254780558

254780558

hypothetical protein CLIBASIA_02225

GeneID in NCBI database:8209555Locus tag:CLIBASIA_02225
Protein GI in NCBI database:254780558Protein Accession:YP_003064971.1
Gene range:+(722593, 723783)Protein Length:396aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein; K09798 hypothetical protein
SEED prediction:Possible divergent polysaccharide deacetylase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390------
MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS
cccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccEEEEEEEcccccccHHHHHHHHccccEEEEEEcccccHHHHHHHHHHcccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccHHcccHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHcccEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcHHHcEEEEEHHHHHHcccccc
cccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEcccccccccccccccccccccccccccccccHHHccccccEEcccccccEEccccccccccccccccccHEEccccHHHHHcccccccccccccHHcccccccccccEEEEEEEccccccccHHHHHHcccccEEEEEccccccHHHHHHHHHHcccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEccccccHHcccHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHcccHcccEEEEHHHHcccccccc
msidlnhplrkktpkrkSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGtisemipysvireiapipltiplniedkqspskrdnntvcnqlkndssqhdgqiqndisgktvvnkptrstsidslPTIEERLILGLSKKELLAknkvgredtevpamdknfcsnasGARIAIVVSGlgisqtgtQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPmqafdesyneddsytLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRgllffddgssprnltrvlapklnlpymvadlylddqvdRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQehvrdvsvvplsclaklsspss
msidlnhplrkktpkrksFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLkndssqhdgqiqndisgktvvnkptrstsidslptiEERLILglskkellaknkvgredtevpamdknfCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGllffddgssprnLTRVLAPKLNLPYMVADlylddqvdRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLsclaklsspss
MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS
***DLNH******************RLGLFLLFCTFIVGLSIYILISHAFVG********************************************************************************************************************SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF******DDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC**K******
MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS
*****NHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPL***************************************SGKTVVN****STSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS
MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS
MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target396 hypothetical protein CLIBASIA_02225 [Candidatus Liberib
315121752354 hypothetical protein CKC_00010 [Candidatus Liberibacter 1 1e-119
307316285400 protein of unknown function DUF610 YibQ [Sinorhizobium 1 6e-59
15966920400 hypothetical protein SMc03784 [Sinorhizobium meliloti 1 1 1e-58
209551457397 hypothetical protein Rleg2_3886 [Rhizobium leguminosaru 1 3e-55
222087889400 hypothetical protein Arad_4893 [Agrobacterium radiobact 1 4e-55
218515367367 hypothetical protein Retl8_17560 [Rhizobium etli 8C-3] 1 5e-55
222150173398 hypothetical protein Avi_4301 [Agrobacterium vitis S4] 1 8e-55
150398212399 hypothetical protein Smed_3017 [Sinorhizobium medicae W 1 2e-54
190893932388 hypothetical protein RHECIAT_CH0004369 [Rhizobium etli 1 2e-54
116254417388 polysaccharide deacetylase protein [Rhizobium leguminos 1 2e-54
>gi|315121752|ref|YP_004062241.1| hypothetical protein CKC_00010 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 354 Back     alignment and organism information
 Score =  431 bits (1108), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 228/364 (62%), Positives = 266/364 (73%), Gaps = 25/364 (6%)

Query: 37  IVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCN--Q 94
           I GLSIYIL+S+A +GT+SE+ PYS +RE     + +PL      +P+    NT  +  Q
Sbjct: 3   IFGLSIYILMSNALIGTVSEIGPYSFVRE----AVLVPLKNSSVANPASSPVNTAPSPTQ 58

Query: 95  LKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNK----- 149
           + N +   D           V N+  RST +DSLPTIE RLI      EL+ K K     
Sbjct: 59  VVNSTDHKDA---------LVANESKRSTLLDSLPTIEGRLI---PVSELMEKTKPHLIS 106

Query: 150 VGREDTEVP-AMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNS 208
           V  E+  V  A     C N SGARIAIVVS LGISQTGTQRAINLLP N+TLAFASNGNS
Sbjct: 107 VESENKSVSSAYSTRSCPNVSGARIAIVVSALGISQTGTQRAINLLPQNVTLAFASNGNS 166

Query: 209 LDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYF 268
           L+RWM+ AK+KGQE +LQIPMQ+F+E  N DD YTLK+T++ QQLL+RLRYSLRRG GYF
Sbjct: 167 LNRWMQAAKQKGQEVMLQIPMQSFNE-LNNDDVYTLKITKSSQQLLSRLRYSLRRGKGYF 225

Query: 269 GVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYL 328
           GVMNYRGAM LSNK+S E IFKEFA  GLLFFDDGSS RNLTRV+AP++NLPY VADLYL
Sbjct: 226 GVMNYRGAMFLSNKDSVETIFKEFAALGLLFFDDGSSSRNLTRVVAPQINLPYAVADLYL 285

