254780549

254780549

signal peptide protein

GeneID in NCBI database:8209545Locus tag:CLIBASIA_02180
Protein GI in NCBI database:254780549Protein Accession:YP_003064962.1
Gene range:+(730219, 731034)Protein Length:271aa
Gene description:signal peptide protein
COG prediction:none
KEGG prediction:signal peptide protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MRLENGLAISMILHVMFLLLLYFNFNVQLLVPISRREMLSVDNIYNEDYHSSKYKKIEEPVVQFKGSSQENLVRDFSVQENGDRFSDQTKTHATENETKRSSSSKGEQALKESALLRMPVSPYDKQKISKATNKEQDLQGISFAEKKSIDTVVVRPDKKELLSKVEKSSRKRIPSQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIKSQAFRLSPSTYKSWRNITLFFVPSKM
ccccccHHHHHHHHHHHHHHHHHcccEEEEEEEcHHHEEcHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccHHHHHHcccHHHHHccHHHHHHHHHHHHHEEcccccccHHHHHHHHcHHHHHccccHHHHccccEEEEcccHHHHHHHHHHHHHccccccHHHHHHHHHEEEcccccHHHHHHHHEEEEEEEEEccccEEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHccEEEcHHHccccccEEEEEEEccc
cccHHHHHHHHHHHHHHHHHHHHHHHHEEEccccHHHHHccccccccccccccccEccccEEEEccccHHHHHHcccEcccccccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHccccccccEEccccccccEEEEccccHHccccEccccccccccHHHHHHHHHHHHHHcccccccHcHccEEEEEEEEEcccccEEcccEEEEccccHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccc
MRLENGLAISMILHVMFLLLLYFNFnvqllvpisrremlsvdniynedyhsskykkieepvvqfkgssqenlvrdfsvqengdrfsdqtkthatenetkrsssskgeQALKESallrmpvspydkqkiskatnkeqdlqgisfaekksidtvvvrpdkkELLSKVEKssrkripsqdAIAIVRNRVianwnipsdfKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIKSqafrlspstyksWRNITLFFVPSKM
MRLENGLAISMILHVMFLLLLYFNFNVQLLVPISRREMLSVDNIYNedyhsskykkiEEPVVQFKGSSQENLVRDFSVqengdrfsdqtkthatenetkrsssskgeqalkesallrmpvspyDKQKIskatnkeqdlqgisfaekksidtvvvrpdkkellskvekssrkripsqdaiaivrnrvianwnipsDFKRFKKLRVKMHFQlnqkgfvlgkinvDVVGGTELVRRMLRENArkaviksqafrlspstykswrNITLFFVPSKM
MRLENGLAISMILHVMFLLLLYFNFNVQLLVPISRREMLSVDNIYNEDYHSSKYKKIEEPVVQFKGSSQENLVRDFSVQENGDRFSDQTKTHATENETKRSSSSKGEQALKESALLRMPVSPYDKQKISKATNKEQDLQGISFAEKKSIDTVVVRPDkkellskvekssrkrIPSQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIKSQAFRLSPSTYKSWRNITLFFVPSKM
*****GLAISMILHVMFLLLLYFNFNVQLLVPISR*************************************************************************************************************************************************IVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKG********************LRENARKAVIKSQAFRLSPSTYKSWRNITLFFVPSK*
MRLENGLAISMILHVMFLLLLYFNFNVQLLVPISRREMLSVDNIYNEDYHSSKYKKIEEPVVQFKGSSQENLVRDFSVQENGDRFS************************KESALLRMPVSPYDKQKISKATNKEQDLQGISFAEKKSIDTVVVRPDKKEL************PSQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIKSQAFRLSPSTYKSWRNITLFFVPSKM
*RLENGLAISMILHVMFLLLLYFNFNVQLLVPISRREMLSVDNIYNEDYHSSKYKKIEEPVVQFKGSSQ****RDFS****************************************MPVSPYDKQKISKATNKEQDLQGISFAEKKSIDTVVVRPD**************RIPSQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIKSQAFRLSPSTYKSWRNITLFFVP***
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLENGLAISMILHVMFLLLLYFNFNVQLLVPISRREMLSVDNIYNEDYHSSKYKKIEEPVVQFKGSSQENLVRDFSVQENGDRFSDQTKTHATENETKRSSSSKGEQALKESALLRMPVSPYDKQKISKATNKEQDLQGISFAEKKSIDTVVVRPDKKELLSKVEKSSRKRIPSQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIKSQAFRLSPSTYKSWRNITLFFVPSKM
MRLENGLAISMILHVMFLLLLYFNFNVQLLVPISRREMLSVDNIYNEDYHSSKYKKIEEPVVQFKGSSQENLVRDFSVQENGDRFSDQTKTHATENETKRSSSSKGEQALKESALLRMPVSPYDKQKISKATNKEQDLQGISFAEKKSIDTVVVRPDKKELLSKVEKSSRKRIPSQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIKSQAFRLSPSTYKSWRNITLFFVPSKM
MRLENGLAISMILHVMFLLLLYFNFNVQLLVPISRREMLSVDNIYNEDYHSSKYKKIEEPVVQFKGSSQENLVRDFSVQENGDRFSDQTKTHATENETKRSSSSKGEQALKESALLRMPVSPYDKQKISKATNKEQDLQGISFAEKKSIDTVVVRPDKKELLSKVEKSSRKRIPSQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIKSQAFRLSPSTYKSWRNITLFFVPSKM

