254780548

254780548

translocation protein TolB

GeneID in NCBI database:8209544Locus tag:CLIBASIA_02175
Protein GI in NCBI database:254780548Protein Accession:YP_003064961.1
Gene range:+(731085, 732428)Protein Length:447aa
Gene description:translocation protein TolB
COG prediction:[U] Periplasmic component of the Tol biopolymer transport system
KEGG prediction:tolB; translocation protein TolB; K03641 TolB protein
SEED prediction:tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------
MSLRFFIAEELNMKINLCLLLVLIGGFFPTSIHAFVKVATNSANYSPVSIAFTKFVSIDELGGKVSEVVSKDLQRSDVFNLISQDSFKQKITNPDSIPRFQDWNSLGAQVLVTGRVIKEGKDRLRVEFRLWDVKDRKQIIGKKFFSSPASWRKIAHTISDDIYQSITGEKGDFNSRILFVSESVVSGIIKNSLCVMDRDGANIRYLTPSRDQILFEPRFSPNQQKVAYATYDDEDILRVYLMDTRIDRAPKRIGNFRSMILAPRFSSNGKRALISVQKDEAMDIYSVDLQSNATERLTNTLFINISASYSPDSSQIVFESDREGKEQLYVMQSNGSDQKRISQDKEASYFDPVWSPQGDLIAFTKFSGEKFAIGVMKKDGSQERLLVEDSNLQAPTWSPSGRSLIFSRKKDGDTGSKLYSIDLNGRNETLINTPAYASDPQWVGFMD
ccEEEEEHHHHcHHHHHHHHHHHHHHHHHHHccccEEEEEccccccEEEEEEccccccccccHHHHHHHHccccccccEEEEcccccccccccccccccHHHHHHcccEEEEEEEEEEccccEEEEEEEEEEcccccEEEEEEEEEcHHHcccccccHHHHHHHHHHccccccccEEEEEEEccccccccEEEEEEEcccccEEEEEcccccEEEEEEEcccccEEEEEEccccccEEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEcccccEEEEEEEcccccEEEccccccEEEEEEEcccccEEEEEEccccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEEEEcccccEEEEccccccccEEEcccccEEEEEEcccccccEEEEEEEcccccEEEEEccccccccEEEEccc
ccccEHHHccHHHHHHHHHHHHHHHHHHHccHcccEEEEEcccccccccEEcccccccccccHHHHHHHHHHHHcccccccccHHHcccccccccccccHHHHHHccccEEEEEEEEEcccccEEEEEEEEEccccccEccccccccHHHHHHHHHHHHHHHHHHHccccccEcEEEEEEEEEcccccccEEEEEEEccccccEEEEcccccccccccccccccEEEEEEEcccccEEEEEEEEccccEEEEEEccccccccccccccccEEEEEEEccccccEEEEEccccccEEccccccccccccccccccEEEEEcccccccEEEEEEccccccEEEEEEcccccccccEcccccEEEEEEcccccEEEEEEEcccccEEEEcccccccccccccccEEEEEEEccccccccEEEEEEccccccccccccccccccccccccc
MSLRFFIAEELNMKINLCLLLVLIGGFFPTSIHAFVKVAtnsanyspvsIAFTKFVSIDELGGKVSEVVskdlqrsdvfnlisqdsfkqkitnpdsiprfqdwnslgaqVLVTGRVIKEGKDRLRVEFRLWdvkdrkqiigkkffsspasWRKIAHTISddiyqsitgekgdfnsrILFVSESVVSGIIKNSlcvmdrdganiryltpsrdqilfeprfspnqqkvayatyddedILRVYLMDtridrapkrignfrsmilaprfssngkrALISVQKDEAMDIYSVDLQSNATERLTNTLFINisasyspdssqivfesdreGKEQLYVMQSngsdqkrisqdkeasyfdpvwspqgdliaftkfsgekfaigvmkkdgsqerllvedsnlqaptwspsgrslifsrkkdgdtgsklysidlngrnetlintpayasdpqwvgfmd
MSLRFFIAEELNMKINLCLLLVLIGGFFPTSIHAFVKVATNSANYSPVSIAFTKFVSIDELGGKVSEVvskdlqrsdvfnlisqdsfkqkitnpdsiprfqdwnslgaqvlvtgrvikegkdrlrvefrlwdvkdrkqiigkkffsspaswrkIAHTISDDIYQSITGEKGDFNSRILFVSESVVSGIIKNSLCVMDRDGANIRYLTpsrdqilfeprfspnqqkvayatyddediLRVYLMDTridrapkrignfrsmilaprfssngKRALISVQKDEAMDIYSVDLQSNATERLTNTLFINisasyspdsSQIVFESDREGKEQLYVMQsngsdqkrisQDKEASYFDPVWSPQGDLIAFTKFSGEKFAIGVMKKDGSQERLLVedsnlqaptwspsgrslifsrkkdgdtgsKLYSIDLngrnetlintpayasdpqwvGFMD
MSLRFFIAEELNMKINLCLLLVLIGGFFPTSIHAFVKVATNSANYSPVSIAFTKFVSIDELGGKVSEVVSKDLQRSDVFNLISQDSFKQKITNPDSIPRFQDWNSLGAQVLVTGRVIKEGKDRLRVEFRLWDVKDRKQIIGKKFFSSPASWRKIAHTISDDIYQSITGEKGDFNSRILFVSESVVSGIIKNSLCVMDRDGANIRYLTPSRDQILFEPRFSPNQQKVAYATYDDEDILRVYLMDTRIDRAPKRIGNFRSMILAPRFSSNGKRALISVQKDEAMDIYSVDLQSNATERLTNTLFINISASYSPDSSQIVFESDREGKEQLYVMQSNGSDQKRISQDKEASYFDPVWSPQGDLIAFTKFSGEKFAIGVMKKDGSQERLLVEDSNLQAPTWSPSGRSLIFSRKKDGDTGSKLYSIDLNGRNETLINTPAYASDPQWVGFMD
*********E***KINLCLLLVLIGGFFPTSIHAFVKVATNSANYSPVSIAFTKFVSIDELGGKVSEVVSKDLQRSDVFNLIS***************RFQDWNSLGAQVLVTGRVIKEGKDRLRVEFRLWDVKDRKQII****FS**ASWRKIAHTISDDIYQSITGEKGDFNSRILFVSESVVSGIIKNSLCVMDRDGANIRYLTPSRDQILFEPRFSPNQQKVAYATYDDEDILRVYLMDTRID***********MILAPRFSSNGKRALISVQKDEAMDIYSVDLQSNATERLTNTLFINISASYSPDSSQIVFESDREGKEQLYVMQSNGSDQKRISQDKEASYFDPVWSPQGDLIAFTKFSGEKFAIGVMKKDGSQERLLVEDSNLQAPTWSPSGRSLIFSRKKDGDTGSKLYSIDLNGR**********ASDPQWVGFMD
MSLRFFIAEELNMKINLCLLLVLIGGFFPTSIHAFVKVATNSANYSPVSIAFTKFVSIDELGGKVSEVVSKDLQRSDVFNLISQDSFKQKITNPDSIPRFQDWNSLGAQVLVTGRVIKEGKDRLRVEFRLWDVKDRKQIIGKKFFSSPASWRKIAHTISDDIYQSITGEKGDFNSRILFVSESVVSGIIKNSLCVMDRDGANIRYLTPSRDQILFEPRFSPNQQKVAYATYDDEDILRVYLMDTRIDRAPKRIGNFRSMILAPRFSSNGKRALISVQKDEAMDIYSVDLQSNATERLTNTLFINISASYSPDSSQIVFESDREGKEQLYVMQSNGSDQKRISQDKEASYFDPVWSPQGDLIAFTKFSGEKFAIGVMKKDGSQERLLVEDSNLQAPTWSPSGRSLIFSRKKDGDTGSKLYSIDLNGRNETLINTPAYASDPQWVGFMD