Query: 329 DDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           DD VDRD IREKLK L +IAR TGQAIGVA AFDES+E IS+WLQ+EH  DVS+VPLSCL
Sbjct: 286 DDVVDRDSIREKLKKLSDIARVTGQAIGVASAFDESVEEISKWLQEEHASDVSIVPLSCL 345

Query: 389 AKLS 392
            KL+
Sbjct: 346 VKLA 349


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|307316285|ref|ZP_07595729.1| protein of unknown function DUF610 YibQ [Sinorhizobium meliloti AK83] Length = 400 Back     alignment and organism information
>gi|15966920|ref|NP_387273.1| hypothetical protein SMc03784 [Sinorhizobium meliloti 1021] Length = 400 Back     alignment and organism information
>gi|209551457|ref|YP_002283374.1| hypothetical protein Rleg2_3886 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 397 Back     alignment and organism information
>gi|222087889|ref|YP_002546427.1| hypothetical protein Arad_4893 [Agrobacterium radiobacter K84] Length = 400 Back     alignment and organism information
>gi|218515367|ref|ZP_03512207.1| hypothetical protein Retl8_17560 [Rhizobium etli 8C-3] Length = 367 Back     alignment and organism information
>gi|222150173|ref|YP_002551130.1| hypothetical protein Avi_4301 [Agrobacterium vitis S4] Length = 398 Back     alignment and organism information
>gi|150398212|ref|YP_001328679.1| hypothetical protein Smed_3017 [Sinorhizobium medicae WSM419] Length = 399 Back     alignment and organism information
>gi|190893932|ref|YP_001980474.1| hypothetical protein RHECIAT_CH0004369 [Rhizobium etli CIAT 652] Length = 388 Back     alignment and organism information
>gi|116254417|ref|YP_770255.1| polysaccharide deacetylase protein [Rhizobium leguminosarum bv. viciae 3841] Length = 388 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target396 hypothetical protein CLIBASIA_02225 [Candidatus Liberib
pfam04748213 pfam04748, Polysacc_deac_2, Divergent polysaccharide de 2e-46
COG2861250 COG2861, COG2861, Uncharacterized protein conserved in 4e-47
>gnl|CDD|147083 pfam04748, Polysacc_deac_2, Divergent polysaccharide deacetylase Back     alignment and domain information
>gnl|CDD|32688 COG2861, COG2861, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 396 hypothetical protein CLIBASIA_02225 [Candidatus Liberib
COG2861250 Uncharacterized protein conserved in bacteria [Function 100.0
pfam04748213 Polysacc_deac_2 Divergent polysaccharide deacetylase. T 100.0
TIGR02764198 spore_ybaN_pdaB polysaccharide deacetylase family sporu 96.07
PRK02134253 hypothetical protein; Provisional 94.53
TIGR03473283 HpnK hopanoid biosynthesis associated protein HpnK. The 93.8
TIGR03212297 uraD_N-term-dom putative urate catabolism protein. This 95.76
pfam04794261 YdjC YdjC-like protein. Family of YdjC-like proteins. T 93.72
COG5478141 Predicted small integral membrane protein [Function unk 93.45
>COG2861 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam04748 Polysacc_deac_2 Divergent polysaccharide deacetylase Back     alignment and domain information
>TIGR02764 spore_ybaN_pdaB polysaccharide deacetylase family sporulation protein PdaB; InterPro: IPR014132 This entry describes the YbaN protein family, also called PdaB and SpoVIE, of Gram-positive bacteria Back     alignment and domain information
>PRK02134 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03473 HpnK hopanoid biosynthesis associated protein HpnK Back     alignment and domain information
>TIGR03212 uraD_N-term-dom putative urate catabolism protein Back     alignment and domain information
>pfam04794 YdjC YdjC-like protein Back     alignment and domain information
>COG5478 Predicted small integral membrane protein [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target396 hypothetical protein CLIBASIA_02225 [Candidatus Liberib
2qv5_A261 Crystal Structure Of Uncharacterized Protein Atu277 1e-61
2nly_A245 Crystal Structure Of Protein Bh1492 From Bacillus H 8e-55
>gi|159795367|pdb|2QV5|A Chain A, Crystal Structure Of Uncharacterized Protein Atu2773 From Agrobacterium Tumefaciens C58 Length = 261 Back     alignment and structure
 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 104/247 (42%), Positives = 145/247 (58%)

Query: 143 ELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAF 202
            L     VG +            S A G R+AIVV GLG+SQTG+Q+AI  LP  +TL F
Sbjct: 2   SLGQLPVVGADGLRPMEQYARPWSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGF 61

Query: 203 ASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLR 262
           A++GNSL RWM++A+++G E +LQIP++ F          TL      +  ++RL  S+ 
Sbjct: 62  AASGNSLQRWMQDARREGHEILLQIPLEPFGYPGTNPGPDTLLAGDPAKVNIDRLHRSMA 121

Query: 263 RGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYM 322
           + T Y GVMNY G   L+ + + E + ++  KRGLLF DDGSS ++L+  +A  ++ P  
Sbjct: 122 KITNYTGVMNYLGGRFLAEQSALEPVMRDIGKRGLLFLDDGSSAQSLSGGIAKAISAPQG 181