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target271 signal peptide protein [Candidatus Liberibacter asiatic
254780957176 dihydrofolate reductase protein [Candidatus Liberi 0.004
>gi|254780957|ref|YP_003065370.1| dihydrofolate reductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 176 Back     alignment
 Score = 33.1 bits (74), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 11/75 (14%)

Query: 180 AIVRNRVIAN-----WNIPSDFKRFKKLRVKMHFQLNQKGF-VLGKINVDVVGGTELVRR 233
           AI RN VI +     W I SD KRFK L       +  + F  +G++   + G T ++  
Sbjct: 11  AITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRL---LPGRTNII-- 65

Query: 234 MLRENARKAVIKSQA 248
           + R+N R+A +  +A
Sbjct: 66  ITRDNTRRASVNPEA 80

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target271 signal peptide protein [Candidatus Liberibacter asiatic
315122877265 signal peptide protein [Candidatus Liberibacter solanac 1 1e-51
227823309356 putative TolA outer membrane protein [Sinorhizobium fre 1 3e-11
222086974139 signal peptide protein [Agrobacterium radiobacter K84] 1 9e-09
150397826356 putative signal peptide protein [Sinorhizobium medicae 1 1e-08
15966493356 putative signal peptide protein [Sinorhizobium meliloti 1 1e-08
163758791332 hypothetical protein HPDFL43_15247 [Hoeflea phototrophi 1 1e-07
218662998378 putative TolA outer membrane protein [Rhizobium etli IE 1 2e-07
15891233384 hypothetical protein Atu3715 [Agrobacterium tumefaciens 1 7e-07
332716444389 putative TolA outer membrane protein [Agrobacterium sp. 1 7e-07
222149662389 hypothetical protein Avi_3620 [Agrobacterium vitis S4] 1 1e-06
>gi|315122877|ref|YP_004063366.1| signal peptide protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 265 Back     alignment and organism information
 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 129/275 (46%), Positives = 173/275 (62%), Gaps = 14/275 (5%)

Query: 1   MRLENGLAISMILHVMFLLLLYFNFNVQLLVPISRREMLSVDNIYNEDYHSSKY----KK 56
           MR+ENGLAIS+ILH +FLLLLY NFNVQL VP+S+ E  S+ NI+N+D HS+KY      
Sbjct: 1   MRVENGLAISLILHFIFLLLLYLNFNVQLFVPVSKIEGSSIKNIHNDDLHSNKYSGDKNN 60

