254780540

254780540

ABC transporter, membrane spanning protein (iron transport)

GeneID in NCBI database:8209536Locus tag:CLIBASIA_02135
Protein GI in NCBI database:254780540Protein Accession:YP_003064953.1
Gene range:-(740290, 741123)Protein Length:277aa
Gene description:ABC transporter, membrane spanning protein (iron transport)
COG prediction:[P] ABC-type Mn2+/Zn2+ transport systems, permease components
KEGG prediction:ABC transporter, membrane spanning protein (iron transport); K11606 manganese/iron transport system permease protein
SEED prediction:Manganese ABC transporter, inner membrane permease protein SitD
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM8 TM-Helix
TOPPRED7 TM-Helix
HMMTOP7 TM-Helix
MEMSAT9 TM-Helix
MEMSAT_SVM8 TM-Helix
PHOBIUS8 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MSSFLHYVLLPLTFPAIQNSFIITVIVVIPMSVLSCFIILKNQSFAGEAISHSVLPGIVLSHMAGIPLEIGAFIAGMICTLSAGYLKEKSYFQEDLVLSIVFSGMFAIGIILILKVHSSLHFSHILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIFDPMHAHSMQIPIKLLHYNFLIVLSLIIVISLKSIGIILPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISFFINSAAAPTVVILMAIFFVVVYAYSIIINKRTA
ccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccc
cHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcEEEEEEccccccHHEEEcccEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHccc
mssflhyvllpltfpaiqnSFIITVIVVIPMSVLSCFIILknqsfageaishsvlpgivlshmagipLEIGAFIAGMICTLSAGYLKEKSYFQEDLVLSIVFSGMFAIGIILILKVHSSLHFSHILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIfdpmhahsmqipIKLLHYNFLIVLSLIIVISLKSigiilppavlvlpGATAFLLSKHHTTMILLSVIISVVCTLVGIYISFFINSAAAPTVVILMAIFFVVVYAYSIIINKRTA
MSSFLHYVLLPLTFPAIQNSFIITVIVVIPMSVLSCFIILKNQSFAGEAISHSVLPGIVLSHMAGIPLEIGAFIAGMICTLSAGYLKEKSYFQEDLVLSIVFSGMFAIGIILILKVHSSLHFSHILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIFDPMHAHSMQIPIKLLHYNFLIVLSLIIVISLKSIGIILPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISFFINSAAAPTVVILMAIFFVVVYAYSIIINKRTA
MSSFLHYVLLPLTFPAIQNSFIITVIVVIPMSVLSCFIILKNQSFAGEAISHSVLPGIVLSHMAGIPLEIGAFIAGMICTLSAGYLKEKSYFQEDLVLSIVFSGMFAIGIILILKVHSSLHFSHILLGDMLGISKSDiittaffafisisflilKKNDLLLMIFDPMHAHSMQIPIKLLHYNFlivlsliivislksigiilPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISFFINSAAAPTVVILMAIFFVVVYAYSIIINKRTA
*SSFLHYVLLPLTFPAIQNSFIITVIVVIPMSVLSCFIILKNQSFAGEAISHSVLPGIVLSHMAGIPLEIGAFIAGMICTLSAGYLKEKSYFQEDLVLSIVFSGMFAIGIILILKVHSSLHFSHILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIFDPMHAHSMQIPIKLLHYNFLIVLSLIIVISLKSIGIILPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISFFINSAAAPTVVILMAIFFVVVYAYSIIINK***
MSSFLHYVLLPLTFPAIQNSFIITVIVVIPMSVLSCFIILKNQSFAGEAISHSVLPGIVLSHMAGIPLEIGAFIAGMICTLSAGYLKEKSYFQEDLVLSIVFSGMFAIGIILILKVHSSLHFSHILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIFDPMHAHSMQIPIKLLHYNFLIVLSLIIVISLKSIGIILPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISFFINSAAAPTVVILMAIFFVVVYAYSIIINKRTA
MSSFLHYVLLPLTFPAIQNSFIITVIVVIPMSVLSCFIILKNQSFAGEAISHSVLPGIVLSHMAGIPLEIGAFIAGMICTLSAGYLKEKSYFQEDLVLSIVFSGMFAIGIILILKVHSSLHFSHILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIFDPMHAHSMQIPIKLLHYNFLIVLSLIIVISLKSIGIILPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISFFINSAAAPTVVILMAIFFVVVYAYSIIINKR**
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiii
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
ooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiii
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiii
oooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSFLHYVLLPLTFPAIQNSFIITVIVVIPMSVLSCFIILKNQSFAGEAISHSVLPGIVLSHMAGIPLEIGAFIAGMICTLSAGYLKEKSYFQEDLVLSIVFSGMFAIGIILILKVHSSLHFSHILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIFDPMHAHSMQIPIKLLHYNFLIVLSLIIVISLKSIGIILPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISFFINSAAAPTVVILMAIFFVVVYAYSIIINKRTA
MSSFLHYVLLPLTFPAIQNSFIITVIVVIPMSVLSCFIILKNQSFAGEAISHSVLPGIVLSHMAGIPLEIGAFIAGMICTLSAGYLKEKSYFQEDLVLSIVFSGMFAIGIILILKVHSSLHFSHILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIFDPMHAHSMQIPIKLLHYNFLIVLSLIIVISLKSIGIILPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISFFINSAAAPTVVILMAIFFVVVYAYSIIINKRTA
MSSFLHYVLLPLTFPAIQNSFIITVIVVIPMSVLSCFIILKNQSFAGEAISHSVLPGIVLSHMAGIPLEIGAFIAGMICTLSAGYLKEKSYFQEDLVLSIVFSGMFAIGIILILKVHSSLHFSHILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIFDPMHAHSMQIPIKLLHYNFLIVLSLIIVISLKSIGIILPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISFFINSAAAPTVVILMAIFFVVVYAYSIIINKRTA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target277 ABC transporter, membrane spanning protein (iron transp
254780539273 ABC transporter, membrane spanning protein (iron) 1e-36
254780719260 zinc uptake ABC transporter, permease protein [Can 3e-15
>gi|254780539|ref|YP_003064952.1| ABC transporter, membrane spanning protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 273 Back     alignment
 Score =  144 bits (363), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 148/253 (58%)