Query: 323 VADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSV 382
            AD+ LD +V    I  KL  LE IAR  GQAIGVA AFDESI  IS+W ++   R + +
Sbjct: 182 FADVLLDGEVTEASILRKLDDLERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEI 241

Query: 383 VPLSCLA 389
           V +S L 
Sbjct: 242 VGVSALV 248


>gi|119390469|pdb|2NLY|A Chain A, Crystal Structure Of Protein Bh1492 From Bacillus Halodurans, Pfam Duf610 Length = 245 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target396 hypothetical protein CLIBASIA_02225 [Candidatus Liberib
2qv5_A261 AGR_C_5032P, uncharacterized protein ATU2773; structura 1e-51
2nly_A245 BH1492 protein, divergent polysaccharide deacetylase hy 4e-26
>2qv5_A AGR_C_5032P, uncharacterized protein ATU2773; structural genomics, unknown function, PSI-2, protein structure initiative; 1.90A {Agrobacterium tumefaciens str} Length = 261 Back     alignment and structure
 Score =  198 bits (506), Expect = 1e-51
 Identities = 101/225 (44%), Positives = 141/225 (62%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S A G R+AIVV GLG+SQTG+Q+AI  LP  +TL FA++GNSL RWM++A+++G E +L
Sbjct: 25  SGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFAASGNSLQRWMQDARREGHEILL 84

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
           QIP++ F          TL      +  ++RL  S+ + T Y GVMNY G   L+ + + 
Sbjct: 85  QIPLEPFGYPGTNPGPDTLLAGDPAKVNIDRLHRSMAKITNYTGVMNYLGGRFLAEQSAL 144

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           E + ++  KRGLLF DDGSS ++L+  +A  ++ P   AD+ LD +V    I  KL  LE
Sbjct: 145 EPVMRDIGKRGLLFLDDGSSAQSLSGGIAKAISAPQGFADVLLDGEVTEASILRKLDDLE 204

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            IAR  GQAIGVA AFDESI  IS+W ++   R + +V +S L  
Sbjct: 205 RIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIVGVSALVS 249


>2nly_A BH1492 protein, divergent polysaccharide deacetylase hypothetical protein; PFAM04748, structural genomics, PSI, protein structure initiative; 2.50A {Bacillus halodurans} SCOP: c.6.2.7 Length = 245 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target396 hypothetical protein CLIBASIA_02225 [Candidatus Liberib
2qv5_A261 AGR_C_5032P, uncharacterized protein ATU2773; structura 100.0
2nly_A245 BH1492 protein, divergent polysaccharide deacetylase hy 100.0
2vyo_A254 ECU11_0510, chitooligosaccharide deacetylase; CE4 ester 98.91
2j13_A247 Polysaccharide deacetylase; family 4, peptidoglycan, hy 98.48
2c1i_A431 Peptidoglycan glcnac deacetylase; carbohydrate esterase 98.38
2iw0_A254 Chitin deacetylase; hydrolase, chitin DE-N-acetylase, f 98.37
2cc0_A195 Acetyl-xylan esterase; hydrolase, carbohydrate esterase 98.28
1ny1_A240 Probable polysaccharide deacetylase PDAA; structural ge 98.18
2w3z_A311 Putative deacetylase; PGDA, glcnac DE-N-acetylase, hydr 97.98
2c71_A216 Glycoside hydrolase, family 11\:clostridium cellulosome 97.97
2i5i_A263 UPF0249 protein EF_3048; putative cellobiose-phosphate 96.32
1v6t_A255 Hypothetical UPF0271 protein PH0986; TIM-barrel, lactam 97.04
3cl6_A308 PUUE allantoinase; URIC acid, nitrogen fixation, hydrol 96.79
2dfa_A250 Hypothetical UPF0271 protein TTHB195; lactam utilizatio 95.27
1xw8_A252 UPF0271 protein YBGL; NESG, northeast structural genomi 95.06
>2qv5_A AGR_C_5032P, uncharacterized protein ATU2773; structural genomics, unknown function, PSI-2, protein structure initiative; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
Probab=100.00  E-value=0  Score=555.52  Aligned_cols=245  Identities=41%  Similarity=0.645  Sum_probs=235.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCC------CCCEEEEEECCCCCCCHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHCCCC
Q ss_conf             65646743455332112346------686589997377877168899998379350898708987689999999985992
Q gi|254780558|r  149 KVGREDTEVPAMDKNFCSNA------SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE  222 (396)
Q Consensus       149 ~~g~~P~~~~~~~~~~~~~a------~~~riAIVIddlG~~~~~~~~ai~~LP~~vT~A~~P~~~~~~~~~~~Ar~~G~E  222 (396)
                      ..|++|.+..++.+|+..||      .+|+|||||||+|++...+.++|.+||++|||||+||.+++++|++.||++|||
T Consensus         2 ~~g~lP~~~~~~~~P~~~~a~P~~~~~~p~iAIVIDD~G~~~~~~~~ai~~Lp~pvT~Ai~P~~~~~~~~a~~ar~~G~E   81 (261)
T 2qv5_A            2 SLGQLPVVGADGLRPMEQYARPWSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFAASGNSLQRWMQDARREGHE   81 (261)
T ss_dssp             -CCSCCCCCTTCCCHHHHTCCCCCCCSSEEEEEEEEEETSCHHHHHHHHHHSCTTSEEEEETTCSSHHHHHHHHHHHTCC
T ss_pred             CCCCCCCCCCCCCCHHHHCCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCCCE
T ss_conf             87889988888999466426889988886699999579999378999998589973799878997779999999977987


