254780555

254780555

hypothetical protein CLIBASIA_02210

GeneID in NCBI database:8209552Locus tag:CLIBASIA_02210
Protein GI in NCBI database:254780555Protein Accession:YP_003064968.1
Gene range:+(725077, 725202)Protein Length:41aa
Gene description:hypothetical protein
COG prediction:[K] Prophage antirepressor
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40-
MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT
cccccccccccccEEEEEEccccEEEEEEEcccccEEEEEc
cccccccccccccEEEEEEccccEEEEEEEccccccccccc
msdmipfnlehnpirivvdedgnyWFMVKDvaggldftsit
msdmipfnlehnpirivvdEDGNYWFMVKDVAGGLDFTSIT
MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT
**DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSI*
MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT
***MIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT***
ooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooo
ooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT
MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT
MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target41 hypothetical protein CLIBASIA_02210 [Candidatus Liberib
254780125 262 prophage antirepressor [Candidatus Liberibacter as 8e-08
>gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 46.6 bits (109), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 24/37 (64%)

Query: 1  MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37
          MS + PF  E N IR +VD+D N WF+ KDVA  L +
Sbjct: 1  MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGY 37

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target41 hypothetical protein CLIBASIA_02210 [Candidatus Liberib
254780125 262 prophage antirepressor [Candidatus Liberibacter asiatic 1 0.001
315122913 261 prophage antirepressor [Candidatus Liberibacter solanac 2 1e-07
315121946 262 prophage antirepressor [Candidatus Liberibacter solanac 2 1e-07
315121965 263 prophage antirepressor [Candidatus Liberibacter solanac 2 4e-06
315122933 264 prophage antirepressor [Candidatus Liberibacter solanac 2 4e-06
9107730 530 phage-related protein [Xylella fastidiosa 9a5c] Length 2 6e-06
77747608 504 hypothetical protein XF2524 [Xylella fastidiosa 9a5c] L 2 6e-06
15837286 503 hypothetical protein XF0684 [Xylella fastidiosa 9a5c] L 2 6e-06
28199601 503 hypothetical protein PD1726 [Xylella fastidiosa Temecul 2 6e-06
182681747 535 prophage antirepressor [Xylella fastidiosa M23] Length 2 6e-06
>gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment and organism information
 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 24/37 (64%)

Query: 1  MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37
          MS + PF  E N IR +VD+D N WF+ KDVA  L +
Sbjct: 1  MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGY 37


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122913|ref|YP_004063402.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 261 Back     alignment and organism information
>gi|315121946|ref|YP_004062435.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 262 Back     alignment and organism information
>gi|315121965|ref|YP_004062454.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 263 Back     alignment and organism information
>gi|315122933|ref|YP_004063422.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 264 Back     alignment and organism information
>gi|9107730|gb|AAF85322.1|AE004059_12 phage-related protein [Xylella fastidiosa 9a5c] Length = 530 Back     alignment and organism information
>gi|77747608|ref|NP_299802.2| hypothetical protein XF2524 [Xylella fastidiosa 9a5c] Length = 504 Back     alignment and organism information
>gi|15837286|ref|NP_297974.1| hypothetical protein XF0684 [Xylella fastidiosa 9a5c] Length = 503 Back     alignment and organism information
>gi|28199601|ref|NP_779915.1| hypothetical protein PD1726 [Xylella fastidiosa Temecula1] Length = 503 Back     alignment and organism information
>gi|182681747|ref|YP_001829907.1| prophage antirepressor [Xylella fastidiosa M23] Length = 535 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target41 hypothetical protein CLIBASIA_02210 [Candidatus Liberib
COG3617 176 COG3617, COG3617, Prophage antirepressor [Transcription 0.002
>gnl|CDD|33416 COG3617, COG3617, Prophage antirepressor [Transcription] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 41 hypothetical protein CLIBASIA_02210 [Candidatus Liberib
COG3617 176 Prophage antirepressor [Transcription] 92.6
>COG3617 Prophage antirepressor [Transcription] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00