAKALGVKMAPLRWLVIFLSGSLVACQVAISGSIGWVGL-IIPHLSRMLVGANHQSLLPCTMLVGATYMLLVDNV  300 (337)
T ss_dssp             GSCHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHCCCCSSTT-HHHHHHHHHHCSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEHHH-HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             07938898789979999999999999999999963776303874-09999999818885339999999999999999999


Q ss_pred             HHHH---CCCCHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             9995---7981899999999999999998042445
Q gi|254780539|r  240 SYFL---DCSPGGIIVIIETSLFLLCLFFFSKQYR  271 (273)
Q Consensus       240 S~~~---~lp~g~~Iv~~~~~~f~~~~~~~~~~~r  271 (273)
                      +...   ++|.|-. ..+.+..|++.++..+||++
T Consensus       301 ~r~l~p~elPvG~v-taliG~p~fl~ll~r~~r~g  334 (337)
T 2nq2_A          301 ARSLSDAEIPISIL-TALIGAPLFGVLVYKLKRGG  334 (337)
T ss_dssp             HHHSCSSCCCHHHH-HHHHHHHHHHHHHHCC----
T ss_pred             HHHCCCCCEEHHHH-HHHHHHHHHHHHHHHHHCCC
T ss_conf             86656777319999-99999999999999852077



>2qi9_A Vitamin B12 import system permease protein BTUC; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target273 ABC transporter, membrane spanning protein (iron) [Cand
d1l7va_324 ABC transporter involved in vitamin B12 uptake, BtuC {E 99.87
>d1l7va_ f.22.1.1 (A:) ABC transporter involved in vitamin B12 uptake, BtuC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: ABC transporter involved in vitamin B12 uptake, BtuC
superfamily: ABC transporter involved in vitamin B12 uptake, BtuC
family: ABC transporter involved in vitamin B12 uptake, BtuC
domain: ABC transporter involved in vitamin B12 uptake, BtuC
species: Escherichia coli [TaxId: 562]
Probab=99.87  E-value=1.4e-19  Score=126.62  Aligned_cols=241  Identities=14%  Similarity=0.162  Sum_probs=173.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHHCCCC------HHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999877799999965899632--------4899999999999831441------4568999999999999863
Q gi|254780539|r   18 IWMSTLIGCVCGLLSAYLILKGWSSIGN--------GISHAIFPGIVVCHRLNIP------LSVGATISGMLATGIMVKI   83 (273)
Q Consensus        18 ll~~~li~~~~~~lG~~~v~r~~s~~~~--------alsH~~l~Giala~~l~~~------~~~ga~~~~ll~~~li~~l   83 (273)
                      .+++.++|...+.-|...    |....+        +++..+-.|++++..++..      ....++..+..........
T Consensus        60 ~l~a~l~Ga~La~sG~~l----Q~~~rNpLA~P~ilGissGA~l~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  135 (324)
T d1l7va_          60 TLAVLLVGAALAISGAVM----QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLCAIAGALIITLILLRF  135 (324)
T ss_dssp             HHHHHHHHHHHHHHHHHH----HHHHTCTTCCTTTTTHHHHHHHHHHHHHHTSCTTCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH----HHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999----9981798878367875428899999999723322578899999999999999999998