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHCCCCEEEEC
Q ss_conf             99981766568987787855446789989999999999985589359800123000049899999999985069289974
Q gi|254780558|r  223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDD  302 (396)
Q Consensus       223 vllhlPMEp~~~~~~~pGp~~L~~~~~~~~~~~~l~~~l~~~p~~vGvnNhmGs~~t~~~~~m~~vl~~l~~rgL~flDs  302 (396)
                      |||||||||++|+..||||++|+++|++++|+++|+|+|+++|+|+||||||||+||+|+..|++||++|++||||||||
T Consensus        82 vllhlPMep~~~~~~~~gp~~L~~~~~~~~i~~~l~~~l~~vP~avGvnNhmGS~~t~~~~~m~~v~~~l~~~gL~fvDS  161 (261)
T 2qv5_A           82 ILLQIPLEPFGYPGTNPGPDTLLAGDPAKVNIDRLHRSMAKITNYTGVMNYLGGRFLAEQSALEPVMRDIGKRGLLFLDD  161 (261)
T ss_dssp             EEEEEEECCTTTTTSCCCTTCBCTTSCHHHHHHHHHHHHTTCCCCSEEEEEECTTGGGCHHHHHHHHHHHHHTTCEEEEC
T ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCHHHCCHHHHHHHHHHHHHCCCEEEEC
T ss_conf             99976667668887888855456678899999999999986986299834655201269899999999998779889946


Q ss_pred             CCCCCCHHHHHHHHHCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCEEEEEEECCHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             97632267898987099469845886289999999999999999998719489998088788999999975688769189
Q gi|254780558|r  303 GSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSV  382 (396)
Q Consensus       303 ~Ts~~Sva~~~A~~~gvp~~~~dvfLD~~~~~~~I~~qL~~l~~~Ar~~G~AI~igh~~p~Ti~~L~~w~~~l~~~gi~l  382 (396)
                      +|+++|++.++|++.|+|+++||+||||++++++|++||++++++||++|+||+|||+||+||++|++|+++++++||+|
T Consensus       162 ~T~~~Sva~~~A~~~gvp~~~rdvfLD~~~~~~~I~~ql~~~~~~A~~~G~aI~Ighp~p~Tl~~L~~w~~~l~~~gi~l  241 (261)
T 2qv5_A          162 GSSAQSLSGGIAKAISAPQGFADVLLDGEVTEASILRKLDDLERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEI  241 (261)
T ss_dssp             SCCTTCCHHHHHHHHTCCEEECSEETTSSCSHHHHHHHHHHHHHHHHHHSEEEEEEECCHHHHHHHHHHHHHGGGGTEEE
T ss_pred             CCCCCCHHHHHHHHCCCCEEEECEECCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHHHCCEEE
T ss_conf             99877489999997599865402425899999999999999999998759589997899899999999716777688699


Q ss_pred             EEHHHHHHCCC
Q ss_conf             96777430647
Q gi|254780558|r  383 VPLSCLAKLSS  393 (396)
Q Consensus       383 VpvS~l~~~~~  393 (396)
                      ||+|+|++..+
T Consensus       242 VpvS~Ll~~~~  252 (261)
T 2qv5_A          242 VGVSALVSGQA  252 (261)
T ss_dssp             CCHHHHC----
T ss_pred             EEHHHHHHHCC
T ss_conf             98899742003



