254780556

254780556

hypothetical protein CLIBASIA_02215

GeneID in NCBI database:8209553Locus tag:CLIBASIA_02215
Protein GI in NCBI database:254780556Protein Accession:YP_003064969.1
Gene range:+(724662, 725024)Protein Length:120aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MRAKTLLASTLVTTAITIIGCSLVEDNRIESLRMVKEAKMEVLEAHKLAKEYVEQANQRVKEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQNKYQDEMEELSEFGEKVSDY
ccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHccHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccc
MRAKTLLASTLVTTAITIIGCSLVEDNRIESLRMVKEAKMEVLEAHKLAKEYVEQANQRVKEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQNKYQDEMEELSEfgekvsdy
MRAKTLLASTLVTTAITIIGCSLVEDNRIESLRMVKEAKMEVLEAHKLAKEYVEQANQRVKEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQNKYQDEMEELsefgekvsdy
MRAKTLLASTLVTTAITIIGCSLVEDNRIESLRMVKEAKMEVLEAHKLAKEYVEQANQRVKEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQNKYQDEMEELSEFGEKVSDY
*******ASTLVTTAITIIGCSLVEDNRIESLRMVKEAKMEVLEAHKL***************************GMDDLVRYFMNLDSQNQAFFIDTIQNKYQDEMEELSEFG******
MRAKTLLASTLVTTAITIIGCSLVEDNRIESLRMVKEAKMEVLEAHKLAKEYVEQA**********SNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQNKYQDEM*************
*RAKTLLASTLVTTAITIIGCSLVEDNRIESLRMVKEAKMEVLEAHKLAKEYVEQANQRVKEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQNKYQDEMEELSEFGEK****
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRAKTLLASTLVTTAITIIGCSLVEDNRIESLRMVKEAKMEVLEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxGLGMDDLVRYFMNLDSQNQAFFxxxxxxxxxxxxxxxxxxxxxVSDY
MRAKTLLASTLVTTAITIIGCSLVEDNRIESLRMVKEAKMEVLEAHKLAKEYVEQANQRVKEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQNKYQDEMEELSEFGEKVSDY
MRAKTLLASTLVTTAITIIGCSLVEDNRIESLRMVKEAKMEVLEAHKLAKEYVEQANQRVKEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQNKYQDEMEELSEFGEKVSDY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target120 hypothetical protein CLIBASIA_02215 [Candidatus Liberib
254780980121 hypothetical protein CLIBASIA_04405 [Candidatus Li 7e-14
>gi|254780980|ref|YP_003065393.1| hypothetical protein CLIBASIA_04405 [Candidatus Liberibacter asiaticus str. psy62] Length = 121 Back     alignment
 Score = 67.4 bits (163), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 66/108 (61%), Gaps = 10/108 (9%)

Query: 1   MRAKTLLASTLVTTAITIIGCSLV----ED--NRIE--SLRMVKEAKMEVLEAHKLAKEY 52
           M+AK L+ S   TT +TI GC +V    ED  N+++  S +M+KEA  ++ E H+LA+E 
Sbjct: 1   MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQER 60

Query: 53  VEQANQRVKEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQ 100
           VE A +RVKE EE++ A   + L +D+L   F +L  +++  F   ++
Sbjct: 61  VEAAEKRVKEVEERATAS--RKLSVDELANAFWDLSDEDKNAFTGNVK 106

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target120 hypothetical protein CLIBASIA_02215 [Candidatus Liberib
254780980121 hypothetical protein CLIBASIA_04405 [Candidatus Liberib 1 6e-10
>gi|254780980|ref|YP_003065393.1| hypothetical protein CLIBASIA_04405 [Candidatus Liberibacter asiaticus str. psy62] Length = 121 Back     alignment and organism information
 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 66/108 (61%), Gaps = 10/108 (9%)

Query: 1   MRAKTLLASTLVTTAITIIGCSLV----ED--NRIE--SLRMVKEAKMEVLEAHKLAKEY 52
           M+AK L+ S   TT +TI GC +V    ED  N+++  S +M+KEA  ++ E H+LA+E 
Sbjct: 1   MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQER 60

Query: 53  VEQANQRVKEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQ 100
           VE A +RVKE EE++ A   + L +D+L   F +L  +++  F   ++
Sbjct: 61  VEAAEKRVKEVEERATAS--RKLSVDELANAFWDLSDEDKNAFTGNVK 106


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00