Query: 5   LHYVLLPLTFPAIQNSFIITVIVVIPMSVLSCFIILKNQSFAGEAISHSVLPGIVLSHMA 64
           ++ +L P T+  +  +  ++ ++     +LS ++ILK  S  G  ISH++ PGIV+ H  
Sbjct: 2   INQILEPFTYNYMNTAIWMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGIVVCHRL 61

Query: 65  GIPLEIGAFIAGMICTLSAGYLKEKSYFQEDLVLSIVFSGMFAIGIILILKVHSSLHFSH 124
            IPL +GA I+GM+ T     +KE +  +ED+ +++V+   ++  + ++    S+++  +
Sbjct: 62  NIPLSVGATISGMLATGIMVKIKETTKLREDVAIAVVYIIFYSFAMFMLSLSPSAVYVEN 121

Query: 125 ILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIFDPMHAHSMQIPIKLLHYNFL 184
           I LG+ L +S+SD I      F     + +K  D +L+ FD  HAHS+ I +KLL   F 
Sbjct: 122 IFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFFDERHAHSVGINVKLLKMLFF 181

Query: 185 IVLSLIIVISLKSIGIILPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISF 244
            +L++ IVI  +++GI+L  A ++ PGATA L+SK   T ++ S ++    + +G YIS+
Sbjct: 182 SLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISY 241

Query: 245 FINSAAAPTVVIL 257
           F++ +    +VI+
Sbjct: 242 FLDCSPGGIIVII 254

>gi|254780719|ref|YP_003065132.1| zinc uptake ABC transporter, permease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 260 Back     alignment
 Score = 73.6 bits (179), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 126/247 (51%), Gaps = 7/247 (2%)

Query: 27  VVIPMSVLSCFIILKNQSFAGEAISHSVLPGIVLSHMAGIPLEIGAFIAGMICTLSAGYL 86
           +V+    L CFII +  ++ G+ I+HS L G+ LS +  +PL I  F+   + +L    +
Sbjct: 16  IVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQI 75

Query: 87  KEKSYFQEDLVLSIVFSGMFAIG-IILILKVHSSLHFSHILLGDMLGISKSDIITTAFFA 145
           ++      D +L ++     ++  +IL      +   +  L GD+L ++ +DI+      
Sbjct: 76  QKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIG 135

Query: 146 FISISFLILKKNDLLLMI--FDPMHAHSMQ-IPIKLLHYNFLIVLSLIIVISLKSIGIIL 202
           F++I  L      LL     ++   A  MQ   IKL+   F+++ SL+I +S+K IGI L
Sbjct: 136 FLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI---FIMITSLMISVSIKFIGITL 192

Query: 203 PPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISFFINSAAAPTVVILMAIFF 262
             ++L+LP  TA   S     M +L+ II ++  ++G+Y S   ++ + P+++I     F
Sbjct: 193 ITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLF 252