Query: 57  IEEPVVQFKGSSQENLVRDFSVQENGDRFSDQTKTHATENETKRSSSSKGEQALKESALL 116
            +E V   +  S++     F  Q+N  +  DQ KT    +E K+ S S+GE ALKES+  
Sbjct: 61  EKEEVFHSREMSEKTGAHWFEDQQNNSKSFDQGKTQTIPDELKKFSDSEGEHALKESSPP 120

Query: 117 RMPVSPYDKQKISKATNKEQDLQGISFAEKKSIDTVVVRPDKKELLSKVEKSSRKRIPSQ 176
            + + P DK++  K  NK           KK+I  + V         K++    +   SQ
Sbjct: 121 NVSLRPLDKKQHIK--NKAHSQHSTPSIIKKNIAKLPV--------PKIDTKQSRSNFSQ 170

Query: 177 DAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLR 236
           + I IVR R++ NWNIP D K+FKK++VKMHF LN+ GFV+G  ++ VVGGTEL RR L 
Sbjct: 171 NEIGIVRRRIMGNWNIPPDLKKFKKIQVKMHFSLNRNGFVIGNPDITVVGGTELARRTLV 230

Query: 237 ENARKAVIKSQAFRLSPSTYKSWRNITLFFVPSKM 271
           ++ARKA IKSQ FRL    YK+WRN+T+ F+PSKM
Sbjct: 231 KSARKAFIKSQPFRLPADKYKNWRNMTIHFIPSKM 265


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227823309|ref|YP_002827281.1| putative TolA outer membrane protein [Sinorhizobium fredii NGR234] Length = 356 Back     alignment and organism information
>gi|222086974|ref|YP_002545508.1| signal peptide protein [Agrobacterium radiobacter K84] Length = 139 Back     alignment and organism information
>gi|150397826|ref|YP_001328293.1| putative signal peptide protein [Sinorhizobium medicae WSM419] Length = 356 Back     alignment and organism information
>gi|15966493|ref|NP_386846.1| putative signal peptide protein [Sinorhizobium meliloti 1021] Length = 356 Back     alignment and organism information
>gi|163758791|ref|ZP_02165878.1| hypothetical protein HPDFL43_15247 [Hoeflea phototrophica DFL-43] Length = 332 Back     alignment and organism information
>gi|218662998|ref|ZP_03518928.1| putative TolA outer membrane protein [Rhizobium etli IE4771] Length = 378 Back     alignment and organism information
>gi|15891233|ref|NP_356905.1| hypothetical protein Atu3715 [Agrobacterium tumefaciens str. C58] Length = 384 Back     alignment and organism information
>gi|332716444|ref|YP_004443910.1| putative TolA outer membrane protein [Agrobacterium sp. H13-3] Length = 389 Back     alignment and organism information
>gi|222149662|ref|YP_002550619.1| hypothetical protein Avi_3620 [Agrobacterium vitis S4] Length = 389 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 271 signal peptide protein [Candidatus Liberibacter asiatic
TIGR02794452 tolA_full protein TolA; InterPro: IPR014161 TolA couple 99.77
COG0810244 TonB Periplasmic protein TonB, links inner and outer me 99.75
PRK09510402 tolA cell envelope integrity inner membrane protein Tol 99.73
PRK10819243 transport protein TonB; Provisional 99.62
pfam0651996 TolA TolA C-terminal. This family consists of several b 99.48
COG3064387 TolA Membrane protein involved in colicin uptake [Cell 98.99
TIGR0135281 tonB_Cterm TonB family C-terminal domain; InterPro: IPR 98.93
pfam0354479 TonB Gram-negative bacterial tonB protein. 98.02
TIGR02794 452 tolA_full protein TolA; InterPro: IPR014161 TolA couple 98.43
COG3064 387 TolA Membrane protein involved in colicin uptake [Cell 95.24
PRK10819243 transport protein TonB; Provisional 94.17
>TIGR02794 tolA_full protein TolA; InterPro: IPR014161 TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal) Back     alignment and domain information
>COG0810 TonB Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>PRK10819 transport protein TonB; Provisional Back     alignment and domain information
>pfam06519 TolA TolA C-terminal Back     alignment and domain information
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01352 tonB_Cterm TonB family C-terminal domain; InterPro: IPR006260 The sequences in this set all contain a conserved C-terminal domain which is characteristic of TonB and is homologs Back     alignment and domain information
>pfam03544 TonB Gram-negative bacterial tonB protein Back     alignment and domain information
>TIGR02794 tolA_full protein TolA; InterPro: IPR014161 TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal) Back     alignment and domain information
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10819 transport protein TonB; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target271 signal peptide protein [Candidatus Liberibacter asiatic
1lr0_A129 Pseudomonas Aeruginosa Tola Domain Iii, Seleno-Meth 4e-04
>gi|21466140|pdb|1LR0|A Chain A, Pseudomonas Aeruginosa Tola Domain Iii, Seleno-Methionine Derivative Length = 129 Back     alignment and structure
 Score = 49.9 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 33/127 (25%), Gaps = 12/127 (9%)