*SLRFFIAEELNMKINLCLLLVLIGGFFPTSIHAFVKVATNSANYSPVSIAFTKFVSIDELGGKVSEVVSKDLQRSDVFNLISQDSFKQKITNPDSIPRFQDWNSLGAQVLVTGRVIKEGKDRLRVEFRLWDVKDRKQIIGKKFFSSPASWRKIAHTISDDIYQSITGEKGDFNSRILFVSESVVSGIIKNSLCVMDRDGANIRYLTPSRDQILFEPRFSPNQQKVAYATYDDEDILRVYLMDTRIDRAPKRIGNFRSMILAPRFSSNGKRALISVQKDEAMDIYSVDLQSNATERLTNTLFINISASYSPDSSQIVFESDREGKEQLYVMQSNGSDQKRISQDKEASYFDPVWSPQGDLIAFTKFSGEKFAIGVMKKDGSQERLLVEDSNLQAPTWSPSGRSLIFSRKKDGDTGSKLYSIDLNGRNET********SDPQW*****
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MSLRFFIAEELNMKINLCLLLVLIGGFFPTSIHAFVKVATNSANYSPVSIAFTKFVSIDELGGKVSEVVSKDLQRSDVFNLISQDSFKQKITNPDSIPRFQDWNSLGAQVLVTGRVIKEGKDRLRVEFRLWDVKDRKQIIGKKFFSSPASWRKIAHTISDDIYQSITGEKGDFNSRILFVSESVVSGIIKNSLCVMDRDGANIRYLTPSRDQILFEPRFSPNQQKVAYATYDDEDILRVYLMDTRIDRAPKRIGNFRSMILAPRFSSNGKRALISVQKDEAMDIYSVDLQSNATERLTNTLFINISASYSPDSSQIVFESDREGKEQLYVMQSNGSDQKRISQDKEASYFDPVWSPQGDLIAFTKFSGEKFAIGVMKKDGSQERLLVEDSNLQAPTWSPSGRSLIFSRKKDGDTGSKLYSIDLNGRNETLINTPAYASDPQWVGFMD
MSLRFFIAEELNMKINLCLLLVLIGGFFPTSIHAFVKVATNSANYSPVSIAFTKFVSIDELGGKVSEVVSKDLQRSDVFNLISQDSFKQKITNPDSIPRFQDWNSLGAQVLVTGRVIKEGKDRLRVEFRLWDVKDRKQIIGKKFFSSPASWRKIAHTISDDIYQSITGEKGDFNSRILFVSESVVSGIIKNSLCVMDRDGANIRYLTPSRDQILFEPRFSPNQQKVAYATYDDEDILRVYLMDTRIDRAPKRIGNFRSMILAPRFSSNGKRALISVQKDEAMDIYSVDLQSNATERLTNTLFINISASYSPDSSQIVFESDREGKEQLYVMQSNGSDQKRISQDKEASYFDPVWSPQGDLIAFTKFSGEKFAIGVMKKDGSQERLLVEDSNLQAPTWSPSGRSLIFSRKKDGDTGSKLYSIDLNGRNETLINTPAYASDPQWVGFMD
MSLRFFIAEELNMKINLCLLLVLIGGFFPTSIHAFVKVATNSANYSPVSIAFTKFVSIDELGGKVSEVVSKDLQRSDVFNLISQDSFKQKITNPDSIPRFQDWNSLGAQVLVTGRVIKEGKDRLRVEFRLWDVKDRKQIIGKKFFSSPASWRKIAHTISDDIYQSITGEKGDFNSRILFVSESVVSGIIKNSLCVMDRDGANIRYLTPSRDQILFEPRFSPNQQKVAYATYDDEDILRVYLMDTRIDRAPKRIGNFRSMILAPRFSSNGKRALISVQKDEAMDIYSVDLQSNATERLTNTLFINISASYSPDSSQIVFESDREGKEQLYVMQSNGSDQKRISQDKEASYFDPVWSPQGDLIAFTKFSGEKFAIGVMKKDGSQERLLVEDSNLQAPTWSPSGRSLIFSRKKDGDTGSKLYSIDLNGRNETLINTPAYASDPQWVGFMD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target447 translocation protein TolB [Candidatus Liberibacter asi
315122876435 translocation protein TolB [Candidatus Liberibacter sol 1 0.0
159185873435 translocation protein TolB [Agrobacterium tumefaciens s 1 1e-117
332716443443 protein tolB precursor [Agrobacterium sp. H13-3] Length 1 1e-117
15966492436 translocation protein TolB [Sinorhizobium meliloti 1021 1 1e-117
307300471434 Tol-Pal system beta propeller repeat protein TolB [Sino 1 1e-117
150397825436 translocation protein TolB [Sinorhizobium medicae WSM41 1 1e-116
163758790450 translocation protein TolB precursor [Hoeflea phototrop 1 1e-116
239832783475 Tol-Pal system beta propeller repeat protein TolB [Ochr 1 1e-112
153008549443 translocation protein TolB [Ochrobactrum anthropi ATCC 1 1e-111
222149663435 translocation protein TolB [Agrobacterium vitis S4] Len 1 1e-111
>gi|315122876|ref|YP_004063365.1| translocation protein TolB [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 435 Back     alignment and organism information
 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/435 (72%), Positives = 369/435 (84%)

Query: 13  MKINLCLLLVLIGGFFPTSIHAFVKVATNSANYSPVSIAFTKFVSIDELGGKVSEVVSKD 72
           M + + LLLVL+ GFF   + A VKV  N+++YSPVSIA T FVS+DELGGK SEV+SK+
Sbjct: 1   MNVKIFLLLVLVSGFFSVPVQALVKVNVNNSDYSPVSIAVTDFVSLDELGGKFSEVISKN 60

Query: 73  LQRSDVFNLISQDSFKQKITNPDSIPRFQDWNSLGAQVLVTGRVIKEGKDRLRVEFRLWD 132
           LQ+SDVF  I Q SFKQKITNPD  PRF DW SLGAQVLV GRVIKEGKDRLRVEFRLWD
Sbjct: 61  LQKSDVFTQIPQGSFKQKITNPDITPRFHDWQSLGAQVLVMGRVIKEGKDRLRVEFRLWD 120

Query: 133 VKDRKQIIGKKFFSSPASWRKIAHTISDDIYQSITGEKGDFNSRILFVSESVVSGIIKNS 192
           +KDRKQI+GKKFF+SP  WR++AH ISD+IYQ+ITGEK  FN+R+LFVSES+VSG+IKN 
Sbjct: 121 IKDRKQILGKKFFASPVDWRRLAHIISDEIYQNITGEKSYFNTRLLFVSESIVSGVIKNR 180

Query: 193 LCVMDRDGANIRYLTPSRDQILFEPRFSPNQQKVAYATYDDEDILRVYLMDTRIDRAPKR 252
           LC+MD+DG N+RYLTP+ D+ILF P+F P QQKVAYA+YDDEDIL+VYLMD RIDRAPKR
Sbjct: 181 LCLMDQDGFNVRYLTPNSDRILFTPQFYPKQQKVAYASYDDEDILKVYLMDIRIDRAPKR 240

Query: 253 IGNFRSMILAPRFSSNGKRALISVQKDEAMDIYSVDLQSNATERLTNTLFINISASYSPD 312
           IGNFR M ++PRFS +G R ++ VQK+ A+D+Y+VD+ S A +RLTNTLF NIS SYSPD
Sbjct: 241 IGNFRGMNISPRFSLDGNRVIMGVQKEGAIDLYNVDVHSYAFKRLTNTLFANISPSYSPD 300