Query: 263 VVVYAYS 269
           ++ + Y 
Sbjct: 253 ILSFFYK 259

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target277 ABC transporter, membrane spanning protein (iron transp
315122869284 ABC transporter, membrane spanning protein (iron transp 1 1e-110
332717129284 iron ABC transporter, membrane spanning protein [Agroba 1 7e-74
15890517284 ABC transporter, membrane spanning protein (iron transp 1 6e-72
330448498287 fecCD transport family protein [Photobacterium leiognat 1 1e-69
294141799305 iron (chelated) ABC transporter permease protein [Shewa 1 2e-69
89072902285 putative iron transport system membrane abc transporter 1 2e-68
153011022282 ABC-3 protein [Ochrobactrum anthropi ATCC 49188] Length 1 3e-68
90408804283 hypothetical protein PCNPT3_07660 [Psychromonas sp. CNP 1 1e-67
90577474285 putative iron transport system membrane abc transporter 1 2e-67
116253627281 iron transmembrane ABC transporter component [Rhizobium 1 2e-67
>gi|315122869|ref|YP_004063358.1| ABC transporter, membrane spanning protein (iron transport) [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 284 Back     alignment and organism information
 Score =  400 bits (1029), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 212/276 (76%), Positives = 252/276 (91%), Gaps = 1/276 (0%)

Query: 1   MSSFLHYVLLPLTFPAIQNSFIITVIVVIPMSVLSCFIILKNQSFAGEAISHSVLPGIVL 60
           M + +HY+L PLTF AI N F+I+++VVIPMS+LSCFIILKNQSF GEAI+HSVLPGIVL
Sbjct: 1   MENLIHYILFPLTFTAILNGFLISLLVVIPMSILSCFIILKNQSFVGEAIAHSVLPGIVL 60

Query: 61  SHMAGIPLEIGAFIAGMICTLSAGYLKEKSYFQEDLVLSIVFSGMFAIGIILILKVHSSL 120
           +H+AGI L IGAFIA ++CTL +GYLKEK  F+ED++LSIVFS MFAIGIIL+LKV S++
Sbjct: 61  AHIAGISLGIGAFIAAIVCTLCSGYLKEKINFKEDILLSIVFSSMFAIGIILMLKVQSAV 120

Query: 121 HFSHILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIFDPMHAHSMQIPIKLLH 180
           HF+HILLGDMLGISKSDII TAFF+F+S+SFLILKKNDLLL+IFDPMHA S+QIPIKLLH
Sbjct: 121 HFNHILLGDMLGISKSDIIETAFFSFLSLSFLILKKNDLLLIIFDPMHARSVQIPIKLLH 180

Query: 181 YNFLIVLSLIIVISLKSIGIILPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGI 240
           Y FLIVLSL+IVISLKSIG+ILPPAVLVLPGATAFLLSKHHTTMIL++++IS+V T++GI
Sbjct: 181 YMFLIVLSLLIVISLKSIGLILPPAVLVLPGATAFLLSKHHTTMILIAIMISIVSTILGI 240

Query: 241 YISFFINSAAAPTVVILMAIFFVVVYAYSIIINKRT 276
           YISFFINSAAAPT+V+LMAIFF + + YS +INKR 
Sbjct: 241 YISFFINSAAAPTIVMLMAIFFAISFLYS-VINKRK 275