>2nly_A BH1492 protein, divergent polysaccharide deacetylase hypothetical protein; PFAM04748, structural genomics, PSI, protein structure initiative; 2.50A {Bacillus halodurans} SCOP: c.6.2.7 Back     alignment and structure
>2vyo_A ECU11_0510, chitooligosaccharide deacetylase; CE4 esterase, native protein, microsporidian, chitin deacetylase, hydrolase, inactive; 1.50A {Encephalitozoon cuniculi} Back     alignment and structure
>2j13_A Polysaccharide deacetylase; family 4, peptidoglycan, hydrolase, bacterial cell WALL, carbohydrate esterase; 1.7A {Bacillus anthracis} SCOP: c.6.2.3 Back     alignment and structure
>2c1i_A Peptidoglycan glcnac deacetylase; carbohydrate esterase, peptidoglycan deacetylase, metalloenzyme, D275N mutant, hydrolase; HET: MES; 1.35A {Streptococcus pneumoniae} SCOP: c.6.2.3 d.341.1.1 PDB: 2c1g_A Back     alignment and structure
>2iw0_A Chitin deacetylase; hydrolase, chitin DE-N-acetylase, family 4 carbohydrate esterase; 1.81A {Colletotrichum lindemuthianum} SCOP: c.6.2.3 Back     alignment and structure
>2cc0_A Acetyl-xylan esterase; hydrolase, carbohydrate esterase; 1.6A {Streptomyces lividans} SCOP: c.6.2.3 Back     alignment and structure
>1ny1_A Probable polysaccharide deacetylase PDAA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.6.2.3 PDB: 1w17_A 1w1b_1 1w1a_1 Back     alignment and structure
>2w3z_A Putative deacetylase; PGDA, glcnac DE-N-acetylase, hydrolase, divale metal cation dependent, carbohydrate esterase family 4; 1.45A {Streptococcus mutans UA159} Back     alignment and structure
>2c71_A Glycoside hydrolase, family 11\:clostridium cellulosome enzyme, dockerin type I\:polysaccharide...; acetyl-xylan, esterases, metal-ION; 1.05A {Clostridium thermocellum} SCOP: c.6.2.3 PDB: 2c79_A Back     alignment and structure
>2i5i_A UPF0249 protein EF_3048; putative cellobiose-phosphate cleavage protein, structural G joint center for structural genomics, JCSG; HET: MSE; 1.70A {Enterococcus faecalis V583} SCOP: c.6.2.8 Back     alignment and structure
>1v6t_A Hypothetical UPF0271 protein PH0986; TIM-barrel, lactam utilization protein, structural genomics; 1.70A {Pyrococcus horikoshii OT3} SCOP: c.6.2.5 Back     alignment and structure
>3cl6_A PUUE allantoinase; URIC acid, nitrogen fixation, hydrolase; 1.58A {Pseudomonas fluorescens} PDB: 3cl7_A 3cl8_A 1z7a_A Back     alignment and structure
>2dfa_A Hypothetical UPF0271 protein TTHB195; lactam utilization protein, structural genomics, NPPSFA; 1.90A {Thermus thermophilus HB8} SCOP: c.6.2.5 Back     alignment and structure
>1xw8_A UPF0271 protein YBGL; NESG, northeast structural genomics consortium, structural genomics, protein structure initiative, PSI, X-RAY; 2.00A {Escherichia coli} SCOP: c.6.2.5 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 396 hypothetical protein CLIBASIA_02225 [Candidatus Liberib
d2nlya1224 c.6.2.7 (A:31-254) Hypothetical protein BH1492 {Bacillu 1e-42
>d2nlya1 c.6.2.7 (A:31-254) Hypothetical protein BH1492 {Bacillus halodurans [TaxId: 86665]} Length = 224 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: 7-stranded beta/alpha barrel
superfamily: Glycoside hydrolase/deacetylase
family: Divergent polysaccharide deacetylase
domain: Hypothetical protein BH1492
species: Bacillus halodurans [TaxId: 86665]
 Score =  167 bits (425), Expect = 1e-42
 Identities = 46/221 (20%), Positives = 96/221 (43%), Gaps = 5/221 (2%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R AI++   G    G    +      +T+A         +  + A+  G E I+ +P++ 
Sbjct: 3   RAAIIIDDFGGDVKGVDDFLTG-EIPVTVAVMPFLEHSTKQAEIAQAAGLEVIVHMPLEP 61

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                +      +    +V ++ +R+R +        G+ N+ G+ ++ N++    I + 
Sbjct: 62  KKGKISWLGPSGITSNLSVGEVKSRVRKAFDDIPYAVGLNNHMGSKIVENEKIMRAILEV 121

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD-DQVDRDKIREKLKGLEEIART 350
             ++     D G+SP +L   LA +L +PY    ++LD     R ++ + ++ L + A+ 
Sbjct: 122 VKEKNAFIIDSGTSPHSLIPQLAEELEVPYATRSIFLDNTHSSRKEVIKNMRKLAKKAKQ 181

Query: 351 TGQAIGVA---VAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             + IG+    V  DE+   I   L +     + +VP+S L
Sbjct: 182 GSEPIGIGHVGVRGDETYAGIRSMLDEFQAESIQLVPVSQL 222