Query: 313 SSQIVFESDREGKEQLYVMQSNGSDQKRISQDKEASYFDPVWSPQGDLIAFTKFSGEKFA 372
           SSQIVFESDREGK+QLYVMQS+GSDQ+RISQDK+A YFDP WSP  ++IAFTKFS  KFA
Sbjct: 301 SSQIVFESDREGKQQLYVMQSDGSDQRRISQDKDAFYFDPSWSPNDNIIAFTKFSEGKFA 360

Query: 373 IGVMKKDGSQERLLVEDSNLQAPTWSPSGRSLIFSRKKDGDTGSKLYSIDLNGRNETLIN 432
           IGVM+ DGSQER+LV D NLQ P WSP+GRSLIF+RKK  D GSKLYSI+LNGRNE LIN
Sbjct: 361 IGVMRVDGSQERILVTDFNLQTPIWSPNGRSLIFARKKMDDIGSKLYSINLNGRNEMLIN 420

Query: 433 TPAYASDPQWVGFMD 447
           TPAYA DP W+  +D
Sbjct: 421 TPAYALDPHWIAPVD 435


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159185873|ref|NP_356906.2| translocation protein TolB [Agrobacterium tumefaciens str. C58] Length = 435 Back     alignment and organism information
>gi|332716443|ref|YP_004443909.1| protein tolB precursor [Agrobacterium sp. H13-3] Length = 443 Back     alignment and organism information
>gi|15966492|ref|NP_386845.1| translocation protein TolB [Sinorhizobium meliloti 1021] Length = 436 Back     alignment and organism information
>gi|307300471|ref|ZP_07580251.1| Tol-Pal system beta propeller repeat protein TolB [Sinorhizobium meliloti BL225C] Length = 434 Back     alignment and organism information
>gi|150397825|ref|YP_001328292.1| translocation protein TolB [Sinorhizobium medicae WSM419] Length = 436 Back     alignment and organism information
>gi|163758790|ref|ZP_02165877.1| translocation protein TolB precursor [Hoeflea phototrophica DFL-43] Length = 450 Back     alignment and organism information
>gi|239832783|ref|ZP_04681112.1| Tol-Pal system beta propeller repeat protein TolB [Ochrobactrum intermedium LMG 3301] Length = 475 Back     alignment and organism information
>gi|153008549|ref|YP_001369764.1| translocation protein TolB [Ochrobactrum anthropi ATCC 49188] Length = 443 Back     alignment and organism information
>gi|222149663|ref|YP_002550620.1| translocation protein TolB [Agrobacterium vitis S4] Length = 435 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target447 translocation protein TolB [Candidatus Liberibacter asi
PRK05137435 PRK05137, tolB, translocation protein TolB; Provisional 1e-140
PRK04922433 PRK04922, tolB, translocation protein TolB; Provisional 8e-58
PRK00178430 PRK00178, tolB, translocation protein TolB; Provisional 3e-50
PRK02889427 PRK02889, tolB, translocation protein TolB; Provisional 6e-50
PRK04792448 PRK04792, tolB, translocation protein TolB; Provisional 5e-39
PRK03629429 PRK03629, tolB, translocation protein TolB; Provisional 2e-28
COG0823425 COG0823, TolB, Periplasmic component of the Tol biopoly 9e-67
TIGR02800417 TIGR02800, propeller_TolB, tol-pal system beta propelle 2e-88
PRK01742429 PRK01742, tolB, translocation protein TolB; Provisional 2e-29
pfam04052106 pfam04052, TolB_N, TolB amino-terminal domain 7e-19
PRK01029428 PRK01029, tolB, translocation protein TolB; Provisional 4e-12
COG1506 620 COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl 9e-08
PRK04043419 PRK04043, tolB, translocation protein TolB; Provisional 3e-07
pfam00930 349 pfam00930, DPPIV_N, Dipeptidyl peptidase IV (DPP IV) N- 2e-05
PRK01029428 PRK01029, tolB, translocation protein TolB; Provisional 4e-05
pfam0767637 pfam07676, PD40, WD40-like Beta Propeller Repeat 6e-05
PRK01029428 PRK01029, tolB, translocation protein TolB; Provisional 0.004
>gnl|CDD|179945 PRK05137, tolB, translocation protein TolB; Provisional Back     alignment and domain information
>gnl|CDD|179892 PRK04922, tolB, translocation protein TolB; Provisional Back     alignment and domain information
>gnl|CDD|166839 PRK00178, tolB, translocation protein TolB; Provisional Back     alignment and domain information
>gnl|CDD|179493 PRK02889, tolB, translocation protein TolB; Provisional Back     alignment and domain information
>gnl|CDD|179879 PRK04792, tolB, translocation protein TolB; Provisional Back     alignment and domain information
>gnl|CDD|179613 PRK03629, tolB, translocation protein TolB; Provisional Back     alignment and domain information
>gnl|CDD|31165 COG0823, TolB, Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|163025 TIGR02800, propeller_TolB, tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>gnl|CDD|179329 PRK01742, tolB, translocation protein TolB; Provisional Back     alignment and domain information