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|332717129|ref|YP_004444595.1| iron ABC transporter, membrane spanning protein [Agrobacterium sp. H13-3] Length = 284 Back     alignment and organism information
>gi|15890517|ref|NP_356189.1| ABC transporter, membrane spanning protein (iron transport) [Agrobacterium tumefaciens str. C58] Length = 284 Back     alignment and organism information
>gi|330448498|ref|ZP_08312146.1| fecCD transport family protein [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] Length = 287 Back     alignment and organism information
>gi|294141799|ref|YP_003557777.1| iron (chelated) ABC transporter permease protein [Shewanella violacea DSS12] Length = 305 Back     alignment and organism information
>gi|89072902|ref|ZP_01159459.1| putative iron transport system membrane abc transporter protein [Photobacterium sp. SKA34] Length = 285 Back     alignment and organism information
>gi|153011022|ref|YP_001372236.1| ABC-3 protein [Ochrobactrum anthropi ATCC 49188] Length = 282 Back     alignment and organism information
>gi|90408804|ref|ZP_01216948.1| hypothetical protein PCNPT3_07660 [Psychromonas sp. CNPT3] Length = 283 Back     alignment and organism information
>gi|90577474|ref|ZP_01233285.1| putative iron transport system membrane abc transporter protein [Vibrio angustum S14] Length = 285 Back     alignment and organism information
>gi|116253627|ref|YP_769465.1| iron transmembrane ABC transporter component [Rhizobium leguminosarum bv. viciae 3841] Length = 281 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target277 ABC transporter, membrane spanning protein (iron transp
COG1108274 COG1108, ZnuB, ABC-type Mn2+/Zn2+ transport systems, pe 2e-34
TIGR03770270 TIGR03770, anch_rpt_perm, anchored repeat-type ABC tran 1e-22
cd06550261 cd06550, TM_ABC_iron-siderophores_like, Transmembrane s 6e-18
PRK09543261 PRK09543, znuB, high-affinity zinc transporter membrane 1e-09
pfam00950258 pfam00950, ABC-3, ABC 3 transport family 1e-41
>gnl|CDD|31305 COG1108, ZnuB, ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163482 TIGR03770, anch_rpt_perm, anchored repeat-type ABC transporter, permease subunit Back     alignment and domain information
>gnl|CDD|119348 cd06550, TM_ABC_iron-siderophores_like, Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+ Back     alignment and domain information
>gnl|CDD|181938 PRK09543, znuB, high-affinity zinc transporter membrane component; Reviewed Back     alignment and domain information
>gnl|CDD|109985 pfam00950, ABC-3, ABC 3 transport family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 277 ABC transporter, membrane spanning protein (iron transp
COG1108274 ZnuB ABC-type Mn2+/Zn2+ transport systems, permease com 100.0
pfam00950258 ABC-3 ABC 3 transport family. 100.0
PRK09543261 znuB high-affinity zinc transporter membrane component; 100.0
cd06550261 TM_ABC_iron-siderophores_like Transmembrane subunit (TM 100.0
PRK10577666 iron-hydroxamate transporter permease subunit; Provisio 99.93
PRK10440330 iron-enterobactin transporter permease; Provisional 99.93
PRK09535366 btuC corrinoid ABC transporter permease; Reviewed 99.93
PRK10577 666 iron-hydroxamate transporter permease subunit; Provisio 99.92
PRK09777318 fecD iron-dicitrate transporter subunit FecD; Reviewed 99.92
PRK10441335 iron-enterobactin transporter membrane protein; Provisi 99.91
PRK03784330 vtamin B12-transporter permease; Provisional 99.91
pfam01032312 FecCD FecCD transport family. This is a sub-family of b 99.91
PRK11228323 fecC iron-dicitrate transporter permease subunit; Provi 99.9
COG0609334 FepD ABC-type Fe3+-siderophore transport system, permea 99.89
COG4606321 CeuB ABC-type enterochelin transport system, permease c 99.39
COG4139326 BtuC ABC-type cobalamin transport system, permease comp 98.76
COG4120293 ABC-type uncharacterized transport system, permease com 96.69
COG4779346 FepG ABC-type enterobactin transport system, permease c 99.53
COG4605316 CeuC ABC-type enterochelin transport system, permease c 99.04
PRK09699325 D-allose transporter subunit; Provisional 97.39
COG1172316 AraH Ribose/xylose/arabinose/galactoside ABC-type trans 97.05
COG4177314 LivM ABC-type branched-chain amino acid transport syste 90.13
TIGR03622283 urea_t_UrtB_arc urea ABC transporter, permease protein 98.23
cd06581268 TM_PBP1_LivM_like Transmembrane subunit (TM) of Escheri 97.92
PRK10740308 branched-chain amino acid transporter permease subunit 97.49
PRK11301416 livM leucine/isoleucine/valine transporter permease sub 96.91
cd06580234 TM_PBP1_transp_TpRbsC_like Transmembrane subunit (TM) o 96.42
cd06579263 TM_PBP1_transp_AraH_like Transmembrane subunit (TM) of 97.81
TIGR03408313 urea_trans_UrtC urea ABC transporter, permease protein 96.83
PRK11618317 inner membrane ABC transporter permease protein YjfF; P 96.26
cd06582272 TM_PBP1_LivH_like Transmembrane subunit (TM) of Escheri 96.15
TIGR03409291 urea_trans_UrtB urea ABC transporter, permease protein 94.66
pfam02653267 BPD_transp_2 Branched-chain amino acid transport system 97.61
cd06574266 TM_PBP1_branched-chain-AA_like Transmembrane subunit (T 97.51
PRK11285327 araH L-arabinose transporter permease protein; Provisio 96.98
PRK09512321 rbsC ribose ABC transporter permease protein; Reviewed 95.87
COG0559297 LivH Branched-chain amino acid ABC-type transport syste 97.06
PRK09478336 mglC beta-methylgalactoside transporter inner membrane 95.25
>COG1108 ZnuB ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam00950 ABC-3 ABC 3 transport family Back     alignment and domain information
>PRK09543 znuB high-affinity zinc transporter membrane component; Reviewed Back     alignment and domain information
