254780543

254780543

NADH dehydrogenase

GeneID in NCBI database:8209539Locus tag:CLIBASIA_02150
Protein GI in NCBI database:254780543Protein Accession:YP_003064956.1
Gene range:+(738391, 738786)Protein Length:131aa
Gene description:NADH dehydrogenase
COG prediction:[C] NADH:ubiquinone oxidoreductase 17.2 kD subunit
KEGG prediction:NADH dehydrogenase (EC:1.6.99.3); K00356 NADH dehydrogenase [EC:1.6.99.3]
SEED prediction:NADH:ubiquinone oxidoreductase 17.2 kD subunit
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Respiratory Complex I
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MKNFLLQIFTWWNGQTLGTRFFTWRFGHIVGKDEFGNTYYESRKNINGSSRRWVIYNGYTDPSSIPPMWHGWIHHRRIGVPKAEEENSFDWQKPHCVNATGSLNSYYPRFRRDNMAGTSTKGKYSAWSPDY
cHHHHHHHHEEccccccccEEEEEcccEEEEEEccccEEEEcccccccccEEEEEEccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHccccccccEcEcccccEEEccccccEEEEEccccccccEEEEEEccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MKNFLLQIFTwwngqtlgtrfftwrfghivgkdefgntyyesrkningssRRWVIYngytdpssippmwhgwihhrrigvpkaeeensfdwqkphcvnatgslnsyyprfrrdnmagtstkgkysawspdy
MKNFLLQIFTWWNGQTLGTRFFTWRFGHIVgkdefgntyyesrkningssrRWVIYNGYTDPSSIPPMWHGWIHHRRIGVPKAEEENSFDWQKPHCVNATGSLNSYYPRFRRdnmagtstkgkysawspdy
MKNFLLQIFTWWNGQTLGTRFFTWRFGHIVGKDEFGNTYYESRKNINGSSRRWVIYNGYTDPSSIPPMWHGWIHHRRIGVPKAEEENSFDWQKPHCVNATGSLNSYYPRFRRDNMAGTSTKGKYSAWSPDY
*KNFLLQIFTWWNGQTLGTRFFTWRFGHIVGKDEFGNTYYESRKNINGSSRRWVIYNGYTDPSSIPPMWHGWIHHRRIGVPKA*******WQKPHCVNATGSLNSYYP**************KYSAWSPD*
MKNFLLQIFTWWNGQTLGTRFFTWRFGHIVGKDEFGNTYYESRKNINGSSRRWVIYNGYTDPSSIPPMWHGWIHHRRIGVPKAEEENSFDWQKPHCVNATGSLNSYYPRFRRDNMAG**************
MKNFLLQIFTWWNGQTLGTRFFTWRFGHIVGKDEFGNTYYESRKNINGSSRRWVIYNGYTDPSSIPPMWHGWIHHRRIGVPKAEEENSFDWQKPHCVNATGSLNSYYPRF*************YSA*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MKNFLLQIFTWWNGQTLGTRFFTWRFGHIVGKDEFGNTYYESRKNINGSSRRWVIYNGYTDPSSIPPMWHGWIHHRRIGVPKAEEENSFDWQKPHCVNATGSLNSYYPRFRRDNMAGTSTKGKYSAWSPDY
MKNFLLQIFTWWNGQTLGTRFFTWRFGHIVGKDEFGNTYYESRKNINGSSRRWVIYNGYTDPSSIPPMWHGWIHHRRIGVPKAEEENSFDWQKPHCVNATGSLNSYYPRFRRDNMAGTSTKGKYSAWSPDY
MKNFLLQIFTWWNGQTLGTRFFTWRFGHIVGKDEFGNTYYESRKNINGSSRRWVIYNGYTDPSSIPPMWHGWIHHRRIGVPKAEEENSFDWQKPHCVNATGSLNSYYPRFRRDNMAGTSTKGKYSAWSPDY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target131 NADH dehydrogenase [Candidatus Liberibacter asiaticus s
315122871132 NADH dehydrogenase [Candidatus Liberibacter solanacearu 1 3e-49
110634071132 NADH dehydrogenase [Mesorhizobium sp. BNC1] Length = 13 1 7e-34
153009607136 NADH dehydrogenase [Ochrobactrum anthropi ATCC 49188] L 1 3e-33
17987349136 NADH dehydrogenase [Brucella melitensis bv. 1 str. 16M] 1 6e-33
239831780136 NADH dehydrogenase [Ochrobactrum intermedium LMG 3301] 1 9e-33
256061008136 NADH dehydrogenase [Brucella neotomae 5K33] Length = 13 1 1e-32
15888652132 NADH dehydrogenase [Agrobacterium tumefaciens str. C58] 1 2e-32
254719006136 NADH dehydrogenase [Brucella sp. 83/13] Length = 136 1 2e-32
150396171131 NADH dehydrogenase [Sinorhizobium medicae WSM419] Lengt 1 2e-32
307301140131 NADH:ubiquinone oxidoreductase 17.2 kD subunit [Sinorhi 1 5e-32
>gi|315122871|ref|YP_004063360.1| NADH dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 132 Back     alignment and organism information
 Score =  197 bits (502), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 106/131 (80%), Gaps = 1/131 (0%)