>gnl|CDD|146599 pfam04052, TolB_N, TolB amino-terminal domain Back     alignment and domain information
>gnl|CDD|179209 PRK01029, tolB, translocation protein TolB; Provisional Back     alignment and domain information
>gnl|CDD|31695 COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|179726 PRK04043, tolB, translocation protein TolB; Provisional Back     alignment and domain information
>gnl|CDD|144507 pfam00930, DPPIV_N, Dipeptidyl peptidase IV (DPP IV) N-terminal region Back     alignment and domain information
>gnl|CDD|179209 PRK01029, tolB, translocation protein TolB; Provisional Back     alignment and domain information
>gnl|CDD|148980 pfam07676, PD40, WD40-like Beta Propeller Repeat Back     alignment and domain information
>gnl|CDD|179209 PRK01029, tolB, translocation protein TolB; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 447 translocation protein TolB [Candidatus Liberibacter asi
TIGR02800439 propeller_TolB Tol-Pal system beta propeller repeat pro 100.0
PRK05137437 tolB translocation protein TolB; Provisional 100.0
PRK03629430 tolB translocation protein TolB; Provisional 100.0
PRK02889430 tolB translocation protein TolB; Provisional 100.0
PRK04792450 tolB translocation protein TolB; Provisional 100.0
PRK04922439 tolB translocation protein TolB; Provisional 100.0
PRK00178433 tolB translocation protein TolB; Provisional 100.0
PRK01742430 tolB translocation protein TolB; Provisional 100.0
PRK04043419 tolB translocation protein TolB; Provisional 100.0
PRK01029425 tolB translocation protein TolB; Provisional 100.0
COG0823425 TolB Periplasmic component of the Tol biopolymer transp 100.0
TIGR02800439 propeller_TolB Tol-Pal system beta propeller repeat pro 100.0
PRK02889430 tolB translocation protein TolB; Provisional 100.0
PRK03629430 tolB translocation protein TolB; Provisional 100.0
PRK00178433 tolB translocation protein TolB; Provisional 100.0
PRK05137437 tolB translocation protein TolB; Provisional 100.0
PRK04922439 tolB translocation protein TolB; Provisional 100.0
PRK01742430 tolB translocation protein TolB; Provisional 100.0
PRK04043419 tolB translocation protein TolB; Provisional 100.0
COG0823425 TolB Periplasmic component of the Tol biopolymer transp 100.0
KOG0266456 consensus 99.41
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport and m 99.31
pfam02897412 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-p 98.99
pfam08450246 SGL SMP-30/Gluconolaconase/LRE-like region. This family 98.96
pfam06433342 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MA 98.87
KOG2055514 consensus 98.84
KOG2315 566 consensus 98.58
pfam10647254 Gmad1 Lipoprotein LpqB beta-propeller domain. The Gmad1 98.49
KOG1407313 consensus 98.46
KOG0305484 consensus 98.44
pfam02239369 Cytochrom_D1 Cytochrome D1 heme domain. Cytochrome cd1 98.39
KOG0771398 consensus 98.22
KOG0278334 consensus 98.01
COG3391381 Uncharacterized conserved protein [Function unknown] 98.01
KOG0645312 consensus 97.96
KOG0268433 consensus 96.64
KOG0640430 consensus 96.62
PRK04792450 tolB translocation protein TolB; Provisional 100.0
PRK01029425 tolB translocation protein TolB; Provisional 100.0
COG4946 668 Uncharacterized protein related to the periplasmic comp 99.83
KOG0266456 consensus 99.26
KOG0263707 consensus 99.02
KOG0279315 consensus 98.98
KOG0305484 consensus 98.93
KOG0772 641 consensus 98.68
KOG0286343 consensus 98.62
KOG0272459 consensus 98.62
pfam08450246 SGL SMP-30/Gluconolaconase/LRE-like region. This family 98.54
KOG0315311 consensus 98.5
KOG0293519 consensus 98.45
pfam07433304 DUF1513 Protein of unknown function (DUF1513). This fam 98.3
KOG1273405 consensus 98.18
pfam02239369 Cytochrom_D1 Cytochrome D1 heme domain. Cytochrome cd1 97.92
pfam10647254 Gmad1 Lipoprotein LpqB beta-propeller domain. The Gmad1 97.9
KOG2110391 consensus 97.78
KOG0277311 consensus 97.71
COG1770 682 PtrB Protease II [Amino acid transport and metabolism] 97.69
COG2319466 FOG: WD40 repeat [General function prediction only] 97.3