>cd06550 TM_ABC_iron-siderophores_like Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+ Back     alignment and domain information
>PRK10577 iron-hydroxamate transporter permease subunit; Provisional Back     alignment and domain information
>PRK10440 iron-enterobactin transporter permease; Provisional Back     alignment and domain information
>PRK09535 btuC corrinoid ABC transporter permease; Reviewed Back     alignment and domain information
>PRK10577 iron-hydroxamate transporter permease subunit; Provisional Back     alignment and domain information
>PRK09777 fecD iron-dicitrate transporter subunit FecD; Reviewed Back     alignment and domain information
>PRK10441 iron-enterobactin transporter membrane protein; Provisional Back     alignment and domain information
>PRK03784 vtamin B12-transporter permease; Provisional Back     alignment and domain information
>pfam01032 FecCD FecCD transport family Back     alignment and domain information
>PRK11228 fecC iron-dicitrate transporter permease subunit; Provisional Back     alignment and domain information
>COG0609 FepD ABC-type Fe3+-siderophore transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4606 CeuB ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4139 BtuC ABC-type cobalamin transport system, permease component [Coenzyme metabolism] Back     alignment and domain information
>COG4120 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4779 FepG ABC-type enterobactin transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4605 CeuC ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09699 D-allose transporter subunit; Provisional Back     alignment and domain information
>COG1172 AraH Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4177 LivM ABC-type branched-chain amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03622 urea_t_UrtB_arc urea ABC transporter, permease protein UrtB Back     alignment and domain information
>cd06581 TM_PBP1_LivM_like Transmembrane subunit (TM) of Escherichia coli LivM and related proteins Back     alignment and domain information
>PRK10740 branched-chain amino acid transporter permease subunit LivH; Reviewed Back     alignment and domain information
>PRK11301 livM leucine/isoleucine/valine transporter permease subunit; Provisional Back     alignment and domain information
>cd06580 TM_PBP1_transp_TpRbsC_like Transmembrane subunit (TM) of Treponema pallidum (Tp) RbsC-1, RbsC-2 and related proteins Back     alignment and domain information
>cd06579 TM_PBP1_transp_AraH_like Transmembrane subunit (TM) of Escherichia coli AraH and related proteins Back     alignment and domain information
>TIGR03408 urea_trans_UrtC urea ABC transporter, permease protein UrtC Back     alignment and domain information
>PRK11618 inner membrane ABC transporter permease protein YjfF; Provisional Back     alignment and domain information
>cd06582 TM_PBP1_LivH_like Transmembrane subunit (TM) of Escherichia coli LivH and related proteins Back     alignment and domain information
>TIGR03409 urea_trans_UrtB urea ABC transporter, permease protein UrtB Back     alignment and domain information
>pfam02653 BPD_transp_2 Branched-chain amino acid transport system / permease component Back     alignment and domain information
>cd06574 TM_PBP1_branched-chain-AA_like Transmembrane subunit (TM) of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which are involved in the uptake of branched-chain amino acids (AAs), as well as TMs of transporters involved in the uptake of monosaccharides including ribose, galactose, and arabinose Back     alignment and domain information
>PRK11285 araH L-arabinose transporter permease protein; Provisional Back     alignment and domain information
>PRK09512 rbsC ribose ABC transporter permease protein; Reviewed Back     alignment and domain information
>COG0559 LivH Branched-chain amino acid ABC-type transport system, permease components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09478 mglC beta-methylgalactoside transporter inner membrane component; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target277 ABC transporter, membrane spanning protein (iron transp
2nq2_A337 Hypothetical ABC transporter permease protein HI1471; p 99.91
2qi9_A326 Vitamin B12 import system permease protein BTUC; inner 99.87
>2nq2_A Hypothetical ABC transporter permease protein HI1471; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
Probab=99.91  E-value=8.7e-22  Score=134.42  Aligned_cols=244  Identities=11%  Similarity=0.158  Sum_probs=182.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHH-HHHHHHHH---HHHHHHHHHHHHHHHHCCCH---HHHHHHHHHHHHHHHHHCC---CCC
Q ss_conf             99999999998788999999-76899644---58999999999999722113---3458899999999997312---334
Q gi|254780540|r   21 FIITVIVVIPMSVLSCFIIL-KNQSFAGE---AISHSVLPGIVLSHMAGIPL---EIGAFIAGMICTLSAGYLK---EKS   90 (277)
Q Consensus        21 ll~~~l~~~~~~~lG~~vv~-rr~~~~~~---alsH~al~Gial~~l~g~~~---~lga~~~~ll~a~li~~l~---~r~   90 (277)
                      .+++.++|...+.-|..... -|..+.+-   +++..+-.|++++.+++.+.   ...+..++.........+.   ++.
T Consensus        66 ~l~a~l~Ga~LavaG~llQ~~~rNpLA~P~iLGissGA~lg~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  145 (337)
T 2nq2_A           66 ILTALCVGAGLALSGVVLQGIFRNPLVNPHIIGVTSGSAFGGTLAIFFGFSLYGLFTSTILFGFGTLALVFLFSFKFNQR  145 (337)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTTCTTCCTTTTSHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHTC----
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999999999998657999990665489999999999999840022578999999999999999999964778


