254780552

254780552

Holliday junction DNA helicase RuvB

GeneID in NCBI database:8209548Locus tag:CLIBASIA_02195
Protein GI in NCBI database:254780552Protein Accession:YP_003064965.1
Gene range:+(727751, 728755)Protein Length:334aa
Gene description:Holliday junction DNA helicase RuvB
COG prediction:[L] Holliday junction resolvasome, helicase subunit
KEGG prediction:ruvB; Holliday junction DNA helicase RuvB (EC:3.6.1.-); K03551 holliday junction DNA helicase RuvB
SEED prediction:Holliday junction DNA helicase RuvB
Pathway involved in KEGG:Homologous recombination [PATH:las03440]
Subsystem involved in SEED:RuvABC plus a hypothetical;
DNA-replication
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----
MMDREGLLSRNVSQEDADISLLRPRTLEEFTGQVEACSNLKVFIEAAKARAEALDHVLFVGPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTNLEDRDVLFIDEIHRLSIIVEEILYPAMEDFQLDLMVGEGPSARSVKINLSRFTLIAATTRVGLLTNPLQDRFGIPIRLNFYEIEDLKTIVQRGAKLTGLAVTDEAACEIAMRSRGTPRIAGRLLRRVRDFAEVAHAKTITREIADAALLRLAIDKMGFDQLDLRYLTMIARNFGGGPVGIETISAGLSEPRDAIEDLIEPYMIQQGFIQRTPRGRLLMPIAWQHLGIDIPHR
ccccHHcccccccHHHHHHHHcccccHHHHccHHHHHHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHccEEEEccHHHccHHHHHHHHHHHHccEEEEEEEccccccccccccccEEEEEEccccccccHHHHHHcccEEEcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccc
cccHHHcccccccHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHHcccccEccccccccccHHHHHHHHcccccccEEHHHHHHccHHHHHHHHHHHHHcccEEEEcccccccEEEEcccccEEEccccccccccccHHHcccccEEEEEccHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHHcHHcccccccEccHHHHHHHccccccc
mmdregllsrnvsqedadisllrprtleeftgqveACSNLKVFIEAAKARAEALDHVlfvgppglgktTLAQVVARELGvnfrstsgpviaKAGDLAALLTnledrdvlfiDEIHRLSIIVEEILYPAMEDFQLDlmvgegpsarsvKINLSRFTLIAATTRVglltnplqdrfgipirlnfyeiedLKTIVQRGAKLTGLAVTDEAACEIAMRSRGTPRIAGRLLRRVRDFAEVAHAKTITREIADAALLRLAIDKMGFDQLDLRYLTMIARnfgggpvgIETISaglseprdAIEDLIEPymiqqgfiqrtprgrllMPIAWqhlgidiphr
mmdregllsrnvsqedadisllrprTLEEFTGQVEACSNLKVFIEAAKARAEALDHVLFVGPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTNLEDRDVLFIDEIHRLSIIVEEILYPAMEDFQLDLMVGEGPSARSVKINLSRFTLIAAttrvglltnplqdrfgiPIRLNFYEIEDLKTIVQRGAKLTGLAVTDEAACEiamrsrgtpriagrlLRRVRDFAEVAHAKTITREIADAALLRLAIDKMGFDQLDLRYLTMIARNFGGGPVGIETISAGLSEPRDAIEDLIEPYMIQQGFIQRTPRGRLLMPIAwqhlgidiphr
MMDREGLLSRNVSQEDADISLLRPRTLEEFTGQVEACSNLKVFIEAAKARAEALDHVLFVGPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTNLEDRDVLFIDEIHRLSIIVEEILYPAMEDFQLDLMVGEGPSARSVKINLSRFTLIAATTRVGLLTNPLQDRFGIPIRLNFYEIEDLKTIVQRGAKLTGLAVTDEAACEIAMRSRGTPRIAGRLLRRVRDFAEVAHAKTITREiadaallrlaidKMGFDQLDLRYLTMIARNFGGGPVGIETISAGLSEPRDAIEDLIEPYMIQQGFIQRTPRGRLLMPIAWQHLGIDIPHR
****EG**************LLRPRTLEEFTGQVEACSNLKVFIEAAKARAEALDHVLFVGPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTNLEDRDVLFIDEIHRLSIIVEEILYPAMEDFQLDLMVGEGPSARSVKINLSRFTLIAATTRVGLLTNPLQDRFGIPIRLNFYEIEDLKTIVQRGAKLTGLAVTDEAACEIAMRSRGTPRIAGRLLRRVRDFAEVAHAKTITREIADAALLRLAIDKMGFDQLDLRYLTMIARNFGGGPVGIETISAGLSEPRDAIEDLIEPYMIQQGFIQRTPRGRLLMPIAWQHLGIDI***
***************DADISLLRPRTLEEFTGQVEACSNLKVFIEAAKARAEALDHVLFVGPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTNLEDRDVLFIDEIHRLSIIVEEILYPAMEDFQLDLMVGEGPSARSVKINLSRFTLIAATTRVGLLTNPLQDRFGIPIRLNFYEIEDLKTIVQRGAKLTGLAVTDEAACEIAMRSRGTPRIAGRLLRRVRDFAEVAHAKTITREIADAALLRLAIDKMGFDQLDLRYLTMIARNFGGGPVGIETISAGLSEPRDAIEDLIEPYMIQQGFIQRTPRGRLLMPIAWQHLGIDIPHR
*****GLLSRNVSQEDADISLLRPRTLEEFTGQVEACSNLKVFIEAAKARAEALDHVLFVGPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTNLEDRDVLFIDEIHRLSIIVEEILYPAMEDFQLDLMVGEGPSARSVKINLSRFTLIAATTRVGLLTNPLQDRFGIPIRLNFYEIEDLKTIVQRGAKLTGLAVTDEAACEIAMRSRGTPRIAGRLLRRVRDFAEVAHAKTITREIADAALLRLAIDKMGFDQLDLRYLTMIARNFGGGPVGIETISAGLSEPRDAIEDLIEPYMIQQGFIQRTPRGRLLMPIAWQHLGID****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMDREGLLSRNVSQEDADISLLRPRTLEEFTGQVEACSNLKVFIEAAKARAEALDHVLFVGPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTNLEDRDVLFIDEIHRLSIIVEEILYPAMEDFQLDLMVGEGPSARSVKINLSRFTLIAATTRVGLLTNPLQDRFGIPIRLNFYEIEDLKTIVQRGAKLTGLAVTDEAACEIAMRSRGTPRIAGRLLRRVRDFAEVAHAKTITREIADAALLRLAIDKMGFDQLDLRYLTMIARNFGGGPVGIETISAGLSEPRDAIEDLIEPYMIQQGFIQRTPRGRLLMPIAWQHLGIDIPHR
MMDREGLLSRNVSQEDADISLLRPRTLEEFTGQVEACSNLKVFIEAAKARAEALDHVLFVGPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTNLEDRDVLFIDEIHRLSIIVEEILYPAMEDFQLDLMVGEGPSARSVKINLSRFTLIAATTRVGLLTNPLQDRFGIPIRLNFYEIEDLKTIVQRGAKLTGLAVTDEAACEIAMRSRGTPRIAGRLLRRVRDFAEVAHAKTITREIADAALLRLAIDKMGFDQLDLRYLTMIARNFGGGPVGIETISAGLSEPRDAIEDLIEPYMIQQGFIQRTPRGRLLMPIAWQHLGIDIPHR
MMDREGLLSRNVSQEDADISLLRPRTLEEFTGQVEACSNLKVFIEAAKARAEALDHVLFVGPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTNLEDRDVLFIDEIHRLSIIVEEILYPAMEDFQLDLMVGEGPSARSVKINLSRFTLIAATTRVGLLTNPLQDRFGIPIRLNFYEIEDLKTIVQRGAKLTGLAVTDEAACEIAMRSRGTPRIAGRLLRRVRDFAEVAHAKTITREIADAALLRLAIDKMGFDQLDLRYLTMIARNFGGGPVGIETISAGLSEPRDAIEDLIEPYMIQQGFIQRTPRGRLLMPIAWQHLGIDIPHR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target334 Holliday junction DNA helicase RuvB [Candidatus Liberib
254780271424 ATP-dependent protease ATP-binding subunit ClpX [C 3e-05
254780270 820 ATP-dependent protease La [Candidatus Liberibacter 2e-04
254780545 647 metalloprotease [Candidatus Liberibacter asiaticus 3e-04
>gi|254780271|ref|YP_003064684.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Back     alignment
 Score = 40.8 bits (94), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 14/80 (17%)