KOG0307 1049 consensus 97.18
KOG0278334 consensus 96.74
KOG0295406 consensus 96.2
KOG0268433 consensus 95.64
COG3490366 Uncharacterized protein conserved in bacteria [Function 95.4
KOG0295406 consensus 95.12
KOG0313423 consensus 94.44
pfam00930349 DPPIV_N Dipeptidyl peptidase IV (DPP IV) N-terminal reg 99.97
PRK11028330 6-phosphogluconolactonase; Provisional 99.58
pfam10282344 Muc_lac_enz 3-carboxy-cis,cis-muconate lactonizing enzy 99.45
PRK11028330 6-phosphogluconolactonase; Provisional 99.36
KOG0271480 consensus 99.29
cd00200289 WD40 WD40 domain, found in a number of eukaryotic prote 99.28
KOG0772 641 consensus 99.14
pfam02897412 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-p 99.13
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidase 99.11
PRK10115 686 protease 2; Provisional 98.87
KOG1446311 consensus 98.7
KOG1273405 consensus 98.38
KOG0282503 consensus 98.23
TIGR02658360 TTQ_MADH_Hv methylamine dehydrogenase heavy chain; Inte 98.17
pfam06433342 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MA 97.61
TIGR02658360 TTQ_MADH_Hv methylamine dehydrogenase heavy chain; Inte 96.63
pfam00930349 DPPIV_N Dipeptidyl peptidase IV (DPP IV) N-terminal reg 99.96
cd00200289 WD40 WD40 domain, found in a number of eukaryotic prote 99.38
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidase 99.14
KOG0315311 consensus 98.94
KOG1446311 consensus 98.9
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) repeat [ 98.8
KOG1407313 consensus 98.72
KOG0275508 consensus 98.41
KOG0265338 consensus 97.45
COG3490366 Uncharacterized protein conserved in bacteria [Function 95.69
PRK11138394 outer membrane protein assembly complex subunit YfgL; P 95.54
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein YfgL. 95.17
pfam11768 544 DUF3312 Protein of unknown function (DUF3312). This is 92.99
pfam04052106 TolB_N TolB amino-terminal domain. TolB is an essential 99.85
pfam11684140 DUF3280 Protein of unknown function (DUF2380). This fam 98.24
COG1462252 CsgG Uncharacterized protein involved in formation of c 98.0
pfam03783207 CsgG Curli production assembly/transport component CsgG 97.2
pfam05643215 DUF799 Putative bacterial lipoprotein (DUF799). This fa 91.61
COG4946 668 Uncharacterized protein related to the periplasmic comp 99.66
TIGR02171 982 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous fam 98.9
pfam10282344 Muc_lac_enz 3-carboxy-cis,cis-muconate lactonizing enzy 99.33
KOG1524 737 consensus 98.17
KOG1538 1081 consensus 97.61
KOG1538 1081 consensus 97.59
KOG1445 1012 consensus 96.73
KOG1408 1080 consensus 95.3
pfam07250243 Glyoxal_oxid_N Glyoxal oxidase N-terminus. This family 95.17
KOG0646476 consensus 93.4
KOG0271480 consensus 99.31
KOG0973 942 consensus 99.3
KOG4497 447 consensus 98.62
KOG0296399 consensus 98.24
KOG0296399 consensus 98.14
KOG1063 764 consensus 97.69
KOG4283397 consensus 96.38
KOG0303472 consensus 93.54
KOG0318 603 consensus 99.25
KOG0273524 consensus 98.81
pfam04762 918 IKI3 IKI3 family. Members of this family are components 98.57
KOG4497447 consensus 98.04
KOG1009434 consensus 97.97
KOG2394 636 consensus 97.78
KOG0277311 consensus 97.43
KOG1063 764 consensus 96.78
KOG0299479 consensus 96.49
COG1770 682 PtrB Protease II [Amino acid transport and metabolism] 96.26
KOG0319 775 consensus 95.5
KOG0647347 consensus 95.43
KOG4378 673 consensus 95.23
KOG1963 792 consensus 93.04
KOG4328498 consensus 91.07
KOG0272459 consensus 99.19
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport and m 99.09
KOG0293519 consensus 99.09
KOG2139445 consensus 98.97
KOG0279315 consensus 98.93
KOG1274 933 consensus 98.92
KOG2055514 consensus 98.57
COG3386307 Gluconolactonase [Carbohydrate transport and metabolism 98.54
KOG2314 698 consensus 98.47
KOG2096420 consensus 98.47
COG3391381 Uncharacterized conserved protein [Function unknown] 98.39
KOG0639705 consensus 97.76
PRK13614573 lipoprotein LpqB; Provisional 97.63
pfam07433304 DUF1513 Protein of unknown function (DUF1513). This fam 97.43
KOG0282503 consensus 97.39
KOG2919406 consensus 97.24
PRK13616590 lipoprotein LpqB; Provisional 97.21
COG2319466 FOG: WD40 repeat [General function prediction only] 96.42