Q ss_pred             HCCCCCCHH-HHHHHHHHHHHHHHHH-HHHHHC-C-CCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             102465115-6899999999999999-752110-2-22421121153100270001357887679999999988878887
Q gi|254780539|r   84 KETTKLRED-VAIAVVYIIFYSFAMF-MLSLSP-S-AVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLL  159 (273)
Q Consensus        84 ~~~~~~~~d-~~igi~~~~~~algvl-lis~~~-~-~~~l~~~LfG~il~i~~~di~~~~~~~~i~~~~~~~~~r~l~~~  159 (273)
                      ++++..+.. ...|+..+..++...- +....+ . ..+...|+.|+....+|+|++...+...+.. ...+..|+++..
T Consensus       136 ~~~~~~~~~liL~Gi~i~~~~~a~~~~l~~~~~~~~~~~~~~w~~Gs~~~~~~~~~~~~~~~~~~~~-~~~~~~~~L~~L  214 (324)
T d1l7va_         136 ARRHLSTSRLLLAGVALGIICSALMTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQSWLMLALIPVLL-WICCQSRPMNML  214 (324)
T ss_dssp             HHHTCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHTCCCTTCCGGGHHHHHHHHHHHH-HHHHCHHHHHHH
T ss_pred             HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHH-HHHHHHHHHHHH
T ss_conf             6146881367788999999999999999995479999999999765004453203577887518999-999998446655


Q ss_pred             HCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             24688998717871046779999999999999999899999999999999998520898999999999999999999999
Q gi|254780539|r  160 FFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYI  239 (273)
Q Consensus       160 sfD~~~A~~~Gi~v~~~~~l~l~l~al~v~~~v~~vG~llv~allv~Paa~A~~~~~~~~~~~~~s~~~g~~~~~~G~~l  239 (273)
                      +.|||.|++.|+|+++++...+...++.++.++..+|.+-+.++ +.|+.+.+...+++|+.++.|.++|......+..+
T Consensus       215 ~lgd~~A~sLGv~v~~~r~~~l~~~~ll~a~~va~~G~I~FvGL-i~PhiaR~l~g~~~~~~lp~s~l~Ga~lll~aD~l  293 (324)
T d1l7va_         215 ALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGL-VIPHILRLCGLTDHRVLLPGCALAGASALLLADIV  293 (324)
T ss_dssp             HHCHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHCCCCSSSS-HHHHHHHHTTCCSHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH-HHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             30368887068666777799999999999999972364455587-57999998607775179999999999999999999


Q ss_pred             HHHH----CCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9995----7981899999999999999998
Q gi|254780539|r  240 SYFL----DCSPGGIIVIIETSLFLLCLFF  265 (273)
Q Consensus       240 S~~~----~lp~g~~Iv~~~~~~f~~~~~~  265 (273)
                      +...    ++|.|- ++.+.+..|++.++.
T Consensus       294 ~r~i~~p~eiPvGv-italiG~P~fi~Ll~  322 (324)
T d1l7va_         294 ARLALAAAELPIGV-VTATLGAPVFIWLLL  322 (324)
T ss_dssp             HHHSCSSSCCCHHH-HHHHHHHHHHHHHHH
T ss_pred             HHHHCCCCCCHHHH-HHHHHHHHHHHHHHH
T ss_conf             97604665632999-999999999999998



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target273 ABC transporter, membrane spanning protein (iron) [Cand
2qi9_A_326 Vitamin B12 import system permease protein BTUC; i 99.9
2nq2_A_94-261168 Hypothetical ABC transporter permease protein HI14 99.66
2nq2_A_1-93_262-307139 Hypothetical ABC transporter permease protein HI14 93.33
>2qi9_A (A:) Vitamin B12 import system permease protein BTUC; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_A* Back     alignment and structure
Probab=99.90  E-value=7.9e-22  Score=141.54  Aligned_cols=250  Identities=12%  Similarity=0.081  Sum_probs=194.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HCC-----CCHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             999999999987779999996589963248999999999998----314-----41456899999999999986310246
Q gi|254780539|r   18 IWMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGIVVCH----RLN-----IPLSVGATISGMLATGIMVKIKETTK   88 (273)
Q Consensus        18 ll~~~li~~~~~~lG~~~v~r~~s~~~~alsH~~l~Giala~----~l~-----~~~~~ga~~~~ll~~~li~~l~~~~~   88 (273)
                      .++..++|...+.-|...-..-+.-++|.--+..-.|..++.    ++.     .....+++..+...........++++
T Consensus        60 ~l~a~l~G~~LavsG~~~Q~~~rNpLa~P~ilGi~sga~l~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  139 (326)
T 2qi9_A           60 TLAVLLVGAALAISGAVXQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLSAIAGALIITLILLRFARRH  139 (326)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTTCSSCCGGGGTHHHHHHHHHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999936987674245402589999999998245402789999999999999999999876213