Query: 53  ALDHVLFVGPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTNL--------- 103
           A  ++L VGP G GKT LAQ +AR + V F       + +AG +   + N+         
Sbjct: 112 AKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAAD 171

Query: 104 -----EDRDVLFIDEIHRLS 118
                  R +++IDE+ ++S
Sbjct: 172 YNVERAQRGIVYIDEVDKIS 191

>gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Back     alignment
 Score = 38.5 bits (88), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 80/182 (43%), Gaps = 40/182 (21%)

Query: 57  VLFVGPPGLGKTTLAQVVARELGVNF-RSTSGPVIAKA---GDLAALLTNLEDRDV---- 108
           + FVGPPG+GKT+LAQ +A+  G  + R + G V  +A   G     + ++  R +    
Sbjct: 369 LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLK 428

Query: 109 --------LFIDEIHRL--------SIIVEEILYPAMEDFQLDLMVGEGPSARSVKINLS 152
                   L +DEI ++        S  + E+L PA     +D  +        V+ +LS
Sbjct: 429 RAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYL-------EVEYDLS 481

Query: 153 --RFTLIAATTRVGLLTNPLQDRFGIPIRLNFY-EIEDLKTIVQRGAK--LTGLAVTDEA 207
              F + A T  + L   PL DR  I IR+  Y E E L+       K  LT  A+  E 
Sbjct: 482 DVMFIMTANTLNIPL---PLMDRMEI-IRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEE 537

Query: 208 AC 209
            C
Sbjct: 538 CC 539

>gi|254780545|ref|YP_003064958.1| metalloprotease [Candidatus Liberibacter asiaticus str. psy62] Length = 647 Back     alignment
 Score = 37.7 bits (86), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (67%)

Query: 57  VLFVGPPGLGKTTLAQVVARELGVNFRSTSG 87
           VL VGPPG GKT LA+ VA E  V F + SG
Sbjct: 184 VLLVGPPGTGKTLLARAVAGEANVPFFTISG 214

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target334 Holliday junction DNA helicase RuvB [Candidatus Liberib
315122879344 Holliday junction DNA helicase RuvB [Candidatus Liberib 1 1e-174
222149654347 Holliday junction DNA helicase RuvB [Agrobacterium viti 1 1e-143
222086987341 Holliday junction DNA helicase RuvB [Agrobacterium radi 1 1e-143
150397835346 Holliday junction DNA helicase RuvB [Sinorhizobium medi 1 1e-143
332716452349 Holliday junction DNA helicase RuvB [Agrobacterium sp. 1 1e-143
209550797346 Holliday junction DNA helicase RuvB [Rhizobium legumino 1 1e-143
116253729346 Holliday junction DNA helicase RuvB [Rhizobium legumino 1 1e-143
163758800345 Holliday junction DNA helicase RuvB [Hoeflea phototroph 1 1e-143
218462461346 Holliday junction DNA helicase RuvB [Rhizobium etli Kim 1 1e-142
190893295346 holliday junction DNA helicase [Rhizobium etli CIAT 652 1 1e-142
>gi|315122879|ref|YP_004063368.1| Holliday junction DNA helicase RuvB [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 344 Back     alignment and organism information
 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 302/334 (90%), Positives = 321/334 (96%)