KOG1332299 consensus 95.41
KOG0973 942 consensus 99.09
KOG2139445 consensus 98.98
KOG1274 933 consensus 98.9
pfam08662194 eIF2A Eukaryotic translation initiation factor eIF2A. T 98.76
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) repeat [ 98.44
KOG2315 566 consensus 98.24
KOG0645312 consensus 98.19
KOG1524 737 consensus 98.1
COG3386307 Gluconolactonase [Carbohydrate transport and metabolism 98.09
KOG0306 888 consensus 98.02
KOG0310 487 consensus 97.99
KOG0643327 consensus 97.93
KOG0306 888 consensus 97.88
KOG0284464 consensus 97.84
KOG0771398 consensus 97.83
KOG2041 1189 consensus 96.48
KOG0650733 consensus 94.38
COG4590 733 ABC-type uncharacterized transport system, permease com 90.52
pfam08662194 eIF2A Eukaryotic translation initiation factor eIF2A. T 99.09
KOG0263707 consensus 98.59
KOG2096420 consensus 98.46
TIGR02171 982 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous fam 98.22
KOG0650733 consensus 98.16
KOG0283 712 consensus 98.07
KOG2048 691 consensus 97.87
PRK13616590 lipoprotein LpqB; Provisional 97.76
PRK13614573 lipoprotein LpqB; Provisional 97.67
KOG0264422 consensus 97.6
PRK13613603 lipoprotein LpqB; Provisional 97.35
PRK13615532 lipoprotein LpqB; Provisional 97.28
KOG0291 893 consensus 99.08
KOG2394 636 consensus 98.42
pfam0767637 PD40 WD40-like Beta Propeller Repeat. This family appea 98.26
KOG1523361 consensus 98.1
KOG1408 1080 consensus 96.45
KOG4378 673 consensus 95.52
pfam04053 435 Coatomer_WDAD Coatomer WD associated region. This regio 94.79
KOG3621 726 consensus 94.24
KOG0294362 consensus 93.83
KOG0291 893 consensus 99.07
PRK10115 686 protease 2; Provisional 98.8
KOG2314 698 consensus 98.62
KOG2048691 consensus 98.15
KOG2110391 consensus 98.11
KOG1445 1012 consensus 98.03
KOG0286343 consensus 97.87
KOG0269 839 consensus 97.28
KOG0307 1049 consensus 97.1
KOG4283397 consensus 95.96
COG3204316 Uncharacterized protein conserved in bacteria [Function 94.62
KOG0318 603 consensus 99.05
KOG0273524 consensus 98.76
pfam04762 918 IKI3 IKI3 family. Members of this family are components 98.15
KOG1920 1265 consensus 97.73
KOG2041 1189 consensus 97.46
pfam02333353 Phytase Phytase. Phytase is a secreted enzyme which hyd 94.53
KOG3914390 consensus 93.93
COG5616152 Predicted integral membrane protein [Function unknown] 98.53
PRK12370553 invasion protein regulator; Provisional 97.98
PRK10153512 DNA-binding transcriptional activator CadC; Provisional 93.42
KOG0275508 consensus 98.51
pfam0767637 PD40 WD40-like Beta Propeller Repeat. This family appea 97.67
KOG0639705 consensus 96.93
KOG2106 626 consensus 96.66
KOG1034385 consensus 96.47
KOG2100 755 consensus 95.95
KOG1214 1289 consensus 95.71
KOG0264422 consensus 94.68
pfam05787515 DUF839 Bacterial protein of unknown function (DUF839). 92.9
KOG0265338 consensus 98.42
KOG0288459 consensus 97.37
KOG1332299 consensus 96.46
KOG0284464 consensus 98.24
KOG0310 487 consensus 97.69
PRK13615532 lipoprotein LpqB; Provisional 97.99
KOG1539 910 consensus 97.61
KOG2106626 consensus 97.18
KOG2100 755 consensus 96.8
KOG1539 910 consensus 97.43
KOG0288459 consensus 97.39
KOG2919406 consensus 95.24
KOG1523361 consensus 94.86
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein YfgL. 97.35
PRK11138394 outer membrane protein assembly complex subunit YfgL; P 96.41
PRK13613603 lipoprotein LpqB; Provisional 96.96
KOG3617 1416 consensus 96.76
KOG0643327 consensus 96.63
KOG0292 1202 consensus 90.75
KOG1009434 consensus 96.6
KOG0269 839 consensus 96.51
KOG1920 1265 consensus 96.23
KOG0289506 consensus 96.03
TIGR02722215 lp_ uncharacterized lipoprotein; InterPro: IPR014094 Me 95.47
KOG0644 1113 consensus 93.09
KOG0319 775 consensus 95.35
KOG1520376 consensus 94.32
PRK11067 801 outer membrane protein assembly factor YaeT; Provisiona 90.42
>TIGR02800 propeller_TolB Tol-Pal system beta propeller repeat protein TolB; InterPro: IPR014167 Members of this protein family are the TolB periplasmic protein of Gram-negative bacteria Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02800 propeller_TolB Tol-Pal system beta propeller repeat protein TolB; InterPro: IPR014167 Members of this protein family are the TolB periplasmic protein of Gram-negative bacteria Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0266 consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain Back     alignment and domain information