Query: 1   MKNFLLQIFTWWNGQTLGTRFFTWRFGHIVGKDEFGNTYYESRKNINGSSRRWVIYNGYT 60
           MKNFLLQIFTWWNGQTLGTRFFTWRFGH+VG+DEFGNTYYE  KN  G SRRWV+Y GYT
Sbjct: 1   MKNFLLQIFTWWNGQTLGTRFFTWRFGHVVGQDEFGNTYYEGGKNAYGFSRRWVVYKGYT 60

Query: 61  DPSSIPPMWHGWIHHRRIGVPKAEEENSFDWQKPHCVNATGSLNSYYPRFRRDNMA-GTS 119
           DPSSIPP+WHGWIHHRRI  P+  E   F+WQKPH VN+TGS NSY P  +++N   G  
Sbjct: 61  DPSSIPPIWHGWIHHRRIDAPQPGEGTVFNWQKPHRVNSTGSENSYSPGQQKNNPDNGNK 120

Query: 120 TKGKYSAWSPD 130
             GKYSAWSPD
Sbjct: 121 LTGKYSAWSPD 131


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|110634071|ref|YP_674279.1| NADH dehydrogenase [Mesorhizobium sp. BNC1] Length = 132 Back     alignment and organism information
>gi|153009607|ref|YP_001370822.1| NADH dehydrogenase [Ochrobactrum anthropi ATCC 49188] Length = 136 Back     alignment and organism information
>gi|17987349|ref|NP_539983.1| NADH dehydrogenase [Brucella melitensis bv. 1 str. 16M] Length = 136 Back     alignment and organism information
>gi|239831780|ref|ZP_04680109.1| NADH dehydrogenase [Ochrobactrum intermedium LMG 3301] Length = 136 Back     alignment and organism information
>gi|256061008|ref|ZP_05451165.1| NADH dehydrogenase [Brucella neotomae 5K33] Length = 136 Back     alignment and organism information
>gi|15888652|ref|NP_354333.1| NADH dehydrogenase [Agrobacterium tumefaciens str. C58] Length = 132 Back     alignment and organism information
>gi|254719006|ref|ZP_05180817.1| NADH dehydrogenase [Brucella sp. 83/13] Length = 136 Back     alignment and organism information
>gi|150396171|ref|YP_001326638.1| NADH dehydrogenase [Sinorhizobium medicae WSM419] Length = 131 Back     alignment and organism information
>gi|307301140|ref|ZP_07580909.1| NADH:ubiquinone oxidoreductase 17.2 kD subunit [Sinorhizobium meliloti BL225C] Length = 131 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target131 NADH dehydrogenase [Candidatus Liberibacter asiaticus s
PRK08183133 PRK08183, PRK08183, NADH dehydrogenase; Validated 3e-38
COG3761118 COG3761, COG3761, NADH:ubiquinone oxidoreductase 17 2e-23
PLN03095115 PLN03095, PLN03095, NADH:ubiquinone oxidoreductase 18 k 2e-08
KOG3382151 KOG3382, KOG3382, KOG3382, NADH:ubiquinone oxidoreducta 4e-08
pfam05071100 pfam05071, NDUFA12, NADH ubiquinone oxidoreductase subu 6e-24
PRK0663099 PRK06630, PRK06630, hypothetical protein; Provisional 3e-11
PLN02732159 PLN02732, PLN02732, Probable NADH dehydrogenase [ubiqui 4e-07
>gnl|CDD|181273 PRK08183, PRK08183, NADH dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|33556 COG3761, COG3761, NADH:ubiquinone oxidoreductase 17 Back     alignment and domain information
>gnl|CDD|178643 PLN03095, PLN03095, NADH:ubiquinone oxidoreductase 18 kDa subunit; Provisional Back     alignment and domain information
>gnl|CDD|38592 KOG3382, KOG3382, KOG3382, NADH:ubiquinone oxidoreductase, B17 Back     alignment and domain information
>gnl|CDD|147317 pfam05071, NDUFA12, NADH ubiquinone oxidoreductase subunit NDUFA12 Back     alignment and domain information
>gnl|CDD|168631 PRK06630, PRK06630, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178333 PLN02732, PLN02732, Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 131 NADH dehydrogenase [Candidatus Liberibacter asiaticus s
PRK08183133 NADH dehydrogenase; Validated 100.0
COG3761118 NADH:ubiquinone oxidoreductase 17.2 kD subunit [Energy 100.0
pfam05071100 NDUFA12 NADH ubiquinone oxidoreductase subunit NDUFA12. 100.0
KOG3382151 consensus 100.0
PRK0663099 hypothetical protein; Provisional 100.0
>PRK08183 NADH dehydrogenase; Validated Back     alignment and domain information
>COG3761 NADH:ubiquinone oxidoreductase 17 Back     alignment and domain information
>pfam05071 NDUFA12 NADH ubiquinone oxidoreductase subunit NDUFA12 Back     alignment and domain information
>KOG3382 consensus Back     alignment and domain information
>PRK06630 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00