Query: 150 DTVVVRPDKKELLSKVEKSSRKRIPSQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQ 209
             +           +          +     ++ N V   W  P   +      V++  +
Sbjct: 2   RALAELLSDTTERQQALADEVGSEVTGSLDDLIVNLVSQQWRRPPSAR--NGXSVEVLIE 59

Query: 210 LNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIKSQAFR----LSPSTYKS-WRNITL 264
               G +         G      +    +A  AV           L  +T+ S +R   +
Sbjct: 60  XLPDGTITNASVSRSSGD-----KPFDSSAVAAVRNVGRIPEXQQLPRATFDSLYRQRRI 114

Query: 265 FFVPSKM 271
            F P  +
Sbjct: 115 IFKPEDL 121


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target271 signal peptide protein [Candidatus Liberibacter asiatic
1lr0_A129 TOLA protein; domain-swapping, TONB, protein transport; 6e-07
1tol_A222 G3P - TOLA, protein (fusion protein consisting of minor 6e-07
>1lr0_A TOLA protein; domain-swapping, TONB, protein transport; 1.91A {Pseudomonas aeruginosa} SCOP: d.212.1.1 Length = 129 Back     alignment and structure
 Score = 50.0 bits (119), Expect = 6e-07
 Identities = 15/102 (14%), Positives = 33/102 (32%), Gaps = 12/102 (11%)

Query: 175 SQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRM 234
           +     ++ N V   W  P   +    + V++  ++   G +         G      + 
Sbjct: 27  TGSLDDLIVNLVSQQWRRPPSARN--GMSVEVLIEMLPDGTITNASVSRSSG-----DKP 79

Query: 235 LRENARKAVIKSQAF----RLSPSTY-KSWRNITLFFVPSKM 271
              +A  AV          +L  +T+   +R   + F P  +
Sbjct: 80  FDSSAVAAVRNVGRIPEMQQLPRATFDSLYRQRRIIFKPEDL 121