>pfam08450 SGL SMP-30/Gluconolaconase/LRE-like region Back     alignment and domain information
>pfam06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH) Back     alignment and domain information
>KOG2055 consensus Back     alignment and domain information
>KOG2315 consensus Back     alignment and domain information
>pfam10647 Gmad1 Lipoprotein LpqB beta-propeller domain Back     alignment and domain information
>KOG1407 consensus Back     alignment and domain information
>KOG0305 consensus Back     alignment and domain information
>pfam02239 Cytochrom_D1 Cytochrome D1 heme domain Back     alignment and domain information
>KOG0771 consensus Back     alignment and domain information
>KOG0278 consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0645 consensus Back     alignment and domain information
>KOG0268 consensus Back     alignment and domain information
>KOG0640 consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0266 consensus Back     alignment and domain information
>KOG0263 consensus Back     alignment and domain information
>KOG0279 consensus Back     alignment and domain information
>KOG0305 consensus Back     alignment and domain information
>KOG0772 consensus Back     alignment and domain information
>KOG0286 consensus Back     alignment and domain information
>KOG0272 consensus Back     alignment and domain information
>pfam08450 SGL SMP-30/Gluconolaconase/LRE-like region Back     alignment and domain information
>KOG0315 consensus Back     alignment and domain information
>KOG0293 consensus Back     alignment and domain information
>pfam07433 DUF1513 Protein of unknown function (DUF1513) Back     alignment and domain information
>KOG1273 consensus Back     alignment and domain information
>pfam02239 Cytochrom_D1 Cytochrome D1 heme domain Back     alignment and domain information
>pfam10647 Gmad1 Lipoprotein LpqB beta-propeller domain Back     alignment and domain information
>KOG2110 consensus Back     alignment and domain information
>KOG0277 consensus Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Back     alignment and domain information
>KOG0278 consensus Back     alignment and domain information
>KOG0295 consensus Back     alignment and domain information
>KOG0268 consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0295 consensus Back     alignment and domain information
>KOG0313 consensus Back     alignment and domain information
>pfam00930 DPPIV_N Dipeptidyl peptidase IV (DPP IV) N-terminal region Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>pfam10282 Muc_lac_enz 3-carboxy-cis,cis-muconate lactonizing enzyme Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0271 consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0772 consensus Back     alignment and domain information
>pfam02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG1446 consensus Back     alignment and domain information
>KOG1273 consensus Back     alignment and domain information
>KOG0282 consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain; InterPro: IPR013476 Methylamine dehydrogenase is a periplasmic enzyme found in Gram-negative methylotrophs Back     alignment and domain information
>pfam06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH) Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain; InterPro: IPR013476 Methylamine dehydrogenase is a periplasmic enzyme found in Gram-negative methylotrophs Back     alignment and domain information
>pfam00930 DPPIV_N Dipeptidyl peptidase IV (DPP IV) N-terminal region Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0315 consensus Back     alignment and domain information
>KOG1446 consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG1407 consensus Back     alignment and domain information
>KOG0275 consensus Back     alignment and domain information