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target396 hypothetical protein CLIBASIA_02225 [Candidatus Liberib
d2nlya1224 Hypothetical protein BH1492 {Bacillus halodurans [TaxId 100.0
d2j13a1235 Putative polysaccharide deacetylase BA0424 {Bacillus an 98.45
d2c1ia1196 Peptidoglycan GlcNAc deacetylase C-terminal domain {Str 98.37
d1ny1a_235 Probable polysaccharide deacetylase PdaA {Bacillus subt 98.32
d2iw0a1220 Chitin deacetylase {Bean anthracnose fungus (Colletotri 98.28
d2cc0a1192 Acetyl-xylan esterase {Streptomyces lividans [TaxId: 19 98.28
d2c71a1204 Xylanase XynA C-terminal domain {Clostridium thermocell 97.91
d2i5ia1261 Uncharacterized protein EF3048 {Enterococcus faecalis [ 96.67
d1z7aa1301 Hypothetical protein PA1517 {Pseudomonas aeruginosa [Ta 96.65
d1v6ta_254 Hypothetical protein PH0986 {Pyrococcus horikoshii [Tax 96.64
d1xw8a_247 Hypothetical protein YbgL {Escherichia coli [TaxId: 562 95.12
d2dfaa1250 Hypothetical protein TTHB195 {Thermus thermophilus [Tax 94.92
>d2nlya1 c.6.2.7 (A:31-254) Hypothetical protein BH1492 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: 7-stranded beta/alpha barrel
superfamily: Glycoside hydrolase/deacetylase
family: Divergent polysaccharide deacetylase
domain: Hypothetical protein BH1492
species: Bacillus halodurans [TaxId: 86665]
Probab=100.00  E-value=0  Score=516.43  Aligned_cols=218  Identities=21%  Similarity=0.325  Sum_probs=212.5

Q ss_pred             CEEEEEECCCCCCCHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             65899973778771688999983793508987089876899999999859929998176656898778785544678998
Q gi|254780558|r  171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV  250 (396)
Q Consensus       171 ~riAIVIddlG~~~~~~~~ai~~LP~~vT~A~~P~~~~~~~~~~~Ar~~G~EvllhlPMEp~~~~~~~pGp~~L~~~~~~  250 (396)
                      +||||||||+|++...+++ +.+||+||||||+||.+++.+|++.||++||||||||||||.+|+.+||||++|+++|++
T Consensus         2 ~riAIVIdD~G~~~~~~~~-~~~Lp~pvT~Ai~P~~~~~~~~a~~A~~~g~EvllhlPMep~~~~~~~~gp~~L~~~~~~   80 (224)
T d2nlya1           2 KRAAIIIDDFGGDVKGVDD-FLTGEIPVTVAVMPFLEHSTKQAEIAQAAGLEVIVHMPLEPKKGKISWLGPSGITSNLSV   80 (224)
T ss_dssp             EEEEEEEEEESSCCTTHHH-HHTCSSCEEEEECSSSTTHHHHHHHHHHTTCEEEEEEEECCC--------CCCBCTTCCH
T ss_pred             CEEEEEEECCCCCHHHHHH-HHCCCCCEEEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCH
T ss_conf             7199999679998689999-975898758998799986199999999879869997455756677678887767778999


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCCEEEEEEEECC
Q ss_conf             99999999999855893598001230000498999999999850692899749763226789898709946984588628
Q gi|254780558|r  251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD  330 (396)
Q Consensus       251 ~~~~~~l~~~l~~~p~~vGvnNhmGs~~t~~~~~m~~vl~~l~~rgL~flDs~Ts~~Sva~~~A~~~gvp~~~~dvfLD~  330 (396)
                      +||+++|+|+|+++|+|+||||||||+||+|+..|+++|++|++||||||||+|+++|+++++|++.|+|+++|||||||
T Consensus        81 ~ei~~~l~~~l~~vP~avGvnNhmGS~~T~~~~~m~~v~~~l~~~gl~fvDS~T~~~sva~~~A~~~gvp~~~rdvfLD~  160 (224)
T d2nlya1          81 GEVKSRVRKAFDDIPYAVGLNNHMGSKIVENEKIMRAILEVVKEKNAFIIDSGTSPHSLIPQLAEELEVPYATRSIFLDN  160 (224)
T ss_dssp             HHHHHHHHHHHHHSTTCCEEEEEECTTGGGCHHHHHHHHHHHHHTTCEEEECCCCSSCSHHHHHHHTTCCEEECCEESCC
T ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCHHCCHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHCCCCEEEEEEECCC
T ss_conf             99999999999847364797137664111798999999999977697899327774668999998759985888786579


Q ss_pred             CCC-HHHHHHHHHHHHHHHHHCCEEEEEEE---CCHHHHHHHHHHHHHHHHCCCEEEEHHHHH
Q ss_conf             999-99999999999999987194899980---887889999999756887691899677743
Q gi|254780558|r  331 QVD-RDKIREKLKGLEEIARTTGQAIGVAV---AFDESIEVISQWLQQEHVRDVSVVPLSCLA  389 (396)
Q Consensus       331 ~~~-~~~I~~qL~~l~~~Ar~~G~AI~igh---~~p~Ti~~L~~w~~~l~~~gi~lVpvS~l~  389 (396)
                      +++ ...|++||++++++|+++|+||+|||   +||+|+++|++|+++++++||+|||+|+|+
T Consensus       161 ~~~~~~~I~~~l~~~~~~A~~~G~AI~IGH~~~p~p~Tl~~L~~~l~~l~~~gi~lvpvS~ll  223 (224)
T d2nlya1         161 THSSRKEVIKNMRKLAKKAKQGSEPIGIGHVGVRGDETYAGIRSMLDEFQAESIQLVPVSQLL  223 (224)
T ss_dssp             TTCCHHHHHHHHHHHHHHHHTTSCCEEEEECSTTHHHHHHHHGGGHHHHHHTTEEECCGGGGC
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCEEEEEHHHHC
T ss_conf             997199999999999999873696799983799976899999997357765887999778837



>d2j13a1 c.6.2.3 (A:1-235) Putative polysaccharide deacetylase BA0424 {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2c1ia1 c.6.2.3 (A:268-463) Peptidoglycan GlcNAc deacetylase C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ny1a_ c.6.2.3 (A:) Probable polysaccharide deacetylase PdaA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2iw0a1 c.6.2.3 (A:29-248) Chitin deacetylase {Bean anthracnose fungus (Colletotrichum lindemuthianum) [TaxId: 290576]} Back     information, alignment and structure
>d2cc0a1 c.6.2.3 (A:1-192) Acetyl-xylan esterase {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d2c71a1 c.6.2.3 (A:480-683) Xylanase XynA C-terminal domain {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2i5ia1 c.6.2.8 (A:2-262) Uncharacterized protein EF3048 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1z7aa1 c.6.2.6 (A:4-304) Hypothetical protein PA1517 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v6ta_ c.6.2.5 (A:) Hypothetical protein PH0986 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xw8a_ c.6.2.5 (A:) Hypothetical protein YbgL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dfaa1 c.6.2.5 (A:1-250) Hypothetical protein TTHB195 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 396 hypothetical protein CLIBASIA_02225 [Candidatus Li
3fho_A_1-326326 (A:1-326) ATP-dependent RNA helicase DBP5; mRNA ex 2e-04

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target396 hypothetical protein CLIBASIA_02225 [Candidatus Liberib
2qv5_A_261 AGR_C_5032P, uncharacterized protein ATU2773; stru 99.92
2nly_A_245 BH1492 protein, divergent polysaccharide deacetyla 99.88
1ny1_A_240 Probable polysaccharide deacetylase PDAA; structur 98.3
2w3z_A_311 Putative deacetylase; PGDA, glcnac DE-N-acetylase, 97.97
2vyo_A_254 ECU11_0510, chitooligosaccharide deacetylase; CE4 97.82
2j13_A_247 Polysaccharide deacetylase; family 4, peptidoglyca 97.4
2cc0_A_195 Acetyl-xylan esterase; hydrolase, carbohydrate est 97.11
2c71_A_216 Glycoside hydrolase, family 11\:clostridium cellul 96.83
2iw0_A_254 Chitin deacetylase; hydrolase, chitin DE-N-acetyla 96.63
2i5i_A_263 UPF0249 protein EF_3048; hypothetical protein, str 96.51
2c1i_A_236-431196 Peptidoglycan glcnac deacetylase; carbohydrate est 96.36
1v6t_A_255 Hypothetical UPF0271 protein PH0986; TIM-barrel, l 96.02
2dfa_A_250 Hypothetical UPF0271 protein TTHB195; lactam utili 94.71
3cl6_A_1-42_96-308255 PUUE allantoinase; URIC acid, nitrogen fixation, h 96.52
>2qv5_A (A:) AGR_C_5032P, uncharacterized protein ATU2773; structural genomics, unknown function, PSI-2, protein structure initiative; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
Probab=99.92  E-value=2.3e-21  Score=154.09  Aligned_cols=229  Identities=44%  Similarity=0.695  Sum_probs=219.4

Q ss_pred             CCCCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCC
Q ss_conf             12346686589997377877168899998379350898708987689999999985992999817665689877878554
Q gi|254780558|r  164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYT  243 (396)
Q Consensus       164 ~~~~a~~~riAIVIddlG~~~~~~~~ai~~LP~~vT~A~~P~~~~~~~~~~~Ar~~G~EvllhlPMEp~~~~~~~pGp~~  243 (396)
                      .+..+.+..|+|.+||.+.+...-.+.+.+.+.+.||-+.....+..+.++..++.||||-.|-.+.+..+...+.+...
T Consensus        23 ~~~~~~~~~ValTfDDg~~~~~~il~~L~~~~vkaTFFv~~~~~~~~~~~~~~~~~GhEIg~Ht~~H~~~~~~~~~~~~~  102 (261)
T 2qv5_A           23 PWSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFAASGNSLQRWMQDARREGHEILLQIPLEPFGYPGTNPGPDT  102 (261)
T ss_dssp             CCCCCSSEEEEEEEEEETSCHHHHHHHHHHSCTTSEEEEETTCSSHHHHHHHHHHHTCCEEEEEEECCTTTTTSCCCTTC
T ss_pred             CCCCCCCCEEEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCC
T ss_conf             89988886699999479998367899998589872799878997779999999977987999766676688878888554


Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCCEEE
Q ss_conf             46789989999999999985589359800123000049899999999985069289974976322678989870994698
Q gi|254780558|r  244 LKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMV  323 (396)
Q Consensus       244 L~~~~~~~~~~~~l~~~l~~~p~~vGvnNhmGs~~t~~~~~m~~vl~~l~~rgL~flDs~Ts~~Sva~~~A~~~gvp~~~  323 (396)
                      ++..++.+++++.+.++...+..+.|+.++.......+...+...+...+....++.+......+.....+...++....
T Consensus       103 ~l~~ls~~~~~~ei~~~~~~l~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  182 (261)
T 2qv5_A          103 LLAGDPAKVNIDRLHRSMAKITNYTGVMNYLGGRFLAEQSALEPVMRDIGKRGLLFLDDGSSAQSLSGGIAKAISAPQGF  182 (261)
T ss_dssp             BCTTSCHHHHHHHHHHHHTTCCCCSEEEEEECTTGGGCHHHHHHHHHHHHHTTCEEEECSCCTTCCHHHHHHHHTCCEEE
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHCCHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHCCCCEEE
T ss_conf             56567899999999999984537089846755212269999999999998769789957887563899999975997564


Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCEEEEEEECCHHHHHHHHHHHHHHHHCCCEEEEHHHHHHCC
Q ss_conf             458862899999999999999999987194899980887889999999756887691899677743064
Q gi|254780558|r  324 ADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS  392 (396)
Q Consensus       324 ~dvfLD~~~~~~~I~~qL~~l~~~Ar~~G~AI~igh~~p~Ti~~L~~w~~~l~~~gi~lVpvS~l~~~~  392 (396)
                      .+...+...+...+..++......++++|..+.++|.++.|+++|.+++..++++|+.+|+++++++..
T Consensus       183 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~li~~lk~~g~~fvt~~e~~~~~  251 (261)
T 2qv5_A          183 ADVLLDGEVTEASILRKLDDLERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIVGVSALVSGQ  251 (261)
T ss_dssp             CSEETTSSCSHHHHHHHHHHHHHHHHHHSEEEEEEECCHHHHHHHHHHHHHGGGGTEEECCHHHHC---
T ss_pred             ECEECCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHHHCCEEEEEHHHHHHCC
T ss_conf             033248999999999999999999977393799978998999999997267775886999879964100



>2nly_A (A:) BH1492 protein, divergent polysaccharide deacetylase hypothetical protein; PFAM04748, structural genomics, PSI, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>1ny1_A (A:) Probable polysaccharide deacetylase PDAA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; 1.80A {Bacillus subtilis} Back     alignment and structure
>2w3z_A (A:) Putative deacetylase; PGDA, glcnac DE-N-acetylase, hydrolase, divale metal cation dependent, carbohydrate esterase family 4; 1.45A {Streptococcus mutans UA159} Back     alignment and structure
>2vyo_A (A:) ECU11_0510, chitooligosaccharide deacetylase; CE4 esterase, native protein, microsporidian, chitin deacetylase, hydrolase, inactive; 1.50A {Encephalitozoon cuniculi} Back     alignment and structure
>2j13_A (A:) Polysaccharide deacetylase; family 4, peptidoglycan, hydrolase, bacterial cell WALL, carbohydrate esterase; 1.7A {Bacillus anthracis} Back     alignment and structure
>2cc0_A (A:) Acetyl-xylan esterase; hydrolase, carbohydrate esterase; 1.6A {Streptomyces lividans} Back     alignment and structure
>2c71_A (A:) Glycoside hydrolase, family 11\:clostridium cellulosome enzyme, dockerin type I\:polysaccharide...; acetyl-xylan, esterases, metal-ION; 1.05A {Clostridium thermocellum} Back     alignment and structure
>2iw0_A (A:) Chitin deacetylase; hydrolase, chitin DE-N-acetylase, family 4 carbohydrate esterase; 1.81A {Colletotrichum lindemuthianum} Back     alignment and structure
>2i5i_A (A:) UPF0249 protein EF_3048; hypothetical protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Enterococcus faecalis V583} Back     alignment and structure
>2c1i_A (A:236-431) Peptidoglycan glcnac deacetylase; carbohydrate esterase, peptidoglycan deacetylase, metalloenzyme, D275N mutant, hydrolase; HET: MES; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>1v6t_A (A:) Hypothetical UPF0271 protein PH0986; TIM-barrel, lactam utilization protein, structural genomics; 1.70A {Pyrococcus horikoshii OT3} Back     alignment and structure
>2dfa_A (A:) Hypothetical UPF0271 protein TTHB195; lactam utilization protein, structural genomics, NPPSFA; 1.90A {Thermus thermophilus HB8} Back     alignment and structure
>3cl6_A (A:1-42,A:96-308) PUUE allantoinase; URIC acid, nitrogen fixation, hydrolase; 1.58A {Pseudomonas fluorescens} PDB: 3cl7_A 3cl8_A 1z7a_A Back     alignment and structure