>1tol_A G3P - TOLA, protein (fusion protein consisting of minor coat protein, glycine rich linker, TOLA,...; bacteriophage M13, phage infection; 1.85A {Enterobacteria phage M13} SCOP: b.37.1.1 d.212.1.1 PDB: 1s62_A Length = 222 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target271 signal peptide protein [Candidatus Liberibacter asiatic
1lr0_A129 TOLA protein; domain-swapping, TONB, protein transport; 99.92
1tol_A222 G3P - TOLA, protein (fusion protein consisting of minor 99.7
2grx_C229 Protein TONB; beta barrel, outer membrane, heterocomple 99.32
2k9k_A106 TONB2; metal transport; NMR {Listonella anguillarum} 97.85
1u07_A90 TONB protein; beta-hairpin, protein transport; 1.13A {E 97.7
>1lr0_A TOLA protein; domain-swapping, TONB, protein transport; 1.91A {Pseudomonas aeruginosa} SCOP: d.212.1.1 Back     alignment and structure
Probab=99.92  E-value=1.4e-24  Score=158.10  Aligned_cols=94  Identities=16%  Similarity=0.262  Sum_probs=83.6

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEEECCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             00000789999999999622546565553752999999987998185335640588860589999999999999718898
Q gi|254780549|r  171 KRIPSQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIKSQAFR  250 (271)
Q Consensus       171 ~~~~~~~~~~~ir~~I~~~w~~p~~~~~~~~~~v~v~i~l~~~G~v~~~~~~~~~~~~~~~~~~~~~~a~rAi~~~~p~~  250 (271)
                      +..++.+|.++|+++|++||++|.+++  .++.|+|+|+|++||+|.+..++.+||+     +.||++|+|||.+|+||+
T Consensus        23 ~~~~~~~y~~~i~~~I~~~W~~P~~~~--~~~~v~v~i~l~~dG~v~~~~i~~sSG~-----~~~d~aa~~Av~ra~p~p   95 (129)
T 1lr0_A           23 GSEVTGSLDDLIVNLVSQQWRRPPSAR--NGMSVEVLIEMLPDGTITNASVSRSSGD-----KPFDSSAVAAVRNVGRIP   95 (129)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCCCCTTCC--TTCCEEEEEEECTTSBEEEEEEEECCSC-----HHHHHHHHHHHHHHCBCG
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCC--CCCEEEEEEEECCCCCEEEEEECCCCCC-----HHHHHHHHHHHHHHCCCC
T ss_conf             588999999999999998468998778--8978999999989998987551027787-----589999999999852699


Q ss_pred             C----CHHHHHH-CCEEEEEECHHHC
Q ss_conf             8----8467761-2228997444009
Q gi|254780549|r  251 L----SPSTYKS-WRNITLFFVPSKM  271 (271)
Q Consensus       251 ~----p~~~y~~-~~~~~~~F~p~~m  271 (271)
                      .    |++.|+. ||+|+|+|+|++|
T Consensus        96 ~p~~~p~~~y~~~~r~i~l~F~Ped~  121 (129)
T 1lr0_A           96 EMQQLPRATFDSLYRQRRIIFKPEDL  121 (129)
T ss_dssp             GGGGSCHHHHHHHTSEEEEEECHHHH
T ss_pred             CCCCCCHHHHHHHEEEEEEEECHHHC
T ss_conf             99877977874400677899882133



>1tol_A G3P - TOLA, protein (fusion protein consisting of minor coat protein, glycine rich linker, TOLA,...; bacteriophage M13, phage infection; 1.85A {Enterobacteria phage M13} SCOP: b.37.1.1 d.212.1.1 PDB: 1s62_A Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Back     alignment and structure
>2k9k_A TONB2; metal transport; NMR {Listonella anguillarum} Back     alignment and structure
>1u07_A TONB protein; beta-hairpin, protein transport; 1.13A {Escherichia coli} SCOP: d.212.1.2 PDB: 2gsk_B* 1ihr_A 1qxx_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 271 signal peptide protein [Candidatus Liberibacter asiatic
d1lr0a_126 d.212.1.1 (A:) TolA {Pseudomonas aeruginosa [TaxId: 287 1e-05
d1tola292 d.212.1.1 (A:125-216) TolA {Escherichia coli [TaxId: 56 1e-04
>d1lr0a_ d.212.1.1 (A:) TolA {Pseudomonas aeruginosa [TaxId: 287]} Length = 126 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: TolA/TonB C-terminal domain
superfamily: TolA/TonB C-terminal domain
family: TolA
domain: TolA
species: Pseudomonas aeruginosa [TaxId: 287]
 Score = 43.9 bits (103), Expect = 1e-05
 Identities = 15/102 (14%), Positives = 33/102 (32%), Gaps = 12/102 (11%)

