254780551

254780551

tolQ protein

GeneID in NCBI database:8209547Locus tag:CLIBASIA_02190
Protein GI in NCBI database:254780551Protein Accession:YP_003064964.1
Gene range:+(729038, 729730)Protein Length:230aa
Gene description:tolQ protein
COG prediction:[U] Biopolymer transport proteins
KEGG prediction:tolQ; TolQ protein; K03562 biopolymer transport protein TolQ
SEED prediction:MotA/TolQ/ExbB proton channel family protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS
ccccccHHHHccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
cccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHcccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKkscdkgarspigiqDRIDRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGyysnnvvsiPGIIESLISILLGLCvsipssiaynKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS
MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKgarspigiqdriDRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAilsrqtegnis
MNNYGLAIMDISIFALFMQMGLAVKCiitllfifsilswsviiQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSagllvgilgavlgmmgFFQSIAGYYSNNVVsipgiieslisillglCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS
******A*MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE****************IFMSAMS*******************IDRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL**Q******
MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILS********
*NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE****
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS
MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS
MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target230 tolQ protein [Candidatus Liberibacter asiaticus str. ps
315122878213 tolQ protein [Candidatus Liberibacter solanacearum CLso 1 1e-81
332716446239 biopolymer transport protein tolQ [Agrobacterium sp. H1 1 1e-62
159185874239 tolQ protein [Agrobacterium tumefaciens str. C58] Lengt 1 4e-62
222149660239 protein TolQ [Agrobacterium vitis S4] Length = 239 1 3e-61
222086977240 protein TolQ [Agrobacterium radiobacter K84] Length = 2 1 9e-61
86359057239 protein transporter protein [Rhizobium etli CFN 42] Len 1 1e-60
116253712239 TolQ protein uptake system component [Rhizobium legumin 1 1e-60
241206188239 protein TolQ [Rhizobium leguminosarum bv. trifolii WSM1 1 2e-60
190893279239 biopolymer transporter protein [Rhizobium etli CIAT 652 1 6e-60
227823311239 putative TolQ protein uptake system component [Sinorhiz 1 2e-59
>gi|315122878|ref|YP_004063367.1| tolQ protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 213 Back     alignment and organism information
 Score =  306 bits (785), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 195/212 (91%)

Query: 18  MQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLK 77
           MQMGLAVKC+I LL +FSI SWS+I+QK VNFI +RR FREFEQLFWSGQSLE++CK LK
Sbjct: 1   MQMGLAVKCVIILLLVFSIFSWSIIVQKIVNFIMIRRNFREFEQLFWSGQSLESLCKLLK 60

Query: 78  NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKLSFLGS 137
           + HN+GLAAIFMSAM EWKKS ++GARS IG+QDRIDRMMDVAIARELE+ITE+LSFLG+
Sbjct: 61  DKHNVGLAAIFMSAMCEWKKSYEQGARSSIGMQDRIDRMMDVAIARELEDITERLSFLGT 120

Query: 138 MSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLISILLGLCVSIPSSIAYN 197
           MSS GLLVG+LGAVLGM+GFFQ+IAG ++N +  IP IIESL+SI+LGLCVSIPSSIAYN
Sbjct: 121 MSSVGLLVGLLGAVLGMVGFFQNIAGPHANIIFFIPEIIESLMSIILGLCVSIPSSIAYN 180

Query: 198 KFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           KF+ED+KKF++QMEGF++EFSAILSRQTEG++
Sbjct: 181 KFMEDAKKFSVQMEGFSDEFSAILSRQTEGHV 212


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|332716446|ref|YP_004443912.1| biopolymer transport protein tolQ [Agrobacterium sp. H13-3] Length = 239 Back     alignment and organism information
>gi|159185874|ref|NP_356903.2| tolQ protein [Agrobacterium tumefaciens str. C58] Length = 239 Back     alignment and organism information
>gi|222149660|ref|YP_002550617.1| protein TolQ [Agrobacterium vitis S4] Length = 239 Back     alignment and organism information
>gi|222086977|ref|YP_002545511.1| protein TolQ [Agrobacterium radiobacter K84] Length = 240 Back     alignment and organism information
>gi|86359057|ref|YP_470949.1| protein transporter protein [Rhizobium etli CFN 42] Length = 239 Back     alignment and organism information
>gi|116253712|ref|YP_769550.1| TolQ protein uptake system component [Rhizobium leguminosarum bv. viciae 3841] Length = 239 Back     alignment and organism information
>gi|241206188|ref|YP_002977284.1| protein TolQ [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 239 Back     alignment and organism information
>gi|190893279|ref|YP_001979821.1| biopolymer transporter protein [Rhizobium etli CIAT 652] Length = 239 Back     alignment and organism information
>gi|227823311|ref|YP_002827283.1| putative TolQ protein uptake system component [Sinorhizobium fredii NGR234] Length = 239 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target230 tolQ protein [Candidatus Liberibacter asiaticus str. ps
TIGR02796215 TIGR02796, tolQ, TolQ protein 3e-52
PRK10801227 PRK10801, PRK10801, colicin uptake protein TolQ; Provis 6e-26
TIGR02797211 TIGR02797, exbB, tonB-system energizer ExbB 4e-15
PRK10414244 PRK10414, PRK10414, biopolymer transport protein ExbB; 2e-14
COG0811216 COG0811, TolQ, Biopolymer transport proteins [Intracell 6e-32
pfam01618139 pfam01618, MotA_ExbB, MotA/TolQ/ExbB proton channel fam 8e-10
>gnl|CDD|131843 TIGR02796, tolQ, TolQ protein Back     alignment and domain information
>gnl|CDD|182743 PRK10801, PRK10801, colicin uptake protein TolQ; Provisional Back     alignment and domain information
>gnl|CDD|131844 TIGR02797, exbB, tonB-system energizer ExbB Back     alignment and domain information
>gnl|CDD|182439 PRK10414, PRK10414, biopolymer transport protein ExbB; Provisional Back     alignment and domain information
>gnl|CDD|31153 COG0811, TolQ, Biopolymer transport proteins [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|144995 pfam01618, MotA_ExbB, MotA/TolQ/ExbB proton channel family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 230 tolQ protein [Candidatus Liberibacter asiaticus str. ps
TIGR02796219 tolQ protein TolQ; InterPro: IPR014163 TolQ is one of t 100.0
PRK10801227 colicin uptake protein TolQ; Provisional 100.0
PRK10414239 biopolymer transport protein ExbB; Provisional 100.0
TIGR02797213 exbB tonB-system energizer ExbB; InterPro: IPR014164 Th 100.0
COG0811216 TolQ Biopolymer transport proteins [Intracellular traff 100.0
TIGR02805139 exbB2 tonB-system energizer ExbB; InterPro: IPR014172 M 99.95
COG0811216 TolQ Biopolymer transport proteins [Intracellular traff 97.02
pfam01618139 MotA_ExbB MotA/TolQ/ExbB proton channel family. This fa 100.0
PRK09109246 motC flagellar motor protein; Reviewed 99.28
PRK08456257 flagellar motor protein MotA; Validated 99.27
PRK08990253 flagellar motor protein PomA; Reviewed 99.27
PRK06743254 flagellar motor protein MotP; Reviewed 99.23
PRK09110283 flagellar motor protein MotA; Validated 99.21
PRK08124263 flagellar motor protein MotA; Validated 99.2
PRK12482287 flagellar motor protein MotA; Provisional 99.17
PRK06926272 flagellar motor protein MotP; Reviewed 99.16
COG1291266 MotA Flagellar motor component [Cell motility and secre 98.98
TIGR02956 1052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 95.17
>TIGR02796 tolQ protein TolQ; InterPro: IPR014163 TolQ is one of the essential components of the Tol-Pal system Back     alignment and domain information
>PRK10801 colicin uptake protein TolQ; Provisional Back     alignment and domain information
>PRK10414 biopolymer transport protein ExbB; Provisional Back     alignment and domain information
>TIGR02797 exbB tonB-system energizer ExbB; InterPro: IPR014164 This entry describes ExbB proteins, part of the MotA/TolQ/ExbB protein family Back     alignment and domain information
>COG0811 TolQ Biopolymer transport proteins [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02805 exbB2 tonB-system energizer ExbB; InterPro: IPR014172 Members of this protein family appear to be the ExbB protein of an ExbBD proton-transporting membrane complex that, by means of TonB, energizes transport by TonB-dependent receptors Back     alignment and domain information
>COG0811 TolQ Biopolymer transport proteins [Intracellular trafficking and secretion] Back     alignment and domain information
>pfam01618 MotA_ExbB MotA/TolQ/ExbB proton channel family Back     alignment and domain information
>PRK09109 motC flagellar motor protein; Reviewed Back     alignment and domain information
>PRK08456 flagellar motor protein MotA; Validated Back     alignment and domain information
>PRK08990 flagellar motor protein PomA; Reviewed Back     alignment and domain information
>PRK06743 flagellar motor protein MotP; Reviewed Back     alignment and domain information
>PRK09110 flagellar motor protein MotA; Validated Back     alignment and domain information
>PRK08124 flagellar motor protein MotA; Validated Back     alignment and domain information
>PRK12482 flagellar motor protein MotA; Provisional Back     alignment and domain information
>PRK06926 flagellar motor protein MotP; Reviewed Back     alignment and domain information
>COG1291 MotA Flagellar motor component [Cell motility and secretion] Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: IPR014302 This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00