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHH-CCC---CCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             4302447898999999999986321-024---410345776317534665525789988999999998633431134668
Q gi|254780540|r   91 YFQEDLVLSIVFSGMFAIGIILILK-VHS---SLHFSHILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIFDP  166 (277)
Q Consensus        91 ~~~~d~~igiv~~~~~algill~s~-~~~---~~~l~~~LfG~il~v~~~dv~~~~i~~~~~l~~~~~~~r~l~~~sfD~  166 (277)
                      +...-..+|+..+..+.....+... ..+   ......|++||....+|+|++......+......+...|+++.+.+||
T Consensus       146 ~~~~liL~gi~~~~~~~a~~~~~~~l~~~~~~~~~~~~W~~Gs~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~~l~lG~  225 (337)
T 2nq2_A          146 SLLMLILIGMILSGLFSALVSLLQYISDTEEKLPSIVFWLMGSFATSNWEKLLFFFVPFLLCSSILLSLSWRLNLLSLDE  225 (337)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHSSCTTTHHHHHHHHTTCCSTTCCHHHHHHHHHHHHHHHHHHHHTTTGGGGGGSCH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHCCCCHHCCCH
T ss_conf             72177876799999999999999997224889999999850143568843213311211478888888630056210793


Q ss_pred             HHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-
Q ss_conf             8997618874235669999999999999989899999999998778998530888999999999999999999999999-
Q gi|254780540|r  167 MHAHSMQIPIKLLHYNFLIVLSLIIVISLKSIGIILPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISFF-  245 (277)
Q Consensus       167 ~~A~~~Gi~v~~~~~~~~~lial~v~~~v~~vG~llv~alli~Paa~A~~~s~s~~~~i~~s~~ig~~~~~~G~~lS~~-  245 (277)
                      |.|++.|+|+++.+...+.+.++.++.++..+|.+.+.++ +.|+.+.+...+++++.++.|.++|..-....-.++-. 
T Consensus       226 ~~A~sLGv~v~~~r~~~l~l~~llta~~vs~~G~I~FvGL-i~Phiar~l~g~~~~~~l~~s~l~Ga~lll~aD~i~r~l  304 (337)
T 2nq2_A          226 KEAKALGVKMAPLRWLVIFLSGSLVACQVAISGSIGWVGL-IIPHLSRMLVGANHQSLLPCTMLVGATYMLLVDNVARSL  304 (337)
T ss_dssp             HHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHCCCCSSTT-HHHHHHHHHHCSCHHHHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEHHH-HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             8898789979999999999999999999963776303874-099999998188853399999999999999999998665


Q ss_pred             --HCCCCHHHHHHHHHHHHHHH
Q ss_conf             --57881899999999999999
Q gi|254780540|r  246 --INSAAAPTVVILMAIFFVVV  265 (277)
Q Consensus       246 --~~~p~g~~Iv~~~~~~~~~~  265 (277)
                        .++|.|..+.++.+.+|+..
T Consensus       305 ~p~elPvG~vtaliG~p~fl~l  326 (337)
T 2nq2_A          305 SDAEIPISILTALIGAPLFGVL  326 (337)
T ss_dssp             CSSCCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCEEHHHHHHHHHHHHHHHH
T ss_conf             6777319999999999999999