>KOG0265 consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane protein assembly complex subunit YfgL; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>pfam11768 DUF3312 Protein of unknown function (DUF3312) Back     alignment and domain information
>pfam04052 TolB_N TolB amino-terminal domain Back     alignment and domain information
>pfam11684 DUF3280 Protein of unknown function (DUF2380) Back     alignment and domain information
>COG1462 CsgG Uncharacterized protein involved in formation of curli polymers [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam03783 CsgG Curli production assembly/transport component CsgG Back     alignment and domain information
>pfam05643 DUF799 Putative bacterial lipoprotein (DUF799) Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>pfam10282 Muc_lac_enz 3-carboxy-cis,cis-muconate lactonizing enzyme Back     alignment and domain information
>KOG1524 consensus Back     alignment and domain information
>KOG1538 consensus Back     alignment and domain information
>KOG1538 consensus Back     alignment and domain information
>KOG1445 consensus Back     alignment and domain information
>KOG1408 consensus Back     alignment and domain information
>pfam07250 Glyoxal_oxid_N Glyoxal oxidase N-terminus Back     alignment and domain information
>KOG0646 consensus Back     alignment and domain information
>KOG0271 consensus Back     alignment and domain information
>KOG0973 consensus Back     alignment and domain information
>KOG4497 consensus Back     alignment and domain information
>KOG0296 consensus Back     alignment and domain information
>KOG0296 consensus Back     alignment and domain information
>KOG1063 consensus Back     alignment and domain information
>KOG4283 consensus Back     alignment and domain information
>KOG0303 consensus Back     alignment and domain information
>KOG0318 consensus Back     alignment and domain information
>KOG0273 consensus Back     alignment and domain information
>pfam04762 IKI3 IKI3 family Back     alignment and domain information
>KOG4497 consensus Back     alignment and domain information
>KOG1009 consensus Back     alignment and domain information
>KOG2394 consensus Back     alignment and domain information
>KOG0277 consensus Back     alignment and domain information
>KOG1063 consensus Back     alignment and domain information
>KOG0299 consensus Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0319 consensus Back     alignment and domain information
>KOG0647 consensus Back     alignment and domain information
>KOG4378 consensus Back     alignment and domain information
>KOG1963 consensus Back     alignment and domain information
>KOG4328 consensus Back     alignment and domain information
>KOG0272 consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0293 consensus Back     alignment and domain information
>KOG2139 consensus Back     alignment and domain information
>KOG0279 consensus Back     alignment and domain information
>KOG1274 consensus Back     alignment and domain information
>KOG2055 consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2314 consensus Back     alignment and domain information
>KOG2096 consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>pfam07433 DUF1513 Protein of unknown function (DUF1513) Back     alignment and domain information
>KOG0282 consensus Back     alignment and domain information
>KOG2919 consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Back     alignment and domain information
>KOG0973 consensus Back     alignment and domain information
>KOG2139 consensus Back     alignment and domain information
>KOG1274 consensus Back     alignment and domain information
>pfam08662 eIF2A Eukaryotic translation initiation factor eIF2A Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Back     alignment and domain information
>KOG0645 consensus Back     alignment and domain information
>KOG1524 consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0306 consensus Back     alignment and domain information
>KOG0310 consensus Back     alignment and domain information
>KOG0643 consensus Back     alignment and domain information
>KOG0306 consensus Back     alignment and domain information