Query: 175 SQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRM 234
           +     ++ N V   W  P   +    + V++  ++   G +         G      + 
Sbjct: 25  TGSLDDLIVNLVSQQWRRPPSARN--GMSVEVLIEMLPDGTITNASVSRSSG-----DKP 77

Query: 235 LRENARKAVIKSQAF----RLSPSTY-KSWRNITLFFVPSKM 271
              +A  AV          +L  +T+   +R   + F P  +
Sbjct: 78  FDSSAVAAVRNVGRIPEMQQLPRATFDSLYRQRRIIFKPEDL 119


>d1tola2 d.212.1.1 (A:125-216) TolA {Escherichia coli [TaxId: 562]} Length = 92 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target271 signal peptide protein [Candidatus Liberibacter asiatic
d1lr0a_126 TolA {Pseudomonas aeruginosa [TaxId: 287]} 99.91
d1tola292 TolA {Escherichia coli [TaxId: 562]} 99.72
d1u07a_90 TonB {Escherichia coli [TaxId: 562]} 97.89
>d1lr0a_ d.212.1.1 (A:) TolA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: TolA/TonB C-terminal domain
superfamily: TolA/TonB C-terminal domain
family: TolA
domain: TolA
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.91  E-value=1.6e-24  Score=156.30  Aligned_cols=94  Identities=16%  Similarity=0.271  Sum_probs=83.4

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEEECCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             00000789999999999622546565553752999999987998185335640588860589999999999999718898
Q gi|254780549|r  171 KRIPSQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIKSQAFR  250 (271)
Q Consensus       171 ~~~~~~~~~~~ir~~I~~~w~~p~~~~~~~~~~v~v~i~l~~~G~v~~~~~~~~~~~~~~~~~~~~~~a~rAi~~~~p~~  250 (271)
                      +..++.+|.++|+++|++||++|.+++  .++.|+|+|+|++||+|.+..++.+||+     ..||++|+|||.+|+|||
T Consensus        21 ~~~~~~sy~~~i~~~I~~~W~~P~~~~--~~~~v~v~~~i~~dG~v~~~~i~~sSG~-----~~~D~sa~~Av~~a~p~P   93 (126)
T d1lr0a_          21 GSEVTGSLDDLIVNLVSQQWRRPPSAR--NGMSVEVLIEMLPDGTITNASVSRSSGD-----KPFDSSAVAAVRNVGRIP   93 (126)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCCCCTTCC--TTCCEEEEEEECTTSBEEEEEEEECCSC-----HHHHHHHHHHHHHHCBCG
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCC--CCCEEEEEEEEECCCCEEEEEEECCCCC-----HHHHHHHHHHHHHHCCCC
T ss_conf             789999999999999998568997778--8978999999918998953032047876-----678999999999854799


Q ss_pred             ----CCHHHHH-HCCEEEEEECHHHC
Q ss_conf             ----8846776-12228997444009
Q gi|254780549|r  251 ----LSPSTYK-SWRNITLFFVPSKM  271 (271)
Q Consensus       251 ----~p~~~y~-~~~~~~~~F~p~~m  271 (271)
                          +|+++|+ .||+|+|+|+|.+|
T Consensus        94 ~p~~~p~~~f~~~~r~i~l~F~Pedl  119 (126)
T d1lr0a_          94 EMQQLPRATFDSLYRQRRIIFKPEDL  119 (126)
T ss_dssp             GGGGSCHHHHHHHTSEEEEEECHHHH
T ss_pred             CCCCCCHHHHHHCCEEEEEEECHHHH
T ss_conf             99888977875401688999870471