>2qi9_A Vitamin B12 import system permease protein BTUC; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target277 ABC transporter, membrane spanning protein (iron transp
d1l7va_324 ABC transporter involved in vitamin B12 uptake, BtuC {E 99.87
>d1l7va_ f.22.1.1 (A:) ABC transporter involved in vitamin B12 uptake, BtuC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: ABC transporter involved in vitamin B12 uptake, BtuC
superfamily: ABC transporter involved in vitamin B12 uptake, BtuC
family: ABC transporter involved in vitamin B12 uptake, BtuC
domain: ABC transporter involved in vitamin B12 uptake, BtuC
species: Escherichia coli [TaxId: 562]
Probab=99.87  E-value=2.1e-20  Score=125.66  Aligned_cols=244  Identities=10%  Similarity=0.133  Sum_probs=182.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHH-HHHHHHHH---HHHHHHHHHHHHHHHHCCC------HHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             99999999998788999999-76899644---5899999999999972211------33458899999999997312334
Q gi|254780540|r   21 FIITVIVVIPMSVLSCFIIL-KNQSFAGE---AISHSVLPGIVLSHMAGIP------LEIGAFIAGMICTLSAGYLKEKS   90 (277)
Q Consensus        21 ll~~~l~~~~~~~lG~~vv~-rr~~~~~~---alsH~al~Gial~~l~g~~------~~lga~~~~ll~a~li~~l~~r~   90 (277)
                      .+++.++|...+.-|..... -|..+.+-   +++..+-.|++++.+++..      ....++..++..........++.
T Consensus        60 ~l~a~l~Ga~La~sG~~lQ~~~rNpLA~P~ilGissGA~l~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  139 (324)
T d1l7va_          60 TLAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLCAIAGALIITLILLRFARRH  139 (324)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTCTTCCTTTTTHHHHHHHHHHHHHHTSCTTCCHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999817988783678754288999999997233225788999999999999999999986146


Q ss_pred             CCCHH-HHHHHHHHHHHHHHHHHHH-HCC--CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             43024-4789899999999998632-102--4410345776317534665525789988999999998633431134668
Q gi|254780540|r   91 YFQED-LVLSIVFSGMFAIGIILIL-KVH--SSLHFSHILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIFDP  166 (277)
Q Consensus        91 ~~~~d-~~igiv~~~~~algill~s-~~~--~~~~l~~~LfG~il~v~~~dv~~~~i~~~~~l~~~~~~~r~l~~~sfD~  166 (277)
                      ..+.. ...|+..+..+.....+.. ..+  ...+...|+.|+....+|+|++......... .......|+++.++.||
T Consensus       140 ~~~~~liL~Gi~i~~~~~a~~~~l~~~~~~~~~~~~~~w~~Gs~~~~~~~~~~~~~~~~~~~-~~~~~~~~~L~~L~lgd  218 (324)
T d1l7va_         140 LSTSRLLLAGVALGIICSALMTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQSWLMLALIPVL-LWICCQSRPMNMLALGE  218 (324)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHTCCCTTCCGGGHHHHHHHHHHH-HHHHHCHHHHHHHHHCH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHH-HHHHHHHHHHHHHHCCH
T ss_conf             88136778899999999999999999547999999999976500445320357788751899-99999984466553036


Q ss_pred             HHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-
Q ss_conf             8997618874235669999999999999989899999999998778998530888999999999999999999999999-
Q gi|254780540|r  167 MHAHSMQIPIKLLHYNFLIVLSLIIVISLKSIGIILPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISFF-  245 (277)
Q Consensus       167 ~~A~~~Gi~v~~~~~~~~~lial~v~~~v~~vG~llv~alli~Paa~A~~~s~s~~~~i~~s~~ig~~~~~~G~~lS~~-  245 (277)
                      |.|+..|+|+++.+...+...++.++.++..+|.+.+.++ +.|+.+.+...+++++.++.|.++|.......-.++-. 
T Consensus       219 ~~A~sLGv~v~~~r~~~l~~~~ll~a~~va~~G~I~FvGL-i~PhiaR~l~g~~~~~~lp~s~l~Ga~lll~aD~l~r~i  297 (324)
T d1l7va_         219 ISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGL-VIPHILRLCGLTDHRVLLPGCALAGASALLLADIVARLA  297 (324)
T ss_dssp             HHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHCCCCSSSS-HHHHHHHHTTCCSHHHHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH-HHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8887068666777799999999999999972364455587-579999986077751799999999999999999999760


Q ss_pred             ---HCCCCHHHHHHHHHHHHHHHH
Q ss_conf             ---578818999999999999999
Q gi|254780540|r  246 ---INSAAAPTVVILMAIFFVVVY  266 (277)
Q Consensus       246 ---~~~p~g~~Iv~~~~~~~~~~~  266 (277)
                         .++|.|-.+.++.+.+|+.-.
T Consensus       298 ~~p~eiPvGvitaliG~P~fi~Ll  321 (324)
T d1l7va_         298 LAAAELPIGVVTATLGAPVFIWLL  321 (324)
T ss_dssp             CSSSCCCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             466563299999999999999999