Q ss_pred             CCHHHHH--HHHHHHHHH-HHHHHHHHHCC-CCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHH
Q ss_conf             5115689--999999999-99997521102-2242112115310027000135788767999999998887888724688
Q gi|254780539|r   89 LREDVAI--AVVYIIFYS-FAMFMLSLSPS-AVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFFDER  164 (273)
Q Consensus        89 ~~~d~~i--gi~~~~~~a-lgvllis~~~~-~~~l~~~LfG~il~i~~~di~~~~~~~~i~~~~~~~~~r~l~~~sfD~~  164 (273)
                      .+.+..+  |+..+..++ ...++....+. ..+...++.|+....+|+|++...+...+......+.+|++...++|||
T Consensus       140 ~~~~~lil~gi~~~~~~~a~~~~l~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~l~lg~~  219 (326)
T 2qi9_A          140 LSTSRLLLAGVALGIISSALXTWAIYFSTSVDLRQLXYWXXGGFGGVDWRQSWLXLALIPVLLWISSQSRPXNXLALGEI  219 (326)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHTCCTTHHHHHHHHHTCCCTTCCGGGHHHHTTTHHHHHHHTTCHHHHHHHHTCHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             56405678999999999999999999840799999999876402546742325678750689999998767665441066


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH---
Q ss_conf             99871787104677999999999999999989999999999999999852089899999999999999999999999---
Q gi|254780539|r  165 HAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISY---  241 (273)
Q Consensus       165 ~A~~~Gi~v~~~~~l~l~l~al~v~~~v~~vG~llv~allv~Paa~A~~~~~~~~~~~~~s~~~g~~~~~~G~~lS~---  241 (273)
                      .|++.|+|+++++...+.+.++.++.++..+|.+.+.|+ +.|+.+.+...++.++.++.+.+.|......+..++.   
T Consensus       220 ~A~slGv~v~~~~~~~lil~~~lta~~vs~vG~I~FvGL-i~p~iar~l~~~~~~~~l~~s~l~Ga~lll~~d~l~r~~~  298 (326)
T 2qi9_A          220 SARQLGLPLWFWRNVLVAATGWXVGVSVALAGAIGFIGL-VIPHILRLSGLTDHRVLLPGCALAGASALLLADIVARLAL  298 (326)
T ss_dssp             HHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHCCCCSSTT-HHHHHHHTTTCCSHHHHHHHHHHHHHHHHHHHHHHHHSSS
T ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH-HHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             777068776676689999999999999970358889898-6899999862776546999999999999999999996605


Q ss_pred             -HHCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             -9579818999999999999999980424
Q gi|254780539|r  242 -FLDCSPGGIIVIIETSLFLLCLFFFSKQ  269 (273)
Q Consensus       242 -~~~lp~g~~Iv~~~~~~f~~~~~~~~~~  269 (273)
                       ..+.|.|..+.++. ..|++.++.++||
T Consensus       299 ~~~eiPvg~~~~liG-~p~fi~ll~k~~k  326 (326)
T 2qi9_A          299 AAAELPIGVVTATLG-APVFIWLLLKAGR  326 (326)
T ss_dssp             TTCCCCHHHHHHHHH-HHHHHHHHSCC--
T ss_pred             CCCCCHHHHHHHHHH-HHHHHHHHHHCCC
T ss_conf             666631999999999-9999997620479



>2nq2_A (A:94-261) Hypothetical ABC transporter permease protein HI1471; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2nq2_A (A:1-93,A:262-307) Hypothetical ABC transporter permease protein HI1471; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure