254780557

254780557

dinucleoside polyphosphate hydrolase

GeneID in NCBI database:8209554Locus tag:CLIBASIA_02220
Protein GI in NCBI database:254780557Protein Accession:YP_003064970.1
Gene range:+(723842, 724324)Protein Length:160aa
Gene description:dinucleoside polyphosphate hydrolase
COG prediction:[L] [R] NTP pyrophosphohydrolases including oxidative damage repair enzymes
KEGG prediction:dinucleoside polyphosphate hydrolase (EC:3.6.1.-); K08311 putative (di)nucleoside polyphosphate hydrolase [EC:3.6.1.-]
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:RNA degradation [PATH:las03018]
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MYRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKSEPMG
ccccEEEEEEEcccccEEEEEEcccccccccccEEcccccccccccHHHHHHHHHHHHHcccHHHHHHcccccEEEEccHHHccccccccccEEEEEEEEccccccccccccccccccccccEEcccHHHHHHccccccHHHHHHHHHHHHHHHcccccc
ccccccEEEEEcccccEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEccccccEEcccHHHccccccccccEEEEEEEEccccccEccccccccccccccccccccccccHHHEccccHHHHHHHHHHHHHHHcccccc
MYRRGVGILIlnqddlvwvgrrcfhdnnkhlslwqmpqgginpqedplDAAYRELYEETGIKsisllgqgdsyiqydfpahciqengyvGQMQKWFAFRFQGLTSEicvdrtaygyesefdawtwvslwdtpnivvdFKKEAYRQVVADFAYLIKSEPMG
myrrgvgililnqddlvwVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKSEPMG
MYRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKSEPMG
MYRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKS****
MYRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKSEPMG
MYRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKS****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKSEPMG
MYRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKSEPMG
MYRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKSEPMG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target160 dinucleoside polyphosphate hydrolase [Candidatus Liberi
254780325141 mutator MutT protein [Candidatus Liberibacter asia 0.003
>gi|254780325|ref|YP_003064738.1| mutator MutT protein [Candidatus Liberibacter asiaticus str. psy62] Length = 141 Back     alignment
 Score = 33.1 bits (74), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 34/88 (38%), Gaps = 12/88 (13%)

Query: 23  CFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI--KSISLLGQGDSYIQYD--- 77
           C   +  H   W+ P G I   E P +A  REL+EE  I  K  SL+        Y+   
Sbjct: 28  CRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFH 87

Query: 78  -----FPAHCIQ--ENGYVGQMQKWFAF 98
                F  HC +       GQ  +W A 
Sbjct: 88  LLMPFFVCHCFEGIPQSCEGQQLQWVAL 115

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target160 dinucleoside polyphosphate hydrolase [Candidatus Liberi
315121751158 dinucleoside polyphosphate hydrolase [Candidatus Liberi 1 5e-70
150398213175 dinucleoside polyphosphate hydrolase [Sinorhizobium med 1 9e-40
218681252181 dinucleoside polyphosphate hydrolase [Rhizobium etli CI 1 2e-39
209551458177 dinucleoside polyphosphate hydrolase [Rhizobium legumin 1 4e-39
227823693175 dinucleoside polyphosphate hydrolase [Sinorhizobium fre 1 8e-39
86359658177 dinucleoside polyphosphate hydrolase [Rhizobium etli CF 1 1e-38
116254418177 dinucleoside polyphosphate hydrolase [Rhizobium legumin 1 2e-38
307301693175 NUDIX hydrolase [Sinorhizobium meliloti BL225C] Length 1 2e-38
15966921167 dinucleoside polyphosphate hydrolase [Sinorhizobium mel 1 2e-38
190893933177 nucleoside polyphosphate hydrolase [Rhizobium etli CIAT 1 3e-38
>gi|315121751|ref|YP_004062240.1| dinucleoside polyphosphate hydrolase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 158 Back     alignment and organism information
 Score =  266 bits (681), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 139/156 (89%), Gaps = 1/156 (0%)

Query: 1   MYRRGVGILILNQDDLVWVGRR-CFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEET 59
           MYR GVGI++LNQDDLVWVGRR C   +  + SLWQMPQGGIN QEDP DAAYRELYEET
Sbjct: 1   MYRHGVGIVVLNQDDLVWVGRRLCDSHDKANSSLWQMPQGGINAQEDPFDAAYRELYEET 60

Query: 60  GIKSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESE 119
           GIKS+S L Q +SYIQYDFPA+C++ENGY+GQ QKWF FRFQG  SEICVDRTAYGYESE
Sbjct: 61  GIKSVSFLAQKNSYIQYDFPAYCVKENGYLGQRQKWFVFRFQGQISEICVDRTAYGYESE 120

Query: 120 FDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIK 155
           FDAWTWVSLWDTP++VVDFKKEAYR+VV+DFAYLIK
Sbjct: 121 FDAWTWVSLWDTPDMVVDFKKEAYRKVVSDFAYLIK 156


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150398213|ref|YP_001328680.1| dinucleoside polyphosphate hydrolase [Sinorhizobium medicae WSM419] Length = 175 Back     alignment and organism information
>gi|218681252|ref|ZP_03529149.1| dinucleoside polyphosphate hydrolase [Rhizobium etli CIAT 894] Length = 181 Back     alignment and organism information
>gi|209551458|ref|YP_002283375.1| dinucleoside polyphosphate hydrolase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 177 Back     alignment and organism information
>gi|227823693|ref|YP_002827666.1| dinucleoside polyphosphate hydrolase [Sinorhizobium fredii NGR234] Length = 175 Back     alignment and organism information
>gi|86359658|ref|YP_471550.1| dinucleoside polyphosphate hydrolase [Rhizobium etli CFN 42] Length = 177 Back     alignment and organism information
>gi|116254418|ref|YP_770256.1| dinucleoside polyphosphate hydrolase [Rhizobium leguminosarum bv. viciae 3841] Length = 177 Back     alignment and organism information
>gi|307301693|ref|ZP_07581452.1| NUDIX hydrolase [Sinorhizobium meliloti BL225C] Length = 175 Back     alignment and organism information
>gi|15966921|ref|NP_387274.1| dinucleoside polyphosphate hydrolase [Sinorhizobium meliloti 1021] Length = 167 Back     alignment and organism information
>gi|190893933|ref|YP_001980475.1| nucleoside polyphosphate hydrolase [Rhizobium etli CIAT 652] Length = 177 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target160 dinucleoside polyphosphate hydrolase [Candidatus Liberi
PRK00714156 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed 5e-48
pfam00293133 pfam00293, NUDIX, NUDIX domain 2e-17
COG0494161 COG0494, MutT, NTP pyrophosphohydrolases including oxid 2e-10
cd02883123 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfam 6e-10
cd04670127 cd04670, Nudix_Hydrolase_12, Members of the Nudix hydro 9e-08
cd03674138 cd03674, Nudix_Hydrolase_1, Members of the Nudix hydrol 3e-07
cd04664129 cd04664, Nudix_Hydrolase_7, Members of the Nudix hydrol 3e-07
cd03671147 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraph 1e-39
cd03424137 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADP 2e-07
COG1051145 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotid 2e-07
cd04667112 cd04667, Nudix_Hydrolase_10, Members of the Nudix hydro 4e-07
KOG0648295 KOG0648, KOG0648, KOG0648, Predicted NUDIX hydrolase FG 1e-06
cd04684128 cd04684, Nudix_Hydrolase_25, Contains a crystal structu 2e-06
cd04678129 cd04678, Nudix_Hydrolase_19, Members of the Nudix hydro 4e-06
cd04676129 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydro 5e-06
cd03425124 cd03425, MutT_pyrophosphohydrolase, The MutT pyrophosph 6e-06
cd04680120 cd04680, Nudix_Hydrolase_21, Members of the Nudix hydro 1e-05
cd04677132 cd04677, Nudix_Hydrolase_18, Members of the Nudix hydro 2e-05
cd03428130 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraph 3e-05
cd04685133 cd04685, Nudix_Hydrolase_26, Members of the Nudix hydro 3e-05
cd04673122 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydro 3e-05
cd04669121 cd04669, Nudix_Hydrolase_11, Members of the Nudix hydro 4e-05
cd04682122 cd04682, Nudix_Hydrolase_23, Members of the Nudix hydro 4e-05
cd04681130 cd04681, Nudix_Hydrolase_22, Members of the Nudix hydro 5e-05
cd03672145 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), the ca 1e-04
cd03673131 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6 1e-04
cd04700142 cd04700, DR1025_like, DR1025 from Deinococcus radiodura 2e-04
cd04662126 cd04662, Nudix_Hydrolase_5, Members of the Nudix hydrol 2e-04
KOG2839145 KOG2839, KOG2839, KOG2839, Diadenosine and diphosphoino 2e-04
PRK05379340 PRK05379, PRK05379, bifunctional nicotinamide mononucle 2e-04
PRK10776129 PRK10776, PRK10776, nucleoside triphosphate pyrophospho 4e-04
cd04699129 cd04699, Nudix_Hydrolase_39, Members of the Nudix hydro 6e-04
PRK08999 312 PRK08999, PRK08999, hypothetical protein; Provisional 6e-04
cd04666122 cd04666, Nudix_Hydrolase_9, Members of the Nudix hydrol 8e-04
COG4119161 COG4119, COG4119, Predicted NTP pyrophosphohydrolase [D 8e-04
cd04690118 cd04690, Nudix_Hydrolase_31, Members of the Nudix hydro 0.001
cd03427137 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the 0.001
cd04686131 cd04686, Nudix_Hydrolase_27, Members of the Nudix hydro 0.002
cd04665118 cd04665, Nudix_Hydrolase_8, Members of the Nudix hydrol 0.002
cd04683120 cd04683, Nudix_Hydrolase_24, Members of the Nudix hydro 0.002
PRK09438148 PRK09438, nudB, dihydroneopterin triphosphate pyrophosp 0.002
cd04694143 cd04694, Nudix_Hydrolase_35, Members of the Nudix hydro 0.003
cd03426157 cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a m 0.003
KOG3041225 KOG3041, KOG3041, KOG3041, Nucleoside diphosphate-sugar 0.003
TIGR02705156 TIGR02705, nudix_YtkD, nucleoside triphosphatase YtkD 6e-04
PRK11762185 PRK11762, nudE, adenosine nucleotide hydrolase NudE; Pr 0.004
>gnl|CDD|179094 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>gnl|CDD|144032 pfam00293, NUDIX, NUDIX domain Back     alignment and domain information
>gnl|CDD|30840 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>gnl|CDD|72880 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72906 cd04670, Nudix_Hydrolase_12, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72894 cd03674, Nudix_Hydrolase_1, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72901 cd04664, Nudix_Hydrolase_7, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72891 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|72882 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>gnl|CDD|31251 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|72904 cd04667, Nudix_Hydrolase_10, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|35867 KOG0648, KOG0648, KOG0648, Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|72919 cd04684, Nudix_Hydrolase_25, Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>gnl|CDD|72913 cd04678, Nudix_Hydrolase_19, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72911 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72883 cd03425, MutT_pyrophosphohydrolase, The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>gnl|CDD|72915 cd04680, Nudix_Hydrolase_21, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72912 cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72886 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|72920 cd04685, Nudix_Hydrolase_26, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72909 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72905 cd04669, Nudix_Hydrolase_11, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72917 cd04682, Nudix_Hydrolase_23, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72916 cd04681, Nudix_Hydrolase_22, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72892 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>gnl|CDD|72893 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|72934 cd04700, DR1025_like, DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>gnl|CDD|72899 cd04662, Nudix_Hydrolase_5, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|38050 KOG2839, KOG2839, KOG2839, Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|180046 PRK05379, PRK05379, bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|182721 PRK10776, PRK10776, nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|72933 cd04699, Nudix_Hydrolase_39, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|181607 PRK08999, PRK08999, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|72903 cd04666, Nudix_Hydrolase_9, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|33876 COG4119, COG4119, Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>gnl|CDD|72925 cd04690, Nudix_Hydrolase_31, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72885 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|72921 cd04686, Nudix_Hydrolase_27, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72902 cd04665, Nudix_Hydrolase_8, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72918 cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|181858 PRK09438, nudB, dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|72929 cd04694, Nudix_Hydrolase_35, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72884 cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>gnl|CDD|38251 KOG3041, KOG3041, KOG3041, Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|131752 TIGR02705, nudix_YtkD, nucleoside triphosphatase YtkD Back     alignment and domain information
>gnl|CDD|183303 PRK11762, nudE, adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 160 dinucleoside polyphosphate hydrolase [Candidatus Liberi
PRK00714156 dinucleoside polyphosphate hydrolase; Reviewed 100.0
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (A 100.0
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase super 99.94
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase super 99.93
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase super 99.93
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase super 99.92
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase super 99.92
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase super 99.92
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase super 99.92
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose m 99.91
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase super 99.91
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase super 99.91
PRK09438148 ntpA dATP pyrophosphohydrolase; Provisional 99.9
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase super 99.9
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a memb 99.89
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase super 99.89
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase 99.89
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Provision 99.89
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase super 99.89
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase super 99.89
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of the 99.88
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrola 99.88
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase super 99.88
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase super 99.88
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase superf 99.88
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohy 99.88
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase super 99.88
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase superf 99.87
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase super 99.87
pfam00293133 NUDIX NUDIX domain. 99.87
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (A 99.86
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase superf 99.86
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase super 99.86
PRK08999 312 hypothetical protein; Provisional 99.86
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase super 99.85
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily of enz 99.85
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase super 99.85
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hyd 99.84
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase super 99.84
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase super 99.83
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of the N 99.83
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase super 99.83
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase super 99.82
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase super 99.81
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase super 99.8
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase super 99.79
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic su 99.78
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, 99.77
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport and me 99.76
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a member of 99.75
PRK05379340 bifunctional nicotinamide mononucleotide adenylyltransf 99.72
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase super 99.71
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provisional 99.68
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase super 99.65
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) cata 99.63
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member of t 99.61
PRK11762185 nudE ADP-ribose diphosphatase NudE; Provisional 99.56
COG0494161 MutT NTP pyrophosphohydrolases including oxidative dama 99.51
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase superf 99.5
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 99.48
PRK10707190 hypothetical protein; Provisional 99.47
PRK00241257 nudC NADH pyrophosphatase; Reviewed 99.45
KOG2839145 consensus 99.44
KOG0648295 consensus 99.4
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, 99.4
KOG3084345 consensus 99.35
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase superf 99.23
COG1443185 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] 99.1
KOG3041225 consensus 99.06
KOG3069246 consensus 99.05
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and 98.78
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) i 98.61
KOG0142225 consensus 98.44
TIGR02150190 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, typ 98.28
KOG2937 348 consensus 98.13
PRK10880350 adenine DNA glycosylase; Provisional 97.84
TIGR00052199 TIGR00052 conserved hypothetical protein TIGR00052; Int 97.45
KOG4313306 consensus 97.32
KOG4548263 consensus 97.27
COG4112203 Predicted phosphoesterase (MutT family) [General functi 96.7
TIGR00586150 mutt mutator mutT protein; InterPro: IPR003561 MutT is 99.7
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase superf 99.46
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase superf 99.38
TIGR02705158 nudix_YtkD nucleoside triphosphatase YtkD; InterPro: IP 99.28
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) cata 98.53
KOG4195275 consensus 97.93
KOG1689221 consensus 94.86
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase superf 99.4
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replication, re 98.94
PRK13910290 DNA glycosylase MutY; Provisional 96.74
COG1194342 MutY A/G-specific DNA glycosylase [DNA replication, rec 91.21
>PRK00714 dinucleoside polyphosphate hydrolase; Reviewed Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK09438 ntpA dATP pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>pfam00293 NUDIX NUDIX domain Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>PRK11762 nudE ADP-ribose diphosphatase NudE; Provisional Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>PRK10707 hypothetical protein; Provisional Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>KOG2839 consensus Back     alignment and domain information
>KOG0648 consensus Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3084 consensus Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>KOG3041 consensus Back     alignment and domain information
>KOG3069 consensus Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>KOG0142 consensus Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1; InterPro: IPR011876 This entry represents type 1 of two non-homologous families of the enzyme isopentenyl-diphosphate delta-isomerase (IPP isomerase) Back     alignment and domain information
>KOG2937 consensus Back     alignment and domain information
>PRK10880 adenine DNA glycosylase; Provisional Back     alignment and domain information
>TIGR00052 TIGR00052 conserved hypothetical protein TIGR00052; InterPro: IPR004385 This entry describes a family of proteins which appear to catalyse the hydrolysis of phosphorus-containing acid anhydrides such as nucleoside diphosphate, for example ADP-mannose and UDP-glucose Back     alignment and domain information
>KOG4313 consensus Back     alignment and domain information
>KOG4548 consensus Back     alignment and domain information
>COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein; InterPro: IPR003561 MutT is a small bacterial protein (~12-15kDa) involved in the GO system responsible for removing an oxidatively damaged form of guanine (8-hydroxy- guanine or 7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD; InterPro: IPR014078 The proteins in this entry belong to the nudix family and share some sequence identity with Escherichia coli MutT but appear not to be functionally interchangeable with it Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>KOG4195 consensus Back     alignment and domain information
>KOG1689 consensus Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>PRK13910 DNA glycosylase MutY; Provisional Back     alignment and domain information
>COG1194 MutY A/G-specific DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target160 dinucleoside polyphosphate hydrolase [Candidatus Liberi
2kdv_A164 Solution Structure Of Rna Pyrophosphohydrolase Rpph 5e-32
2kdw_A164 Solution Structure Of Rpph Mutant E53a From Escheri 1e-31
1f3y_A165 Solution Structure Of The Nudix Enzyme Diadenosine 3e-30
3oga_A165 1.75 Angstrom Resolution Crystal Structure Of A Put 4e-08
2i8t_A167 Gdp-Mannose Mannosyl Hydrolase-Calcium-Gdp-Mannose 1e-07
3grn_A153 Crystal Structure Of Mutt Protein From Methanosarci 2e-07
1rya_A160 Crystal Structure Of The E. Coli Gdp-Mannose Mannos 3e-07
2gt4_A160 Crystal Structure Of The Y103f Mutant Of The Gdp-Ma 4e-07
3n77_A144 Crystal Structure Of Idp01880, Putative Ntp Pyropho 9e-07
3dku_A153 Crystal Structure Of Nudix Hydrolase Orf153, Ymfb, 8e-05
3h95_A199 Crystal Structure Of The Nudix Domain Of Nudt6 Leng 1e-04
2pbt_B134 Crystal Structure Of Ap4a Hydrolase (Aq_158) From A 1e-04
2qjt_B352 Crystal Structure Of A Bifunctional Nmn Adenylyltra 3e-04
3gz5_A240 Crystal Structure Of Shewanella Oneidensis Nrtr Len 8e-04
3gz8_A162 Cocrystal Structure Of Nudix Domain Of Shewanella O 0.001
3fk9_A188 Crystal Structure Of Mmutator Mutt Protein From Bac 0.002
1kt9_A138 Crystal Structure Of C. Elegans Ap4a Hydrolase Leng 0.002
1q54_A183 Structure And Mechanism Of Action Of Isopentenylpyr 0.004
1hx3_A190 Crystal Structure Of E.Coli Isopentenyl Diphosphate 0.004
1i9a_A182 Structural Studies Of Cholesterol Biosynthesis: Mev 0.004
3hhj_A158 Crystal Structure Of Mutator Mutt From Bartonella H 4e-10
1vc8_A126 Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydr 6e-05
3gwy_A140 Crystal Structure Of Putative Ctp Pyrophosphohydrol 9e-05
1vc9_A126 Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydr 2e-04
3r03_A144 The Crystal Structure Of Nudix Hydrolase From Rhodo 4e-09
3ees_A153 Structure Of The Rna Pyrophosphohydrolase Bdrpph Le 3e-06
1sjy_A159 Crystal Structure Of Nudix Hydrolase Dr1025 From De 4e-06
3eds_A153 Crystal Structure Of A MutNUDIX FAMILY PROTEIN FROM 2e-05
1ppx_A129 Solution Structure Of The Mutt Pyrophosphohydrolase 4e-05
3gg6_A156 Crystal Structure Of The Nudix Domain Of Human Nudt 3e-04
2yvm_A182 Crystal Structure Of Ndx2 In Complex With Mg2+ From 0.001
>gi|284793767|pdb|2KDV|A Chain A, Solution Structure Of Rna Pyrophosphohydrolase Rpph From Escherichia Coli Length = 164 Back     alignment and structure
 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 58/160 (36%), Positives = 83/160 (51%), Gaps = 14/160 (8%)

Query: 2   YRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI 61
           YR  VGI+I N+   V   RR    +      WQ PQGGINP E    A YREL+EE G+
Sbjct: 7   YRPNVGIVICNRQGQVMWARRFGQHS------WQFPQGGINPGESAEQAMYRELFEEVGL 60

Query: 62  --KSISLLGQGDSYIQYDFPAH---CIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGY 116
             K + +L    ++++Y  P        +   +GQ QKWF  +     +EI +  ++   
Sbjct: 61  SRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSST-- 118

Query: 117 ESEFDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKS 156
             EFD W WVS W     VV FK++ YR+V+ +FA ++ S
Sbjct: 119 -PEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMS 157


>gi|284793768|pdb|2KDW|A Chain A, Solution Structure Of Rpph Mutant E53a From Escherichia Coli Length = 164 Back     alignment and structure
>gi|159162286|pdb|1F3Y|A Chain A, Solution Structure Of The Nudix Enzyme Diadenosine Tetraphosphate Hydrolase From Lupinus Angustifolius L. Length = 165 Back     alignment and structure
>gi|308198656|pdb|3OGA|A Chain A, 1.75 Angstrom Resolution Crystal Structure Of A Putative Ntp Pyrophosphohydrolase (Yfao) From Salmonella Typhimurium Lt2 Length = 165 Back     alignment and structure
>gi|150261293|pdb|2I8T|A Chain A, Gdp-Mannose Mannosyl Hydrolase-Calcium-Gdp-Mannose Complex Length = 167 Back     alignment and structure
>gi|226438383|pdb|3GRN|A Chain A, Crystal Structure Of Mutt Protein From Methanosarcina Mazei Go1 Length = 153 Back     alignment and structure
>gi|50513417|pdb|1RYA|A Chain A, Crystal Structure Of The E. Coli Gdp-Mannose Mannosyl Hydrolase In Complex With Gdp And Mg Length = 160 Back     alignment and structure
>gi|122920347|pdb|2GT4|A Chain A, Crystal Structure Of The Y103f Mutant Of The Gdp-Mannose Mannosyl Hydrolase In Complex With Gdp-Mannose And Mg+2 Length = 160 Back     alignment and structure
>gi|303325082|pdb|3N77|A Chain A, Crystal Structure Of Idp01880, Putative Ntp Pyrophosphohydrolase Of Salmonella Typhimurium Lt2 Length = 144 Back     alignment and structure
gi|242556351|pdb|3DKU|A Chain A, Crystal Structure Of Nudix Hydrolase Orf153, Ymfb, From Escherichia Coli K-1 Length = 153 Back     alignment and structure
>gi|251836976|pdb|3H95|A Chain A, Crystal Structure Of The Nudix Domain Of Nudt6 Length = 199 Back     alignment and structure
>gi|169404580|pdb|2QJT|B Chain B, Crystal Structure Of A Bifunctional Nmn AdenylyltransferaseADP RIBOSE PYROPHOSPHATASE COMPLEXED With Amp And Mn Ion From Francisella Tularensis Length = 352 Back     alignment and structure
>gi|239782033|pdb|3GZ5|A Chain A, Crystal Structure Of Shewanella Oneidensis Nrtr Length = 240 Back     alignment and structure
>gi|239782039|pdb|3GZ8|A Chain A, Cocrystal Structure Of Nudix Domain Of Shewanella Oneidensis Nrtr Complexed With Adp Ribose Length = 162 Back     alignment and structure
>gi|220702553|pdb|3FK9|A Chain A, Crystal Structure Of Mmutator Mutt Protein From Bacillus Halodurans Length = 188 Back     alignment and structure
gi|21465912|pdb|1KT9|A Chain A, Crystal Structure Of C. Elegans Ap4a Hydrolase Length = 138 Back     alignment and structure
>gi|34810373|pdb|1Q54|A Chain A, Structure And Mechanism Of Action Of Isopentenylpyrophosphate-Dimethylallylpyrophosphate Isomerase: Complex With The Bromohydrine Of Ipp Length = 183 Back     alignment and structure
>gi|15826360|pdb|1HX3|A Chain A, Crystal Structure Of E.Coli Isopentenyl Diphosphate:dimethylallyl Diphosphate Isomerase Length = 190 Back     alignment and structure
>gi|13786885|pdb|1I9A|A Chain A, Structural Studies Of Cholesterol Biosynthesis: Mevalonate 5-Diphosphate Decarboxylase And Isopentenyl Diphosphate Isomerase Length = 182 Back     alignment and structure
>gi|238538034|pdb|3HHJ|A Chain A, Crystal Structure Of Mutator Mutt From Bartonella Henselae Length = 158 Back     alignment and structure
gi|66360267|pdb|1VC8|A Chain A, Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydrolase Ndx1-Ap6a Complex Length = 126 Back     alignment and structure
>gi|226887984|pdb|3GWY|A Chain A, Crystal Structure Of Putative Ctp Pyrophosphohydrolase From Bacteroides Fragilis Length = 140 Back     alignment and structure
>gi|66360269|pdb|1VC9|A Chain A, Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydrolase E50q Mutant-Mg2+-Atp Complex Length = 126 Back     alignment and structure
>gi|332639860|pdb|3R03|A Chain A, The Crystal Structure Of Nudix Hydrolase From Rhodospirillum Rubrum Length = 144 Back     alignment and structure
gi|225734088|pdb|3EES|A Chain A, Structure Of The Rna Pyrophosphohydrolase Bdrpph Length = 153 Back     alignment and structure
gi|49259036|pdb|1SJY|A Chain A, Crystal Structure Of Nudix Hydrolase Dr1025 From Deinococcus Radiodurans Length = 159 Back     alignment and structure
>gi|206582106|pdb|3EDS|A Chain A, Crystal Structure Of A MutNUDIX FAMILY PROTEIN FROM Bacillus Thuringiensis Length = 153 Back     alignment and structure
gi|34810351|pdb|1PPX|A Chain A, Solution Structure Of The Mutt Pyrophosphohydrolase Complexed With Mg(2+) And 8-Oxo-Dgmp, A Tightly-Bound Product Length = 129 Back     alignment and structure
>gi|224983726|pdb|3GG6|A Chain A, Crystal Structure Of The Nudix Domain Of Human Nudt18 Length = 156 Back     alignment and structure
gi|168988840|pdb|2YVM|A Chain A, Crystal Structure Of Ndx2 In Complex With Mg2+ From Thermus Thermophilus Hb8 Length = 182 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target160 dinucleoside polyphosphate hydrolase [Candidatus Liberi
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, mang 8e-29
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enz 5e-27
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NUDT6, 6e-14
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure initia 5e-13
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enterica sub 3e-12
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta-alpha 2e-11
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydr 3e-11
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, protein s 6e-11
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two indivi 3e-10
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyro 3e-09
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrolase; t 3e-09
3fcm_A197 Hydrolase, nudix family; protein structure initiative I 5e-09
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nud 6e-09
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mR 2e-08
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, 2e-08
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polyphosphat 2e-08
1q27_A171 Putative nudix hydrolase DR0079; radiation resistance; 2e-08
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethylallyl, 3e-08
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP6A, h 4e-08
3dku_A153 Putative phosphohydrolase; nudix hydrolase, ORF153, YMF 6e-08
3f13_A163 Putative nudix hydrolase family member; structural geno 8e-08
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcus fae 1e-07
1xsa_A153 BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human 1e-07
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, magne 1e-07
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein stru 1e-07
3f6a_A159 Hydrolase, nudix family; protein structure initiative I 2e-07
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold 2e-07
3fk9_A188 Mutator MUTT protein; structural genomics, hydrolase, P 4e-07
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1; nud 5e-07
3i9x_A187 MUTT/nudix family protein; structural genomics, hydrola 1e-06
3e57_A211 Uncharacterized protein TM1382; structural genomics, nu 1e-06
3id9_A171 MUTT/nudix family protein; hydrolase, protein structure 1e-06
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, adenosi 2e-06
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moiety X 2e-06
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; structural 2e-06
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, MAD, s 5e-06
3dup_A300 MUTT/nudix family protein; nudix superfamily hydrolase, 7e-06
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/beta p 2e-05
3grn_A153 MUTT related protein; structural genomics, hydrolase, P 2e-05
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family protein 9e-05
2pqv_A154 MUTT/nudix family protein; structural genomics, PSI-2, 1e-04
3gwy_A140 Putative CTP pyrophosphohydrolase; structural genomics, 2e-04
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, 2e-04
3exq_A161 Nudix family hydrolase; protein structure initiative II 3e-04
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribo 7e-04
2fml_A273 MUTT/nudix family protein; structural genomics, PSI, pr 0.001
2fb1_A226 Conserved hypothetical protein; structural genomics, PS 0.003
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergenic re 3e-07
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA 4e-07
1iry_A156 HMTH1; nudix motif(G37-L59), hydrolase; NMR {Homo sapie 1e-06
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphatase, 1e-05
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydrolase 1e-04
2b06_A155 MUTT/nudix family protein; structural genomics, PSI, pr 1e-04
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, ADP-rib 3e-04
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, 7e-04
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D.radi 0.002
3cou_A217 Nudix motif 16, nucleoside diphosphate-linked moiety X 0.004
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-helix-loo 0.004
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Length = 164 Back     alignment and structure
 Score =  121 bits (304), Expect = 8e-29
 Identities = 56/160 (35%), Positives = 81/160 (50%), Gaps = 14/160 (8%)

Query: 2   YRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI 61
           YR  VGI+I N+   V   RR     +     WQ PQGGINP E    A YREL+EE G+
Sbjct: 7   YRPNVGIVICNRQGQVMWARR--FGQHS----WQFPQGGINPGESAEQAMYRELFEEVGL 60

Query: 62  KSISLLGQGDSY--IQYDFPAHCIQEN---GYVGQMQKWFAFRFQGLTSEICVDRTAYGY 116
               +     +   ++Y  P   ++ +     +GQ QKWF  +     +EI +  ++   
Sbjct: 61  SRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSS--- 117

Query: 117 ESEFDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKS 156
             EFD W WVS W     VV FK++ YR+V+ +FA ++ S
Sbjct: 118 TPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMS 157


>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Length = 165 Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural genomics, structural genomics consortium; HET: FLC; 1.70A {Homo sapiens} Length = 199 Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II(PSI II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis ATCC15703} Length = 364 Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Length = 165 Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271 Back     alignment and structure
>3eds_A MUTT/nudix family protein; MUT/nudix protein, protein structure initiative II(PSI II), nysgxrc; 1.76A {Bacillus thuringiensis str} Length = 153 Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Length = 352 Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneopterin triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Length = 150 Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrolase; two individual domains; HET: APR NAD; 2.60A {Synechocystis SP} Length = 341 Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Length = 197 Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160 Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146 Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative nudix hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Length = 156 Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Length = 171 Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Length = 190 Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, hydrolase, riken structural genomics/proteomics initiative, RSGI; 1.70A {Thermus thermophilus HB8} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 Back     alignment and structure
>3dku_A Putative phosphohydrolase; nudix hydrolase, ORF153, YMFB, nucleoside triphosphatase; 2.69A {Escherichia coli apec O1} Length = 153 Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Length = 163 Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, protein structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis V583} SCOP: d.113.1.1 Length = 148 Back     alignment and structure
>1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, unknown function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Length = 159 Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Length = 292 Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Length = 188 Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A Length = 194 Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.20A {Listeria innocua} Length = 187 Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Length = 211 Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171 Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine diphospho-ribose, RV1700; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Length = 207 Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 2.27A {Streptococcus suis} Length = 206 Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, PSI, protein structure initiative; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Length = 180 Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural genomics, protein structure initiative; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Length = 300 Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Length = 235 Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.70A {Methanosarcina mazei} Length = 153 Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA; 1.80A {Aquifex aeolicus VF5} Length = 139 Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.63A {Streptococcus pneumoniae TIGR4} Length = 154 Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 140 Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrolase, structural genomics; 2.10A {Bartonella henselae str} Length = 158 Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Length = 161 Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A Length = 212 Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Length = 273 Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein structure initiative; 2.50A {Bacteroides thetaiotaomicron vpi-5482} SCOP: a.4.5.68 d.113.1.6 Length = 226 Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Length = 209 Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Length = 129 Back     alignment and structure
>1iry_A HMTH1; nudix motif(G37-L59), hydrolase; NMR {Homo sapiens} SCOP: d.113.1.1 Length = 156 Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Length = 145 Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Length = 212 Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Length = 155 Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrolase, structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus HB8} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182 Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A Length = 217 Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Length = 194 Back     alignment and structure
>3cou_A Nudix motif 16, nucleoside diphosphate-linked moiety X motif 16; hydrolase, NUDT16, mRNA decapping, mRNA turnover, structural genomics consortium; 1.80A {Homo sapiens} Length = 217 Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Length = 170 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target160 dinucleoside polyphosphate hydrolase [Candidatus Liberi
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enz 100.0
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, mang 100.0
3grn_A153 MUTT related protein; structural genomics, hydrolase, P 99.91