Query: 1   MMDREGLLSRNVSQEDADISLLRPRTLEEFTGQVEACSNLKVFIEAAKARAEALDHVLFV 60
           M DREGLLS +VS+ED D+ LLRPRTL+EFTGQ EACSNLKVFIEAAKAR+EALDHVLFV
Sbjct: 1   MTDREGLLSHSVSKEDGDVLLLRPRTLDEFTGQTEACSNLKVFIEAAKARSEALDHVLFV 60

Query: 61  GPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTNLEDRDVLFIDEIHRLSII 120
           GPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTNLEDRDVLFIDEIHRLSII
Sbjct: 61  GPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTNLEDRDVLFIDEIHRLSII 120

Query: 121 VEEILYPAMEDFQLDLMVGEGPSARSVKINLSRFTLIAATTRVGLLTNPLQDRFGIPIRL 180
           VEEILYPAMEDFQLDLMVGEGPSARSVKINLSRFTLIAATTRVGLL+NPLQDRFGIPIRL
Sbjct: 121 VEEILYPAMEDFQLDLMVGEGPSARSVKINLSRFTLIAATTRVGLLSNPLQDRFGIPIRL 180

Query: 181 NFYEIEDLKTIVQRGAKLTGLAVTDEAACEIAMRSRGTPRIAGRLLRRVRDFAEVAHAKT 240
           NFYE+EDLKTIV RGAKL GL +TDEAA EIAMRSRGTPRIAGRLLRRVRDFAEVAHA+ 
Sbjct: 181 NFYEVEDLKTIVHRGAKLIGLPITDEAAYEIAMRSRGTPRIAGRLLRRVRDFAEVAHAEI 240

Query: 241 ITREIADAALLRLAIDKMGFDQLDLRYLTMIARNFGGGPVGIETISAGLSEPRDAIEDLI 300
           ITR+IAD AL+RL++DKMGFDQLD+RYLTMIAR+FGGGPVGIETISAGLSEPRDAIEDLI
Sbjct: 241 ITRDIADEALVRLSVDKMGFDQLDVRYLTMIARHFGGGPVGIETISAGLSEPRDAIEDLI 300

Query: 301 EPYMIQQGFIQRTPRGRLLMPIAWQHLGIDIPHR 334
           EPYMIQ+GFIQRTPRGRLLMP AW+HLGI IP++
Sbjct: 301 EPYMIQKGFIQRTPRGRLLMPSAWKHLGISIPYK 334


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222149654|ref|YP_002550611.1| Holliday junction DNA helicase RuvB [Agrobacterium vitis S4] Length = 347 Back     alignment and organism information
>gi|222086987|ref|YP_002545521.1| Holliday junction DNA helicase RuvB [Agrobacterium radiobacter K84] Length = 341 Back     alignment and organism information
>gi|150397835|ref|YP_001328302.1| Holliday junction DNA helicase RuvB [Sinorhizobium medicae WSM419] Length = 346 Back     alignment and organism information
>gi|332716452|ref|YP_004443918.1| Holliday junction DNA helicase RuvB [Agrobacterium sp. H13-3] Length = 349 Back     alignment and organism information
>gi|209550797|ref|YP_002282714.1| Holliday junction DNA helicase RuvB [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 346 Back     alignment and organism information
>gi|116253729|ref|YP_769567.1| Holliday junction DNA helicase RuvB [Rhizobium leguminosarum bv. viciae 3841] Length = 346 Back     alignment and organism information
>gi|163758800|ref|ZP_02165887.1| Holliday junction DNA helicase RuvB [Hoeflea phototrophica DFL-43] Length = 345 Back     alignment and organism information
>gi|218462461|ref|ZP_03502552.1| Holliday junction DNA helicase RuvB [Rhizobium etli Kim 5] Length = 346 Back     alignment and organism information
>gi|190893295|ref|YP_001979837.1| holliday junction DNA helicase [Rhizobium etli CIAT 652] Length = 346 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target334 Holliday junction DNA helicase RuvB [Candidatus Liberib
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Re 1e-157
TIGR00635305 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB s 1e-120
COG2255332 COG2255, RuvB, Holliday junction resolvasome, helicase 1e-135
pfam05496234 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB 1e-114
PRK13342 413 PRK13342, PRK13342, recombination factor protein RarA; 1e-19
COG2256 436 COG2256, MGS1, ATPase related to the helicase subunit o 2e-16
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslat 3e-06
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [ 3e-06
KOG0989346 KOG0989, KOG0989, KOG0989, Replication factor C, subuni 4e-06
COG0593408 COG0593, DnaA, ATPase involved in DNA replication initi 9e-05
PRK14970367 PRK14970, PRK14970, DNA polymerase III subunits gamma a 2e-04
PRK14962 472 PRK14962, PRK14962, DNA polymerase III subunits gamma a 2e-04
COG1474366 COG1474, CDC6, Cdc6-related protein, AAA superfamily AT 0.001
TIGR02902 531 TIGR02902, spore_lonB, ATP-dependent protease LonB 0.001
KOG2035351 KOG2035, KOG2035, KOG2035, Replication factor C, subuni 0.003
pfam0549175 pfam05491, RuvB_C, Holliday junction DNA helicase ruvB 8e-30
pfam00004131 pfam00004, AAA, ATPase family associated with various c 5e-18
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a wide 1e-12
pfam07728139 pfam07728, AAA_5, AAA domain (dynein-related subfamily) 1e-06
smart00382148 smart00382, AAA, ATPases associated with a variety of c 2e-05
KOG0651388 KOG0651, KOG0651, KOG0651, 26S proteasome regulatory co 9e-05
PRK13341 725 PRK13341, PRK13341, recombination factor protein RarA/u 3e-11
COG0714329 COG0714, COG0714, MoxR-like ATPases [General function p 5e-09
KOG2004 906 KOG2004, KOG2004, KOG2004, Mitochondrial ATP-dependent 0.004
KOG2028 554 KOG2028, KOG2028, KOG2028, ATPase related to the helica 2e-09
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily 2e-05
PRK06647 563 PRK06647, PRK06647, DNA polymerase III subunits gamma a 3e-04
KOG0745564 KOG0745, KOG0745, KOG0745, Putative ATP-dependent Clp-t 0.001
COG2812 515 COG2812, DnaX, DNA polymerase III, gamma/tau subunits [ 0.004
PRK00440319 PRK00440, rfc, replication factor C small subunit; Revi 1e-08
PRK04195 482 PRK04195, PRK04195, replication factor C large subunit; 3e-07
TIGR02903 615 TIGR02903, spore_lon_C, ATP-dependent protease, Lon fam 5e-06
KOG0991333 KOG0991, KOG0991, KOG0991, Replication factor C, subuni 1e-05
PRK12402337 PRK12402, PRK12402, replication factor C small subunit 6e-05
PLN03025319 PLN03025, PLN03025, replication factor C subunit; Provi 7e-05
COG1224 450 COG1224, TIP49, DNA helicase TIP49, TBP-interacting pro 9e-05
KOG0990360 KOG0990, KOG0990, KOG0990, Replication factor C, subuni 2e-04
PRK04132 846 PRK04132, PRK04132, replication factor C small subunit; 2e-04
pfam06068395 pfam06068, TIP49, TIP49 C-terminus 6e-04
KOG1942 456 KOG1942, KOG1942, KOG1942, DNA helicase, TBP-interactin 8e-04
KOG1970 634 KOG1970, KOG1970, KOG1970, Checkpoint RAD17-RFC complex 0.001
TIGR00602 637 TIGR00602, rad24, checkpoint protein rad24 0.003
KOG0733 802 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subf 9e-06
KOG0730693 KOG0730, KOG0730, KOG0730, AAA+-type ATPase [Posttransl 5e-05
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttranslat 6e-05
KOG0734 752 KOG0734, KOG0734, KOG0734, AAA+-type ATPase containing 7e-05
KOG0736953 KOG0736, KOG0736, KOG0736, Peroxisome assembly factor 2 7e-05
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH 8e-05
KOG0733802 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subf 1e-04
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 1e-04
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily 2e-04
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding regulato 2e-04
KOG0738491 KOG0738, KOG0738, KOG0738, AAA+-type ATPase [Posttransl 6e-04
KOG0730 693 KOG0730, KOG0730, KOG0730, AAA+-type ATPase [Posttransl 0.001
KOG0735952 KOG0735, KOG0735, KOG0735, AAA+-type ATPase [Posttransl 0.001
COG1219408 COG1219, ClpX, ATP-dependent protease Clp, ATPase subun 0.001
KOG0737386 KOG0737, KOG0737, KOG0737, AAA+-type ATPase [Posttransl 0.001
KOG0739439 KOG0739, KOG0739, KOG0739, AAA+-type ATPase [Posttransl 0.003
TIGR02881261 TIGR02881, spore_V_K, stage V sporulation protein K 9e-05
KOG0731 774 KOG0731, KOG0731, KOG0731, AAA+-type ATPase containing 1e-04
COG1484254 COG1484, DnaC, DNA replication protein [DNA replication 8e-04
pfam07726131 pfam07726, AAA_3, ATPase family associated with various 8e-04
KOG1969 877 KOG1969, KOG1969, KOG1969, DNA replication checkpoint p 0.004
TIGR00763 775 TIGR00763, lon, ATP-dependent protease La 0.004
TIGR02639731 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding 0.004
>gnl|CDD|178847 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>gnl|CDD|32436 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|147593 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|183986 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|32437 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|30812 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31416 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|36207 KOG0989, KOG0989, KOG0989, Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|30938 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|184934 PRK14970, PRK14970, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184926 PRK14962, PRK14962, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|31663 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|131948 TIGR02902, spore_lonB, ATP-dependent protease LonB Back     alignment and domain information
>gnl|CDD|37246 KOG2035, KOG2035, KOG2035, Replication factor C, subunit RFC3 [Energy production and conversion, Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|147589 pfam05491, RuvB_C, Holliday junction DNA helicase ruvB C-terminus Back     alignment and domain information
>gnl|CDD|143797 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|149019 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|35870 KOG0651, KOG0651, KOG0651, 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183985 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>gnl|CDD|31058 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|37215 KOG2004, KOG2004, KOG2004, Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|37239 KOG2028, KOG2028, KOG2028, ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|162267 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|180644 PRK06647, PRK06647, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|35964 KOG0745, KOG0745, KOG0745, Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|32641 COG2812, DnaX, DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|179026 PRK00440, rfc, replication factor C small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|179778 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|163066 TIGR02903, spore_lon_C, ATP-dependent protease, Lon family Back     alignment and domain information
>gnl|CDD|36209 KOG0991, KOG0991, KOG0991, Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|183503 PRK12402, PRK12402, replication factor C small subunit 2; Reviewed Back     alignment and domain information
>gnl|CDD|178596 PLN03025, PLN03025, replication factor C subunit; Provisional Back     alignment and domain information
>gnl|CDD|31417 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>gnl|CDD|36208 KOG0990, KOG0990, KOG0990, Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|179744 PRK04132, PRK04132, replication factor C small subunit; Provisional Back     alignment and domain information
>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information
>gnl|CDD|37153 KOG1942, KOG1942, KOG1942, DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|37181 KOG1970, KOG1970, KOG1970, Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Energy production and conversion, Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|129690 TIGR00602, rad24, checkpoint protein rad24 Back     alignment and domain information
>gnl|CDD|35952 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35949 KOG0730, KOG0730, KOG0730, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30813 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35953 KOG0734, KOG0734, KOG0734, AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35955 KOG0736, KOG0736, KOG0736, Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162266 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|35952 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|177080 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|162267 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|161849 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|35957 KOG0738, KOG0738, KOG0738, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35949 KOG0730, KOG0730, KOG0730, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35954 KOG0735, KOG0735, KOG0735, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31412 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35956 KOG0737, KOG0737, KOG0737, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35958 KOG0739, KOG0739, KOG0739, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163057 TIGR02881, spore_V_K, stage V sporulation protein K Back     alignment and domain information
>gnl|CDD|35950 KOG0731, KOG0731, KOG0731, AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31673 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|116340 pfam07726, AAA_3, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|37180 KOG1969, KOG1969, KOG1969, DNA replication checkpoint protein CHL12/CTF18 [Energy production and conversion, Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|162028 TIGR00763, lon, ATP-dependent protease La Back     alignment and domain information
>gnl|CDD|162958 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 334 Holliday junction DNA helicase RuvB [Candidatus Liberib
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 100.0
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 100.0
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 100.0
PRK13341 726 recombination factor protein RarA/unknown domain fusion 100.0
PRK13342 417 recombination factor protein RarA; Reviewed 100.0
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 100.0
KOG2028 554 consensus 100.0
PRK04195 403 replication factor C large subunit; Provisional 100.0
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 99.85
PRK00149447 dnaA chromosomal replication initiation protein; Review 99.71
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 99.7
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 99.62
PRK12422455 chromosomal replication initiation protein; Provisional 99.61
TIGR02329658 propionate_PrpR propionate catabolism operon regulatory 99.18
KOG2228408 consensus 98.59
KOG4658 889 consensus 98.27
TIGR00362493 DnaA chromosomal replication initiator protein DnaA; In 97.51
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 100.0
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 100.0
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 100.0
TIGR02902 532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 100.0
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 100.0
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 100.0
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 100.0
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 100.0
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 100.0
PRK00440318 rfc replication factor C small subunit; Reviewed 100.0
PRK12402337 replication factor C small subunit 2; Reviewed 100.0
TIGR02903 616 spore_lon_C ATP-dependent protease, Lon family; InterPr 100.0
KOG0989346 consensus 100.0
PRK09112352 DNA polymerase III subunit delta'; Validated 100.0
PRK05564313 DNA polymerase III subunit delta'; Validated 99.96
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 99.96
PRK07471363 DNA polymerase III subunit delta'; Validated 99.96
CHL00176 631 ftsH cell division protein; Validated 99.96
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 99.96
PRK07940395 DNA polymerase III subunit delta'; Validated 99.95
PRK03992390 proteasome-activating nucleotidase; Provisional 99.95
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 99.95
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 99.94
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.94
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.94
KOG0730693 consensus 99.93
PRK08058329 DNA polymerase III subunit delta'; Validated 99.93
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 99.93
CHL00181287 cbbX CbbX; Provisional 99.93
KOG0990360 consensus 99.93
PRK09862506 putative ATP-dependent protease; Provisional 99.92
PRK07399314 DNA polymerase III subunit delta'; Validated 99.91
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 99.9
KOG0733 802 consensus 99.9
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 99.9
KOG2035351 consensus 99.9
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.9
KOG0733802 consensus 99.89
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 99.89
KOG0734 752 consensus 99.89
KOG1969 877 consensus 99.88
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 99.87
KOG0731 774 consensus 99.87
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 99.87
KOG0736953 consensus 99.87
CHL00195491 ycf46 Ycf46; Provisional 99.86
KOG2004 906 consensus 99.86
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.86
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 99.86
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 99.85
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 99.85
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational modi 99.84
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 99.83
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 99.82
PRK10865 857 protein disaggregation chaperone; Provisional 99.81
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 99.81
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 99.81
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 99.8
KOG0738491 consensus 99.8
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 99.79
KOG0737386 consensus 99.79
CHL00095 823 clpC Clp protease ATP binding subunit 99.79
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 99.79
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 99.76
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 99.75
KOG0740428 consensus 99.75
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 99.75
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 99.73
TIGR02442 688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 99.73
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 99.73
pfam00308219 Bac_DnaA Bacterial dnaA protein. 99.71
PRK08903227 hypothetical protein; Validated 99.71
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 99.71
CHL00095823 clpC Clp protease ATP binding subunit 99.7
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 99.69
PRK08084235 DNA replication initiation factor; Provisional 99.68
KOG0735952 consensus 99.68
TIGR00390463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 99.68
PRK10865857 protein disaggregation chaperone; Provisional 99.68
KOG0727408 consensus 99.67
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 99.67
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 99.67
KOG1970 634 consensus 99.67
KOG0652424 consensus 99.67
PRK05642234 DNA replication initiation factor; Validated 99.66
KOG0730 693 consensus 99.66
KOG0732 1080 consensus 99.65
PRK08727233 hypothetical protein; Validated 99.65
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 99.65
PRK06893229 DNA replication initiation factor; Validated 99.64
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 99.63
KOG0739439 consensus 99.63
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 99.62
PTZ00112650 origin recognition complex 1 protein; Provisional 99.62
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 99.61
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 99.57
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 99.56
KOG0743457 consensus 99.55
KOG0728404 consensus 99.55
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 99.54
COG1221403 PspF Transcriptional regulators containing an AAA-type 99.53
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 99.5
TIGR01817574 nifA Nif-specific regulatory protein; InterPro: IPR0101 99.5
PRK05022510 anaerobic nitric oxide reductase transcription regulato 99.49
PRK10365441 transcriptional regulatory protein ZraR; Provisional 99.49
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 99.49
PRK09087226 hypothetical protein; Validated 99.47
PRK06620214 hypothetical protein; Validated 99.45
TIGR02030340 BchI-ChlI magnesium chelatase ATPase subunit I; InterPr 99.44
COG2204464 AtoC Response regulator containing CheY-like receiver, 99.44
KOG0729435 consensus 99.43
PRK11608325 pspF phage shock protein operon transcriptional activat 99.43
KOG1968 871 consensus 99.33
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 99.3
COG3604550 FhlA Transcriptional regulator containing GAF, AAA-type 99.21
KOG0735 952 consensus 99.12
pfam05621302 TniB Bacterial TniB protein. This family consists of se 99.12
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 99.08
COG1241682 MCM2 Predicted ATPase involved in replication control, 99.04
KOG2227529 consensus 99.03
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 98.98
COG1067 647 LonB Predicted ATP-dependent protease [Posttranslationa 98.95
KOG1808 1856 consensus 98.95
TIGR01818471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 98.93
TIGR02915451 PEP_resp_reg putative PEP-CTERM system response regulat 98.93
KOG0480764 consensus 98.87
KOG0482721 consensus 98.59
KOG1051 898 consensus 98.36
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 98.36
PRK04841 903 transcriptional regulator MalT; Provisional 97.93
COG2842297 Uncharacterized ATPase, putative transposase [General f 97.25
PRK10536262 hypothetical protein; Provisional 96.86
KOG0991333 consensus 100.0
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 99.62
PRK04132863 replication factor C small subunit; Provisional 99.97
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 99.9
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 99.89
KOG1942456 consensus 99.84
PRK13765 637 ATP-dependent protease Lon; Provisional 99.82
KOG2680454 consensus 99.69
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 99.88
COG0714329 MoxR-like ATPases [General function prediction only] 99.85
PRK07132303 DNA polymerase III subunit delta'; Validated 99.82
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.77
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 99.76
pfam00493327 MCM MCM2/3/5 family. 99.74
KOG0742630 consensus 99.71
KOG0651388 consensus 99.51
KOG0726440 consensus 99.47
smart00350509 MCM minichromosome maintenance proteins. 99.42
PRK13531 498 regulatory ATPase RavA; Provisional 99.42
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 99.2
KOG0478804 consensus 98.89
PTZ00111 916 DNA replication licensing factor MCM4; Provisional 98.7
KOG0477854 consensus 98.09
pfam05272198 VirE Virulence-associated protein E. This family contai 97.85
KOG0479 818 consensus 97.48
KOG0481729 consensus 97.17
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 97.04
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 96.7
COG3378517 Phage associated DNA primase [General function predicti 96.5
COG1197 1139 Mfd Transcription-repair coupling factor (superfamily I 96.2
PRK08769319 DNA polymerase III subunit delta'; Validated 99.8
PRK05707328 DNA polymerase III subunit delta'; Validated 99.79
PRK06871324 DNA polymerase III subunit delta'; Validated 99.77
PRK06090319 DNA polymerase III subunit delta'; Validated 99.74
TIGR00678216 holB DNA polymerase III, delta' subunit; InterPro: IPR0 99.72
PRK05917290 DNA polymerase III subunit delta'; Validated 99.71
PRK07993334 DNA polymerase III subunit delta'; Validated 99.68
PRK06964342 DNA polymerase III subunit delta'; Validated 99.64
PRK07276290 DNA polymerase III subunit delta'; Validated 99.58
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 99.46
KOG1514767 consensus 99.38
KOG0745564 consensus 99.34
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 99.2
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 99.08
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 99.02
TIGR02974349 phageshock_pspF psp operon transcriptional activator Ps 98.97
COG3284606 AcoR Transcriptional activator of acetoin/glycerol meta 98.86
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 98.78
PRK05574336 holA DNA polymerase III subunit delta; Reviewed 98.09
PRK08487328 DNA polymerase III subunit delta; Validated 97.51
PRK05629331 hypothetical protein; Validated 97.47
PRK07452326 DNA polymerase III subunit delta; Validated 97.46
PRK07914320 hypothetical protein; Reviewed 96.9
CHL00026 2286 ycf2 Ycf2 96.75
PRK06217185 hypothetical protein; Validated 96.67
pfam00004131 AAA ATPase family associated with various cellular acti 99.8
pfam07726131 AAA_3 ATPase family associated with various cellular ac 99.79
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 99.77
PRK08699325 DNA polymerase III subunit delta'; Validated 99.57
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 99.47
KOG0741 744 consensus 99.3
KOG0744423 consensus 99.14
smart00382148 AAA ATPases associated with a variety of cellular activ 99.07
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 98.98
PHA02244383 ATPase-like protein 98.76
TIGR02031 705 BchD-ChlD magnesium chelatase ATPase subunit D; InterPr 98.53
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational modi 98.02
COG1373398 Predicted ATPase (AAA+ superfamily) [General function p 97.91
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 97.78
PRK06581263 DNA polymerase III subunit delta'; Validated 97.3
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 96.74
pfam0549175 RuvB_C Holliday junction DNA helicase ruvB C-terminus. 99.75
PRK05818262 DNA polymerase III subunit delta'; Validated 99.62
COG4650531 RtcR Sigma54-dependent transcription regulator containi 98.52
KOG0736 953 consensus 99.08
KOG1051898 consensus 99.02
PRK07952242 DNA replication protein DnaC; Validated 98.99
PRK12377248 putative replication protein; Provisional 98.87
KOG0741744 consensus 98.83
PRK08116262 hypothetical protein; Validated 98.81
PRK06835330 DNA replication protein DnaC; Validated 98.54
COG1484254 DnaC DNA replication protein [DNA replication, recombin 98.4
PRK08939306 primosomal protein DnaI; Reviewed 98.07
KOG2170344 consensus 98.05
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 97.3
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 96.89
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 96.29
PRK10689 1148 transcription-repair coupling factor; Provisional 96.18
PRK10436461 hypothetical protein; Provisional 96.1
PRK08181269 transposase; Validated 98.65
PRK06526254 transposase; Provisional 98.64
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 98.62
PRK09183258 transposase/IS protein; Provisional 98.42
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.93
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 97.87
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.75
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 97.49
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.47
pfam04851103 ResIII Type III restriction enzyme, res subunit. 97.46
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 97.36
TIGR01967 1320 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IP 97.22
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 97.05
TIGR01970 858 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IP 96.99
PRK04040189 adenylate kinase; Provisional 96.92
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 96.62
pfam05970 418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 96.47
KOG0922 674 consensus 96.07
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transport an 95.93
KOG0923 902 consensus 95.82
pfam01443226 Viral_helicase1 Viral (Superfamily 1) RNA helicase. Hel 95.8
PRK13889 992 conjugal transfer relaxase TraA; Provisional 95.37
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 98.62
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 98.02
pfam06309127 Torsin Torsin. This family consists of several eukaryot 97.94
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 97.74
PRK13764605 ATPase; Provisional 97.58
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 97.43
KOG2543 438 consensus 97.27
PRK13833323 conjugal transfer protein TrbB; Provisional 97.16
COG1855604 ATPase (PilT family) [General function prediction only] 97.11
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 97.09
PRK13894320 conjugal transfer ATPase TrbB; Provisional 97.07
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 97.01
PRK04220306 2-phosphoglycerate kinase; Provisional 96.87
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 96.41
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 96.22
TIGR00631 667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 96.16
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 95.82
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 95.63
COG2909 894 MalT ATP-dependent transcriptional regulator [Transcrip 95.58
PRK10744257 phosphate transporter subunit; Provisional 95.45
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 95.36
pfam00931285 NB-ARC NB-ARC domain. 98.58
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 98.51
PRK06921265 hypothetical protein; Provisional 98.39
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 98.11
PRK03839180 putative kinase; Provisional 97.96
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.94
PRK00131175 aroK shikimate kinase; Reviewed 97.94
PRK13695174 putative NTPase; Provisional 97.91
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 97.87
PRK13947171 shikimate kinase; Provisional 97.85
PRK13948182 shikimate kinase; Provisional 97.85
PRK05057172 aroK shikimate kinase I; Reviewed 97.8
PRK13946195 shikimate kinase; Provisional 97.8
pfam03266168 DUF265 Protein of unknown function, DUF265. 97.79
PRK03731172 aroL shikimate kinase II; Reviewed 97.77
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 97.76
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 97.74
PRK13949169 shikimate kinase; Provisional 97.73
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 97.72
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 97.69
PRK00625173 shikimate kinase; Provisional 97.66
PRK11545177 gntK gluconate kinase 1; Provisional 97.65
KOG3347176 consensus 97.64
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 97.62
PTZ00088225 adenylate kinase 1; Provisional 97.61
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 97.57
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 97.55
PRK02496185 adk adenylate kinase; Provisional 97.52
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 97.52
PRK09825176 idnK D-gluconate kinase; Provisional 97.48
PRK00279215 adk adenylate kinase; Reviewed 97.47
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 97.47
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 97.46
TIGR01187331 potA polyamine ABC transporter, ATP-binding protein; In 97.4
TIGR01351232 adk adenylate kinases; InterPro: IPR006259 Most members 97.38
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 97.35
PRK08118167 topology modulation protein; Reviewed 97.35
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 97.35
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 97.34
PRK07261171 topology modulation protein; Provisional 97.33
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 97.32
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 97.3
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 97.25
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 97.25
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 97.25
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate synthase 97.25
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 97.19
cd01124187 KaiC KaiC is a circadian clock protein primarily found 97.11
PRK13900332 type IV secretion system ATPase VirB11; Provisional 97.09
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 97.07
pfam00406186 ADK Adenylate kinase. 97.03
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 97.02
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 96.99
PRK00023225 cmk cytidylate kinase; Provisional 96.95
COG3839338 MalK ABC-type sugar transport systems, ATPase component 96.91
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 96.88
PRK09270230 frcK putative fructose transport system kinase; Reviewe 96.86
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 96.86
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 96.85
PRK13808297 adenylate kinase; Provisional 96.83
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 96.79
KOG1803 649 consensus 96.76
PRK04328250 hypothetical protein; Provisional 96.75
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 96.74
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Esch 96.72
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 96.69
PRK11784333 tRNA 2-selenouridine synthase; Provisional 96.68
PRK09302 501 circadian clock protein KaiC; Reviewed 96.68
cd01394218 radB RadB. The archaeal protein radB shares similarity 96.68
PRK05541176 adenylylsulfate kinase; Provisional 96.67
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 96.66
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 96.61
PRK13851343 type IV secretion system protein VirB11; Provisional 96.58
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 96.58
PRK04182178 cytidylate kinase; Provisional 96.58
PRK00300208 gmk guanylate kinase; Provisional 96.55
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 96.52
PRK03846198 adenylylsulfate kinase; Provisional 96.49
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 96.49
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 96.49
cd03115173 SRP The signal recognition particle (SRP) mediates the 96.48
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 96.45
COG4178604 ABC-type uncharacterized transport system, permease and 96.43
pfam03969361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 96.41
TIGR02142361 modC_ABC molybdate ABC transporter, ATP-binding protein 96.39
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 96.39
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 96.39
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 96.39
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) i 96.37
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 96.35
PRK12339197 2-phosphoglycerate kinase; Provisional 96.33
KOG3354191 consensus 96.33
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 96.33
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 96.33
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 96.33
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 96.33
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 96.32
pfam01057271 Parvo_NS1 Parvovirus non-structural protein NS1. This f 96.29
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.26
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 96.25
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 96.22
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 96.22
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 96.2
PRK10646153 putative ATPase; Provisional 96.19
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 96.19
KOG0060659 consensus 96.18
pfam00625182 Guanylate_kin Guanylate kinase. 96.17
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Provisi 96.16
pfam02367123 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This 96.15
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic. Me 96.15
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 96.14
CHL00178 2133 consensus 96.13
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 96.12
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 96.12
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 96.11
PRK09302501 circadian clock protein KaiC; Reviewed 96.11
PRK00889175 adenylylsulfate kinase; Provisional 96.1
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 96.1
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 96.09
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 96.08
PRK06696227 uridine kinase; Validated 96.08
pfam06745231 KaiC KaiC. This family represents a conserved region wi 96.07
pfam01745232 IPT Isopentenyl transferase. Isopentenyl transferase / 96.06
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and metabol 96.04
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 96.04
COG3265161 GntK Gluconate kinase [Carbohydrate transport and metab 96.04
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 96.03
PRK06762166 hypothetical protein; Provisional 96.02
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 96.02
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 96.01
TIGR00017223 cmk cytidylate kinase; InterPro: IPR003136 This family 96.0
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome biog 96.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 96.0
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 96.0
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 95.97
PRK13768253 GTPase; Provisional 95.97
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 95.97
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 95.97
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 95.94
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 95.92
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 95.92
PRK00698204 tmk thymidylate kinase; Validated 95.92
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 95.92
PRK05480209 uridine kinase; Provisional 95.89
KOG0926 1172 consensus 95.88
PRK08099411 nicotinamide-nucleotide adenylyltransferase; Provisiona 95.88
PRK11860662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 95.88
PRK10789569 putative multidrug transporter membrane\ATP-binding com 95.86
pfam01202158 SKI Shikimate kinase. 95.86
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 95.86
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 95.84
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 95.84
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 95.83
PRK01184183 hypothetical protein; Provisional 95.82
pfam00006213 ATP-synt_ab ATP synthase alpha/beta family, nucleotide- 95.81
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 95.79
COG1123 539 ATPase components of various ABC-type transport systems 95.79
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 95.78
cd01919515 PEPCK Phosphoenolpyruvate carboxykinase (PEPCK), a crit 95.76
COG1428216 Deoxynucleoside kinases [Nucleotide transport and metab 95.76
PRK10790593 putative multidrug transporter membrane\ATP-binding com 95.74
PRK12338320 hypothetical protein; Provisional 95.73
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 95.72
PRK10522547 multidrug transporter membrane component/ATP-binding co 95.71
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 95.71
PRK06067241 flagellar accessory protein FlaH; Validated 95.71
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 95.69
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S1; Pr 95.68
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.68
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 95.67
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 95.66
COG4525259 TauB ABC-type taurine transport system, ATPase componen 95.64
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 95.64
TIGR00630 956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 95.64
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 95.61
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 95.59
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phos 95.59
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.57
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 95.56
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 95.56
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 95.53
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 95.52
COG0802149 Predicted ATPase or kinase [General function prediction 95.51
TIGR00954788 3a01203 Peroxysomal long chain fatty acyl transporter; 95.5
CHL00179 2262 consensus 95.48
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 95.46
pfam10236274 DAP3 Mitochondrial ribosomal death-associated protein 3 95.45
TIGR01618229 phage_P_loop phage nucleotide-binding protein; InterPro 95.45
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 95.45
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 95.42
PHA00350 402 putative assembly protein 95.41
cd03234226 ABCG_White The White subfamily represents ABC transport 95.4
COG0645170 Predicted kinase [General function prediction only] 95.39
COG1118345 CysA ABC-type sulfate/molybdate transport systems, ATPa 95.35
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 95.35
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein super 95.33
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 95.32
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.32
PRK06585343 holA DNA polymerase III subunit delta; Reviewed 97.66
pfam06144172 DNA_pol3_delta DNA polymerase III, delta subunit. DNA p 96.94
COG1466334 HolA DNA polymerase III, delta subunit [DNA replication 96.48
PRK10875 607 recD exonuclease V subunit alpha; Provisional 97.25
TIGR00764 662 lon_rel ATP-dependent protease, putative; InterPro: IPR 97.18
COG4626 546 Phage terminase-like protein, large subunit [General fu 95.79
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 97.14
>TIGR00635 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR004605 All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2028 consensus Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR02928 TIGR02928 orc1/cdc6 family replication initiation protein; InterPro: IPR014277 This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461 Proteins in this entry are related to ClpA () from Escherichia coli Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR; InterPro: IPR012704 At least five distinct pathways exist for the catabolism of propionate by way of propionyl-CoA Back     alignment and domain information
>KOG2228 consensus Back     alignment and domain information