>d1tola2 d.212.1.1 (A:125-216) TolA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u07a_ d.212.1.2 (A:) TonB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target271 signal peptide protein [Candidatus Liberibacter asiatic
1lr0_A_129 TOLA protein; domain-swapping, TONB, protein trans 99.76
1tol_A_222 G3P - TOLA, protein (fusion protein consisting of 99.76
2grx_C_229 Protein TONB; beta barrel, outer membrane, heteroc 99.64
2k9k_A_106 TONB2; metal transport; NMR {Listonella anguillaru 98.43
1u07_A_90 TONB protein; beta-hairpin, protein transport; 1.1 98.22
>1lr0_A (A:) TOLA protein; domain-swapping, TONB, protein transport; 1.91A {Pseudomonas aeruginosa} Back     alignment and structure
Probab=99.76  E-value=4.6e-18  Score=121.81  Aligned_cols=99  Identities=13%  Similarity=0.151  Sum_probs=86.0

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEEECCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             11000000007899999999996225465655537529999999879981853356405888605899999999999997
Q gi|254780549|r  166 EKSSRKRIPSQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIK  245 (271)
Q Consensus       166 ~~~~~~~~~~~~~~~~ir~~I~~~w~~p~~~~~~~~~~v~v~i~l~~~G~v~~~~~~~~~~~~~~~~~~~~~~a~rAi~~  245 (271)
                      .........+.+|.+.|+.+|++||+||.+++  .++.|+|.|.|++||+|.+..++.+||+.     .||++|++||.+
T Consensus        18 ~~~~~~~~~~~~y~~~i~~~i~~~~~yP~~a~--~~~~v~V~~~i~~dG~V~~~~i~~sSG~~-----~ld~aa~~Av~~   90 (129)
T 1lr0_A           18 LADEVGSEVTGSLDDLIVNLVSQQWRRPPSAR--NGXSVEVLIEXLPDGTITNASVSRSSGDK-----PFDSSAVAAVRN   90 (129)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHCCCCTTCC--TTCCEEEEEEECTTSBEEEEEEEECCSCH-----HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC--CCCEEEEEEEEECCCCEEECCCCCCCCCH-----HHHHHHHHHHHH
T ss_conf             65543589999999999999998568998888--89789999999279988322023578678-----999999999998


Q ss_pred             HCCCCCCH-----HHHHHCCEEEEEECHHHC
Q ss_conf             18898884-----677612228997444009
Q gi|254780549|r  246 SQAFRLSP-----STYKSWRNITLFFVPSKM  271 (271)
Q Consensus       246 ~~p~~~p~-----~~y~~~~~~~~~F~p~~m  271 (271)
                      |+||+.+|     +.|..|.+|.++|+|++|
T Consensus        91 ~~~~p~~P~~~~~~~~~~~~~~~i~F~l~~~  121 (129)
T 1lr0_A           91 VGRIPEXQQLPRATFDSLYRQRRIIFKPEDL  121 (129)
T ss_dssp             HCBCGGGGGSCHHHHHHHTSEEEEEECHHHH
T ss_pred             HCCCCCCCCCCHHHHHHHEEEEEEEECHHHC
T ss_conf             5679999877977875412787899861033



>1tol_A (A:) G3P - TOLA, protein (fusion protein consisting of minor coat protein, glycine rich linker, TOLA,...; bacteriophage M13, phage infection; 1.85A {Enterobacteria phage M13} Back     alignment and structure
>2grx_C (C:) Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} Back     alignment and structure
>2k9k_A (A:) TONB2; metal transport; NMR {Listonella anguillarum} Back     alignment and structure
>1u07_A (A:) TONB protein; beta-hairpin, protein transport; 1.13A {Escherichia coli} Back     alignment and structure