254780542

254780542

hypothetical protein CLIBASIA_02145

GeneID in NCBI database:8209538Locus tag:CLIBASIA_02145
Protein GI in NCBI database:254780542Protein Accession:YP_003064955.1
Gene range:+(738839, 739471)Protein Length:210aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDLKGRPIQELGNNLSDSGLNEQDHNDVQISK
ccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccEEEEEEEccccEEEEEEEEEEEccccccccccccccEEEEEEEEEEcccccccccccEEEEcccccccccccEEEEEEEEcccccccccccHHHHHHHHHHHHcccccccccccccccccccccHHHHccccHHcccccccccccHHHHccccccccccccccccEEEcc
cHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccEEEEEEEEcccEEEEcEEEEEcHHHccccccccccccEEEEEEEEccccccEEEEcccEEcccccccccccccEEEEEEEccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccEEcc
MKYRVLLLILFFVFSHAKFANSARFANKVAEFagmdkitgrVLTFDVeinqsaqfgsliikpmvcysrddreaQRIDAFVSISEIFTDRIVRSIFsgwmfadspamnaidhsIYDIWLMqckdpindsisnsESISKKALseysstditsqgsekssgsssnktlekessqplennlsmdlkgrpiqelgnnlsdsglneqdhndvqisk
MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQsaqfgsliikPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSeysstditsqgsekssgsssnktlekessqplennlsmdLKGRPIQELGnnlsdsglneqdhndvqisk
MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPindsisnsesisKKALSEYSSTDITsqgsekssgsssNKTLEKESSQPLENNLSMDLKGRPIQELGNNLSDSGLNEQDHNDVQISK
*KYRVLLLILFFVFSHAKF******ANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ************************************************************L*GRPI************************
MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS*******************************************ENNLSMDLKGRPIQELGNNLSDSGLNE**********
MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP*******************************************************DLKGRPIQ*****LSDSGLN***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDLKGRPIQELGNNLSDSGLNEQDHNDVQISK
MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDLKGRPIQELGNNLSDSGLNEQDHNDVQISK
MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDLKGRPIQELGNNLSDSGLNEQDHNDVQISK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target210 hypothetical protein CLIBASIA_02145 [Candidatus Liberib
315122870193 hypothetical protein CKC_05630 [Candidatus Liberibacter 1 8e-55
222148330171 hypothetical protein Avi_1785 [Agrobacterium vitis S4] 1 9e-35
153009606156 hypothetical protein Oant_2276 [Ochrobactrum anthropi A 1 2e-34
222085635146 hypothetical protein Arad_1920 [Agrobacterium radiobact 1 3e-34
306843802151 Hypothetical protein BIBO1_0463 [Brucella sp. BO1] Leng 1 5e-34
265983997151 conserved hypothetical protein [Brucella sp. 83/13] Len 1 6e-34
254719007156 hypothetical protein Bru83_05609 [Brucella sp. 83/13] L 1 7e-34
306840398156 Hypothetical protein BIBO2_0198 [Brucella sp. BO2] Leng 1 7e-34
239831781162 Hypothetical protein, conserved [Ochrobactrum intermedi 1 8e-34
23501790156 hypothetical protein BR0904 [Brucella suis 1330] Length 1 8e-34
>gi|315122870|ref|YP_004063359.1| hypothetical protein CKC_05630 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 193 Back     alignment and organism information
 Score =  217 bits (553), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 130/181 (71%), Gaps = 3/181 (1%)

Query: 1   MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60
           MK++VL L + F F+ A    SARF NK+AEFAGMDKITGR+L FDV+IN+S QFGSL I
Sbjct: 1   MKHKVLFLAVLFFFNTAGIVKSARFENKIAEFAGMDKITGRILRFDVDINRSVQFGSLKI 60

Query: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
            PMVCYSRDD+E QR+D+FVSISEI TD  VRSIFSGWMFADSPAMNAIDHSIYD+WL+Q
Sbjct: 61  TPMVCYSRDDKEIQRVDSFVSISEISTDHTVRSIFSGWMFADSPAMNAIDHSIYDVWLIQ 120

Query: 121 CKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSS---SNKTLEKESSQPLENNL 177
           CK+PI DS  NS   S        + +       K+S  S   S+  L+K  +Q  ENNL
Sbjct: 121 CKNPIKDSDKNSTRYSTPVPKMTVTENPDDNSIPKASSQSIEISDAHLDKNYNQKSENNL 180

Query: 178 S 178
           +
Sbjct: 181 N 181


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148330|ref|YP_002549287.1| hypothetical protein Avi_1785 [Agrobacterium vitis S4] Length = 171 Back     alignment and organism information
>gi|153009606|ref|YP_001370821.1| hypothetical protein Oant_2276 [Ochrobactrum anthropi ATCC 49188] Length = 156 Back     alignment and organism information
>gi|222085635|ref|YP_002544165.1| hypothetical protein Arad_1920 [Agrobacterium radiobacter K84] Length = 146 Back     alignment and organism information
>gi|306843802|ref|ZP_07476400.1| Hypothetical protein BIBO1_0463 [Brucella sp. BO1] Length = 151 Back     alignment and organism information
>gi|265983997|ref|ZP_06096732.1| conserved hypothetical protein [Brucella sp. 83/13] Length = 151 Back     alignment and organism information
>gi|254719007|ref|ZP_05180818.1| hypothetical protein Bru83_05609 [Brucella sp. 83/13] Length = 156 Back     alignment and organism information
>gi|306840398|ref|ZP_07473163.1| Hypothetical protein BIBO2_0198 [Brucella sp. BO2] Length = 156 Back     alignment and organism information
>gi|239831781|ref|ZP_04680110.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] Length = 162 Back     alignment and organism information
>gi|23501790|ref|NP_697917.1| hypothetical protein BR0904 [Brucella suis 1330] Length = 156 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target210 hypothetical protein CLIBASIA_02145 [Candidatus Liberib
pfam0992391 pfam09923, DUF2155, Uncharacterized protein conserved i 3e-29
COG4765164 COG4765, COG4765, Uncharacterized protein conserved in 6e-35
>gnl|CDD|150579 pfam09923, DUF2155, Uncharacterized protein conserved in bacteria (DUF2155) Back     alignment and domain information
>gnl|CDD|34378 COG4765, COG4765, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 210 hypothetical protein CLIBASIA_02145 [Candidatus Liberib
pfam0992391 DUF2155 Uncharacterized protein conserved in bacteria ( 100.0
COG4765164 Uncharacterized protein conserved in bacteria [Function 100.0
>pfam09923 DUF2155 Uncharacterized protein conserved in bacteria (DUF2155) Back     alignment and domain information
>COG4765 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00