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target277 ABC transporter, membrane spanning protein (iron transp
2qi9_A_326 Vitamin B12 import system permease protein BTUC; i 99.91
2nq2_A_94-261168 Hypothetical ABC transporter permease protein HI14 99.73
2nq2_A_1-93_262-307139 Hypothetical ABC transporter permease protein HI14 92.54
>2qi9_A (A:) Vitamin B12 import system permease protein BTUC; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_A* Back     alignment and structure
Probab=99.91  E-value=3e-23  Score=143.15  Aligned_cols=245  Identities=10%  Similarity=0.040  Sum_probs=194.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHCC-----CHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             999999999998788999999768996445----89999999999997221-----133458899999999997312334
Q gi|254780540|r   20 SFIITVIVVIPMSVLSCFIILKNQSFAGEA----ISHSVLPGIVLSHMAGI-----PLEIGAFIAGMICTLSAGYLKEKS   90 (277)
Q Consensus        20 all~~~l~~~~~~~lG~~vv~rr~~~~~~a----lsH~al~Gial~~l~g~-----~~~lga~~~~ll~a~li~~l~~r~   90 (277)
                      -.+++.+.|...+.-|......-+--++|.    ++..+..|++++.+...     ....+++..+...........+|+
T Consensus        59 R~l~a~l~G~~LavsG~~~Q~~~rNpLa~P~ilGi~sga~l~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  138 (326)
T 2qi9_A           59 RTLAVLLVGAALAISGAVXQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLSAIAGALIITLILLRFARR  138 (326)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTTCSSCCGGGGTHHHHHHHHHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99999999999999999999993698767424540258999999999824540278999999999999999999987621


Q ss_pred             CCCHHHHH--HHHHHHHHHHHHHH-HHHCC-CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             43024478--98999999999986-32102-4410345776317534665525789988999999998633431134668
Q gi|254780540|r   91 YFQEDLVL--SIVFSGMFAIGIIL-ILKVH-SSLHFSHILLGDMLGISKSDIITTAFFAFISISFLILKKNDLLLMIFDP  166 (277)
Q Consensus        91 ~~~~d~~i--giv~~~~~algill-~s~~~-~~~~l~~~LfG~il~v~~~dv~~~~i~~~~~l~~~~~~~r~l~~~sfD~  166 (277)
                      +.+.+..+  |+..+..++....+ ....+ ...+...++.|+....+|+|++...+...+........+|++..+.+||
T Consensus       139 ~~~~~~lil~gi~~~~~~~a~~~~l~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~l~lg~  218 (326)
T 2qi9_A          139 HLSTSRLLLAGVALGIISSALXTWAIYFSTSVDLRQLXYWXXGGFGGVDWRQSWLXLALIPVLLWISSQSRPXNXLALGE  218 (326)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHHHHHHTCCTTHHHHHHHHHTCCCTTCCGGGHHHHTTTHHHHHHHTTCHHHHHHHHTCH
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             35640567899999999999999999984079999999987640254674232567875068999999876766544106


Q ss_pred             HHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH---
Q ss_conf             89976188742356699999999999999898999999999987789985308889999999999999999999999---
Q gi|254780540|r  167 MHAHSMQIPIKLLHYNFLIVLSLIIVISLKSIGIILPPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYIS---  243 (277)
Q Consensus       167 ~~A~~~Gi~v~~~~~~~~~lial~v~~~v~~vG~llv~alli~Paa~A~~~s~s~~~~i~~s~~ig~~~~~~G~~lS---  243 (277)
                      |.|++.|+|+++++...+.+.++.++.++..+|.+.+.++ +.|+.+.+...++.++.++.+.++|......+-.++   
T Consensus       219 ~~A~slGv~v~~~~~~~lil~~~lta~~vs~vG~I~FvGL-i~p~iar~l~~~~~~~~l~~s~l~Ga~lll~~d~l~r~~  297 (326)
T 2qi9_A          219 ISARQLGLPLWFWRNVLVAATGWXVGVSVALAGAIGFIGL-VIPHILRLSGLTDHRVLLPGCALAGASALLLADIVARLA  297 (326)
T ss_dssp             HHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHCCCCSSTT-HHHHHHHTTTCCSHHHHHHHHHHHHHHHHHHHHHHHHSS
T ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH-HHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             6777068776676689999999999999970358889898-689999986277654699999999999999999999660


Q ss_pred             -HHHCCCCHHHHHHHHHHHHHHH
Q ss_conf             -9957881899999999999999
Q gi|254780540|r  244 -FFINSAAAPTVVILMAIFFVVV  265 (277)
Q Consensus       244 -~~~~~p~g~~Iv~~~~~~~~~~  265 (277)
                       ++.+.|.|..+.++.+.+|+..
T Consensus       298 ~~~~eiPvg~~~~liG~p~fi~l  320 (326)
T 2qi9_A          298 LAAAELPIGVVTATLGAPVFIWL  320 (326)
T ss_dssp             STTCCCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             56666319999999999999997



>2nq2_A (A:94-261) Hypothetical ABC transporter permease protein HI1471; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2nq2_A (A:1-93,A:262-307) Hypothetical ABC transporter permease protein HI1471; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure