254780561

254780561

thiamine transporter substrate binding subunit

GeneID in NCBI database:8209558Locus tag:CLIBASIA_02240
Protein GI in NCBI database:254780561Protein Accession:YP_003064974.1
Gene range:+(718560, 719576)Protein Length:338aa
Gene description:thiamine transporter substrate binding subunit
COG prediction:[H] ABC-type thiamine transport system, periplasmic component
KEGG prediction:tbpA; thiamine transporter substrate binding subunit; K02064 thiamine transport system substrate-binding protein
SEED prediction:Thiamin ABC transporter, substrate-binding component
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:Thiamin biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSRL
ccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHccccccccEEEEccHHHHHHHHHcccccccccccHHcccccccccccEEEEEEEEEEEEEEHHHcccccccHHHHHccccccEEEEEcccccHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccHHHHHHHHcccccEEEEEccHHHHHHHHcccccEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHccHHHHHHHHHcccccccccccccccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHccccccccEEEEcccHHHHHHHHcccccccccccHccccccccccccEEEEEcEEEEEEEccHHcccccccHHHHccccccccEEEcccccccHHHHHHHHHHHHHccHHHHHHHHHHHccEEEcccccHHHHHHHcccccEEEEEcccHHHHHHHHcccccEEEcccccccEEEEEHHHHcccccHHHHHHHHHHHHcHHHHHHcccccEEEEcccccccccccccccccHcccccHHHHHHHHHHHHHHHHHHHHcc
MKKFARIVVGIMMITGVISYctldglpakpvltvytynsfvadegagpkiKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTglfaksnidasqlklpikwdddifvpydyGYLAFIydkrqitqppknfdelinstkpwkiiyqdprtstlgLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFvlsystspgfyllnygqddYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMispsfqrilpttnwmypvvdismpdvyqairipqkslrfnaEETTRYRNQWISSWQNAVSRL
MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAksnidasqlklpikwdddIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKtatvtkgwTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRyrnqwisswqnavsrl
MKKFARivvgimmitgviSYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWkkiatktatvtkGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSRL
****ARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSRL
MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSRL
MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSRL
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSRL
MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSRL
MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSRL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target338 thiamine transporter substrate binding subunit [Candida
315121755333 thiamine transporter substrate binding subunit [Candida 1 1e-140
37524620337 thiamine transporter substrate binding subunit [Photorh 1 1e-128
197286168337 thiamine ABC transporter substrate-binding protein [Pro 1 1e-126
290476664337 thiamin ABC transporter periplasmic binding protein [Xe 1 1e-126
300724841337 thiamin ABC transporter periplasmic-binding protein [Xe 1 1e-126
253988059337 thiamine transporter substrate binding subunit [Photorh 1 1e-126
183597811334 hypothetical protein PROSTU_01140 [Providencia stuartii 1 1e-122
212711207341 hypothetical protein PROVALCAL_02279 [Providencia alcal 1 1e-121
268590568334 thiamin/thiamine pyrophosphate ABC transporter [Provide 1 1e-120
282599934341 hypothetical protein PROVRUST_06035 [Providencia rustig 1 1e-118
>gi|315121755|ref|YP_004062244.1| thiamine transporter substrate binding subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 333 Back     alignment and organism information
 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 237/317 (74%), Positives = 281/317 (88%)

Query: 21  CTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRME 80
           C    + AKP+LTVYTY SFV+D GAGPKIK +FE+ CNCEL++IGL+DGVALLN+L+ME
Sbjct: 16  CLTLNIQAKPILTVYTYGSFVSDWGAGPKIKSSFEQVCNCELRIIGLNDGVALLNRLKME 75

Query: 81  GENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD 140
           G NS ADIVLG DNNLIDLA+KTGLF +S+ID S LKLP++W ++IF+PYDYGY +FIYD
Sbjct: 76  GGNSPADIVLGLDNNLIDLAKKTGLFTESHIDTSLLKLPMEWKNNIFIPYDYGYFSFIYD 135

Query: 141 KRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKT 200
           KR+ITQ PK+FDELINST+PW IIYQDPRTSTLGLGLLLWIQK+YG+ SAQ+W++IA +T
Sbjct: 136 KRRITQAPKSFDELINSTQPWTIIYQDPRTSTLGLGLLLWIQKVYGEKSAQIWREIAKRT 195

Query: 201 ATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQL 260
            T+TKGW ESYG FLKGESDFVLSYS+SPGF LLNYGQD+Y AALFSEGHYLQIEVAAQL
Sbjct: 196 VTITKGWGESYGLFLKGESDFVLSYSSSPGFQLLNYGQDNYAAALFSEGHYLQIEVAAQL 255

Query: 261 VRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEET 320
             SKQP+LAQEFMQFMISP+FQ+ILP TNWMYPV+D+S+P VYQ I +PQKSL+F+AE+ 
Sbjct: 256 KSSKQPKLAQEFMQFMISPTFQKILPITNWMYPVIDMSLPTVYQKILVPQKSLQFHAEDI 315

Query: 321 TRYRNQWISSWQNAVSR 337
           T++RNQWI  WQ+AVS 
Sbjct: 316 TQHRNQWIHLWQDAVSH 332


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|37524620|ref|NP_927964.1| thiamine transporter substrate binding subunit [Photorhabdus luminescens subsp. laumondii TTO1] Length = 337 Back     alignment and organism information
>gi|197286168|ref|YP_002152040.1| thiamine ABC transporter substrate-binding protein [Proteus mirabilis HI4320] Length = 337 Back     alignment and organism information
>gi|290476664|ref|YP_003469569.1| thiamin ABC transporter periplasmic binding protein [Xenorhabdus bovienii SS-2004] Length = 337 Back     alignment and organism information
>gi|300724841|ref|YP_003714166.1| thiamin ABC transporter periplasmic-binding protein [Xenorhabdus nematophila ATCC 19061] Length = 337 Back     alignment and organism information
>gi|253988059|ref|YP_003039415.1| thiamine transporter substrate binding subunit [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949] Length = 337 Back     alignment and organism information
>gi|183597811|ref|ZP_02959304.1| hypothetical protein PROSTU_01140 [Providencia stuartii ATCC 25827] Length = 334 Back     alignment and organism information
>gi|212711207|ref|ZP_03319335.1| hypothetical protein PROVALCAL_02279 [Providencia alcalifaciens DSM 30120] Length = 341 Back     alignment and organism information
>gi|268590568|ref|ZP_06124789.1| thiamin/thiamine pyrophosphate ABC transporter [Providencia rettgeri DSM 1131] Length = 334 Back     alignment and organism information
>gi|282599934|ref|ZP_05972415.2| hypothetical protein PROVRUST_06035 [Providencia rustigianii DSM 4541] Length = 341 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target338 thiamine transporter substrate binding subunit [Candida
PRK11205330 PRK11205, tbpA, thiamine transporter substrate binding 1e-150
TIGR01276309 TIGR01276, thiB, thiamine ABC transporter, periplasmic 1e-120
TIGR01254304 TIGR01254, sfuA, ABC transporter periplasmic binding pr 1e-105
COG1840299 COG1840, AfuA, ABC-type Fe3+ transport system, periplas 5e-15
COG0687363 COG0687, PotD, Spermidine/putrescine-binding periplasmi 1e-11
COG4143336 COG4143, TbpA, ABC-type thiamine transport system, peri 1e-106
TIGR03227367 TIGR03227, PhnS, 2-aminoethylphosphonate ABC transporte 2e-05
PRK15046349 PRK15046, PRK15046, 2-aminoethylphosphonate ABC transpo 1e-04
COG1653433 COG1653, UgpB, ABC-type sugar transport system, peripla 3e-05
pfam01547260 pfam01547, SBP_bac_1, Bacterial extracellular solute-bi 7e-05
COG4134384 COG4134, COG4134, ABC-type uncharacterized transport sy 5e-04
>gnl|CDD|183039 PRK11205, tbpA, thiamine transporter substrate binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130343 TIGR01276, thiB, thiamine ABC transporter, periplasmic binding protein Back     alignment and domain information
>gnl|CDD|130321 TIGR01254, sfuA, ABC transporter periplasmic binding protein, thiB subfamily Back     alignment and domain information
>gnl|CDD|32025 COG1840, AfuA, ABC-type Fe3+ transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31031 COG0687, PotD, Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33896 COG4143, TbpA, ABC-type thiamine transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|132271 TIGR03227, PhnS, 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate binding protein Back     alignment and domain information
>gnl|CDD|185006 PRK15046, PRK15046, 2-aminoethylphosphonate ABC transporter substrate-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|31839 COG1653, UgpB, ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|144951 pfam01547, SBP_bac_1, Bacterial extracellular solute-binding protein Back     alignment and domain information
>gnl|CDD|33890 COG4134, COG4134, ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 338 thiamine transporter substrate binding subunit [Candida
PRK11205326 tbpA thiamine transporter substrate binding subunit; Pr 100.0
COG4143336 TbpA ABC-type thiamine transport system, periplasmic co 100.0
TIGR03227367 PhnS 2-aminoethylphosphonate ABC transporter, periplasm 100.0
TIGR03261334 phnS2 putative 2-aminoethylphosphonate ABC transport sy 100.0
TIGR01254324 sfuA ABC transporter periplasmic binding protein, thiB 100.0
TIGR01276326 thiB thiamin/thiamin pyrophosphate ABC transporter, thi 100.0
PRK10752329 sulfate transporter subunit; Provisional 99.88
PRK10852338 thiosulfate transporter subunit; Provisional 99.86
COG4134384 ABC-type uncharacterized transport system, periplasmic 99.86
COG1613348 Sbp ABC-type sulfate transport system, periplasmic comp 99.84
PRK09501348 potD spermidine/putrescine ABC transporter periplasmic 100.0
PRK10682370 putrescine transporter subunit: periplasmic-binding com 100.0
COG0687363 PotD Spermidine/putrescine-binding periplasmic protein 100.0
PRK11622401 putative ABC transporter solute-binding protein; Provis 99.97
PRK09474394 malE maltose ABC transporter periplasmic protein; Revie 99.96
COG2182420 MalE Maltose-binding periplasmic proteins/domains [Carb 99.88
COG0725258 ModA ABC-type molybdate transport system, periplasmic c 99.87
PRK10974439 glycerol-3-phosphate transporter periplasmic binding pr 99.87
PRK10677257 modA molybdate transporter periplasmic protein; Provisi 99.86
PRK04168336 hypothetical protein; Provisional 99.85
COG1653433 UgpB ABC-type sugar transport system, periplasmic compo 99.82
COG4588252 AcfC Accessory colonization factor AcfC, contains ABC-t 99.49
COG4150341 CysP ABC-type sulfate transport system, periplasmic com 99.41
COG2998280 TupB ABC-type tungstate transport system, permease comp 99.33
PRK09861272 cytoplasmic membrane lipoprotein-28; Provisional 98.82
COG3221299 PhnD ABC-type phosphate/phosphonate transport system, p 98.77
PRK11063271 metQ DL-methionine transporter substrate-binding subuni 98.76
TIGR01098299 3A0109s03R phosphonate ABC transporter, periplasmic pho 98.46
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phosphona 98.46
PRK11260264 cystine transporter subunit; Provisional 98.12
PRK10797302 glutamate and aspartate transporter subunit; Provisiona 97.96
PRK11553314 alkanesulfonate transporter substrate-binding subunit; 97.89
COG1464268 NlpA ABC-type metal ion transport system, periplasmic c 97.8
PRK11480320 tauA taurine transporter substrate binding subunit; Pro 97.58
pfam02030493 Lipoprotein_8 Hypothetical lipoprotein (MG045 family). 97.09
COG1840299 AfuA ABC-type Fe3+ transport system, periplasmic compon 100.0
pfam03401274 Bug Tripartite tricarboxylate transporter family recept 95.28
pfam01547260 SBP_bac_1 Bacterial extracellular solute-binding protei 99.71
TIGR01256225 modA molybdate ABC transporter, periplasmic molybdate-b 99.58
TIGR00971320 3a0106s03 sulfate ABC transporter, sulfate-binding prot 99.39
COG0226318 PstS ABC-type phosphate transport system, periplasmic c 98.48
PRK10859 507 putative transglycosylase; Provisional 97.66
COG3181319 Uncharacterized protein conserved in bacteria [Function 96.5
pfam04069256 OpuAC Substrate binding domain of ABC-type glycine beta 95.55
pfam09084216 NMT1 NMT1/THI5 like. This family contains the NMT1 and 94.56
COG0715335 TauA ABC-type nitrate/sulfonate/bicarbonate transport s 93.3
TIGR03414290 ABC_choline_bnd choline ABC transporter, periplasmic bi 92.0
PRK03537188 hypothetical protein; Provisional 98.88
PRK09495247 glnH glutamine ABC transporter periplasmic protein; Rev 98.18
COG1732300 OpuBC Periplasmic glycine betaine/choline-binding (lipo 97.2
PRK10918346 phosphate transporter subunit; Provisional 96.9
COG2113302 ProX ABC-type proline/glycine betaine transport systems 96.23
PRK09701311 D-allose transporter subunit; Provisional 95.96
PRK01326310 prsA foldase protein PrsA; Reviewed 91.27
PRK10653295 D-ribose transporter subunit RbsB; Provisional 90.65
PRK11119332 proX glycine betaine transporter periplasmic subunit; P 93.31
PRK06760223 hypothetical protein; Provisional 92.06
PRK12450309 foldase protein PrsA; Reviewed 92.0
PRK03002285 prsA peptidylprolyl isomerase; Reviewed 90.12
>PRK11205 tbpA thiamine transporter substrate binding subunit; Provisional Back     alignment and domain information
>COG4143 TbpA ABC-type thiamine transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>TIGR03227 PhnS 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate binding protein Back     alignment and domain information
>TIGR03261 phnS2 putative 2-aminoethylphosphonate ABC transport system, 1-aminoethylphosphonate-binding protein component Back     alignment and domain information
>TIGR01254 sfuA ABC transporter periplasmic binding protein, thiB subfamily; InterPro: IPR005948 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>TIGR01276 thiB thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin pyrophospate-binding protein; InterPro: IPR005967 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK10752 sulfate transporter subunit; Provisional Back     alignment and domain information
>PRK10852 thiosulfate transporter subunit; Provisional Back     alignment and domain information
>COG4134 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>COG1613 Sbp ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed Back     alignment and domain information
>PRK10682 putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional Back     alignment and domain information
>COG0687 PotD Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11622 putative ABC transporter solute-binding protein; Provisional Back     alignment and domain information
>PRK09474 malE maltose ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>COG2182 MalE Maltose-binding periplasmic proteins/domains [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0725 ModA ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10974 glycerol-3-phosphate transporter periplasmic binding protein; Provisional Back     alignment and domain information
>PRK10677 modA molybdate transporter periplasmic protein; Provisional Back     alignment and domain information
>PRK04168 hypothetical protein; Provisional Back     alignment and domain information
>COG1653 UgpB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4588 AcfC Accessory colonization factor AcfC, contains ABC-type periplasmic domain [General function prediction only] Back     alignment and domain information
>COG4150 CysP ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2998 TupB ABC-type tungstate transport system, permease component [Coenzyme metabolism] Back     alignment and domain information
>PRK09861 cytoplasmic membrane lipoprotein-28; Provisional Back     alignment and domain information
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11063 metQ DL-methionine transporter substrate-binding subunit; Provisional Back     alignment and domain information
>TIGR01098 3A0109s03R phosphonate ABC transporter, periplasmic phosphonate-binding protein; InterPro: IPR005770 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>COG1464 NlpA ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11480 tauA taurine transporter substrate binding subunit; Provisional Back     alignment and domain information
>pfam02030 Lipoprotein_8 Hypothetical lipoprotein (MG045 family) Back     alignment and domain information
>COG1840 AfuA ABC-type Fe3+ transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam03401 Bug Tripartite tricarboxylate transporter family receptor Back     alignment and domain information
>pfam01547 SBP_bac_1 Bacterial extracellular solute-binding protein Back     alignment and domain information
>TIGR01256 modA molybdate ABC transporter, periplasmic molybdate-binding protein; InterPro: IPR005950 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR00971 3a0106s03 sulfate ABC transporter, sulfate-binding protein; InterPro: IPR005669 Thiosulphate-binding proteins (gene cysP) specifically binds thiosulphate and are involved in the transport systems for this nutrients , Back     alignment and domain information
>COG0226 PstS ABC-type phosphate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10859 putative transglycosylase; Provisional Back     alignment and domain information
>COG3181 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system Back     alignment and domain information
>pfam09084 NMT1 NMT1/THI5 like Back     alignment and domain information
>COG0715 TauA ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03414 ABC_choline_bnd choline ABC transporter, periplasmic binding protein Back     alignment and domain information
>PRK03537 hypothetical protein; Provisional Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>COG1732 OpuBC Periplasmic glycine betaine/choline-binding (lipo)protein of an ABC-type transport system (osmoprotectant binding protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10918 phosphate transporter subunit; Provisional Back     alignment and domain information
>COG2113 ProX ABC-type proline/glycine betaine transport systems, periplasmic components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09701 D-allose transporter subunit; Provisional Back     alignment and domain information
>PRK01326 prsA foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>PRK11119 proX glycine betaine transporter periplasmic subunit; Provisional Back     alignment and domain information
>PRK06760 hypothetical protein; Provisional Back     alignment and domain information
>PRK12450 foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK03002 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target338 thiamine transporter substrate binding subunit [Candida
2qry_A330 Periplasmic Thiamin Binding Protein Length = 330 4e-57
2pt1_A334 Futa1 Synechocystis Pcc 6803 Length = 334 4e-35
1y4t_A322 Ferric Binding Protein From Campylobacter Jejuni Le 5e-34
1q35_A320 Crystal Structure Of Pasteurella Haemolytica Apo Fe 2e-33
2voz_A346 Apo Futa2 From Synechocystis Pcc6803 Length = 346 4e-31
1y9u_A323 Bordetella Ferric Binding Protein Length = 323 1e-28
1pot_A325 SpermidinePUTRESCINE-Binding Protein Complexed With 6e-24
1poy_1323 SpermidinePUTRESCINE-Binding Protein Complexed With 1e-23
1d9v_A309 Haemophilus Influenzae Ferric-Binding Protein Apo F 2e-22
2o68_A309 Crystal Structure Of Haemophilus Influenzae Q58l Mu 3e-22
2o6a_A309 Crystal Structure Of The Haemophilus Influenzae E57 3e-22
1nnf_A309 Crystal Structure Analysis Of Haemophlius Influenza 4e-22
1qw0_A309 Crystal Structure Of Haemophilus Influenzae N175l M 7e-22
2o69_A309 Crystal Structure Of Haemophilus Influenzae N193l M 7e-22
3kn8_A309 Crystal Structure Of Haemophilus Influenzae Y196a M 9e-22
1qvs_A309 Crystal Structure Of Haemophilus Influenzae H9a Mut 9e-22
1a99_A344 Putrescine Receptor (Potf) From E. Coli Length = 34 1e-21
3kn7_A309 Crystal Structure Of Haemophilus Influenzae Y195a M 1e-21
1o7t_A309 Metal Nanoclusters Bound To The Ferric Binding Prot 6e-20
1r1n_A309 Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding 6e-20
1d9y_A309 Neisseria Gonorrhoeae Ferric Binding Protein Length 1e-19
1xvy_A309 Crystal Structure Of Iron-Free Serratia Marcescens 2e-19
1xvx_A312 Crystal Structure Of Iron-Loaded Yersinia Enterocol 5e-19
3pu5_A333 The Crystal Structure Of A Putative Extracellular S 2e-16
3c9h_A355 Crystal Structure Of The Substrate Binding Protein 6e-13
3rpw_A365 The Crystal Structure Of An Abc Transporter From Rh 4e-12
1sbp_A310 1.7 Angstroms Refined Structure Of Sulfate-Binding 3e-08
2v84_A343 Crystal Structure Of The Tp0655 (Tppotd) Lipoprotei 3e-13
3jyr_A396 Crystal Structures Of The Gach Receptor Of Streptom 3e-10
2nvu_B 805 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 2e-09
3d4c_A 481 Zp-N Domain Of Mammalian Sperm Receptor Zp3 (Crysta 4e-09
3o3u_N 581 Crystal Structure Of Human Receptor For Advanced Gl 5e-09
3ob4_A 500 Mbp-Fusion Protein Of The Major Peanut Allergen Ara 1e-08
3mp1_A 522 Complex Structure Of Sgf29 And Trimethylated H3k4 L 1e-08
2xd2_A416 The Crystal Structure Of Malx From Streptococcus Pn 1e-08
1r6z_P 509 The Crystal Structure Of The Argonaute2 Paz Domain 1e-08
1y4c_A 494 Designed Helical Protein Fusion Mbp Length = 494 1e-08
1nl5_A366 Engineered High-Affinity Maltose-Binding Protein Le 2e-08
1n3w_A366 Engineered High-Affinity Maltose-Binding Protein Le 2e-08
2xz3_A 463 Blv Tm Hairpin Length = 463 2e-08
3mq9_A 471 Crystal Structure Of Ectodomain Mutant Of Bst-2TETH 3e-08
3h4z_A 568 Crystal Structure Of An Mbp-Der P 7 Fusion Protein 3e-08
2zxt_A 465 Crystal Structure Of Tim40MIA40, A DISULFIDE RELAY 3e-08
3dm0_A 694 Maltose Binding Protein Fusion With Rack1 From A. T 4e-08
3a3c_A 451 Crystal Structure Of Tim40MIA40 FUSING MBP, C296S A 4e-08
3l2j_A 535 Dimeric Structure Of The Ligand-Free Extracellular 4e-08
3f5f_A 658 Crystal Structure Of Heparan Sulfate 2-O-Sulfotrans 4e-08
3ehu_A 476 Crystal Structure Of The Extracellular Domain Of Hu 5e-08
1hsj_A 487 Sarr Mbp Fusion Structure Length = 487 5e-08
3c4m_A 539 Structure Of Human Parathyroid Hormone In Complex W 5e-08
3ehs_A 476 Crystal Structure Of The Extracellular Domain Of Hu 5e-08
3csb_A 465 Crystal Structure Of Monobody Ysx1MALTOSE BINDING P 5e-08
3ior_A 449 Huntingtin Amino-Terminal Region With 17 Gln Residu 6e-08
1mdp_1363 Refined Structures Of Two Insertion(Slash)deletion 6e-08
1ziu_A370 Crystal Structure Of Nickel-Bound Engineered Maltos 6e-08
3eht_A 476 Crystal Structure Of The Extracellular Domain Of Hu 6e-08
1t0k_A381 Joint X-Ray And Nmr Refinement Of Yeast L30e-Mrna C 6e-08
1a7l_A389 Dominant B-Cell Epitope From The Pres2 Region Of He 6e-08
1mh3_A421 Maltose Binding-A1 Homeodomain Protein Chimera, Cry 7e-08
3csg_A 461 Crystal Structure Of Monobody Ys1(Mbp-74)MALTOSE BI 7e-08
1nmu_A382 Mbp-L30 Length = 382 7e-08
2obg_A 461 Crystal Structure Of Monobody Mbp-74MALTOSE BINDING 8e-08
3g7v_A408 Islet Amyloid Polypeptide (Iapp Or Amylin) Fused To 8e-08
1jvy_A372 Maltodextrin-Binding Protein Variant D207cA301GSP31 8e-08
1mg1_A 450 Htlv-1 Gp21 EctodomainMALTOSE-Binding Protein Chime 9e-08
2vgq_A 477 Crystal Structure Of Human Ips-1 Card Length = 477 9e-08
1svx_B395 Crystal Structure Of A Designed Selected Ankyrin Re 9e-08
1mdq_A371 Refined Structures Of Two Insertion(Slash)deletion 1e-07
1jvx_A372 Maltodextrin-Binding Protein Variant D207cA301GSP31 1e-07
3n93_A 482 Crystal Structure Of Human Crfr2 Alpha Extracellula 1e-07
3hst_A387 N-Terminal Rnase H Domain Of Rv2228c From Mycobacte 1e-07
3g7w_A393 Islet Amyloid Polypeptide (Iapp Or Amylin) Residues 1e-07
1ezp_A370 Global Fold Of Maltodextrin Binding Protein Complex 1e-07
1ez9_A370 Structure Of Maltotetraitol Bound To Open-Form Malt 1e-07
2ok2_A402 Muts C-Terminal Domain Fused To Maltose Binding Pro 1e-07
1fqa_A370 Structure Of Maltotetraitol Bound To Open-Form Malt 1e-07
3pgf_A398 Crystal Structure Of Maltose Bound Mbp With A Confo 1e-07
3lbs_A384 Crystal Structure Of The Cytoplasmic Tail Of (Pro)r 1e-07
3hpi_A372 Crystal Structure Of Maltose-Binding Protein Mutant 1e-07
1ytv_A366 Maltose-Binding Protein Fusion To A C-Terminal Frag 2e-07
1mpb_A370 Maltodextrin-Binding Protein (Maltose-Binding Prote 2e-07
1iud_A380 Maltodextrin-Binding Protein InsertionDELETION MUTA 6e-07
2v93_A370 Equillibrium Mixture Of Open And Partially-Closed S 1e-06
3fir_A251 Crystal Structure Of Glycosylated K135e Peb3 Length 1e-06
3fjg_A251 Crystal Structure Of 3pg Bound Peb3 Length = 251 1e-06
1lax_A370 Crystal Structure Of Male31, A Defective Folding Mu 9e-06
2gha_A382 Thermotoga Maritima Maltotriose Binding Protein Bou 2e-05
2zyk_A397 Crystal Structure Of CycloMALTODEXTRIN-Binding Prot 2e-05
2fnc_A381 Thermotoga Maritima Maltotriose Binding Protein Bou 2e-05
2dfz_B381 Crystal Structure Of Cyclodextrin-Binding Protein C 9e-05
>gi|167013282|pdb|2QRY|A Chain A, Periplasmic Thiamin Binding Protein Length = 330 Back     alignment and structure
 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 185/318 (58%), Positives = 238/318 (74%)

Query: 20  YCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRM 79
                G   KPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LR 
Sbjct: 13  GLVPRGSHXKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRX 72

Query: 80  EGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIY 139
           EG+NS AD+VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+Y
Sbjct: 73  EGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVY 132

Query: 140 DKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATK 199
           DK ++  PP++  EL+ S + W++IYQDPRTST GLGLLLW QK+YGD++ Q W+K+A K
Sbjct: 133 DKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWXQKVYGDDAPQAWQKLAKK 192

Query: 200 TATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQ 259
           T TVTKGW+E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+
Sbjct: 193 TVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAAR 252

Query: 260 LVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEE 319
              SKQP+LAQ+F+QF +SP+FQ  +PT NW YPV ++++P  ++ +  P  +L F   E
Sbjct: 253 TAASKQPELAQKFLQFXVSPAFQNAIPTGNWXYPVANVTLPAGFEKLTKPATTLEFTPAE 312

Query: 320 TTRYRNQWISSWQNAVSR 337
               R  WIS WQ AVSR
Sbjct: 313 VAAQRQAWISEWQRAVSR 330


>gi|152149368|pdb|2PT1|A Chain A, Futa1 Synechocystis Pcc 6803 Length = 334 Back     alignment and structure
>gi|60594117|pdb|1Y4T|A Chain A, Ferric Binding Protein From Campylobacter Jejuni Length = 322 Back     alignment and structure
>gi|39654597|pdb|1Q35|A Chain A, Crystal Structure Of Pasteurella Haemolytica Apo Ferric Ion- Binding Protein A Length = 320 Back     alignment and structure
gi|170785082|pdb|2VOZ|A Chain A, Apo Futa2 From Synechocystis Pcc6803 Length = 346 Back     alignment and structure
>gi|60594186|pdb|1Y9U|A Chain A, Bordetella Ferric Binding Protein Length = 323 Back     alignment and structure
>gi|157833547|pdb|1POT|A Chain A, SpermidinePUTRESCINE-Binding Protein Complexed With Spermidine (Monomer Form) Length = 325 Back     alignment and structure
>gi|1633142|pdb|1POY|1 Chain 1, SpermidinePUTRESCINE-Binding Protein Complexed With Spermidine (Dimer Form) Length = 323 Back     alignment and structure
>gi|6573533|pdb|1D9V|A Chain A, Haemophilus Influenzae Ferric-Binding Protein Apo Form Length = 309 Back     alignment and structure
>gi|145579973|pdb|2O68|A Chain A, Crystal Structure Of Haemophilus Influenzae Q58l Mutant Fbpa Length = 309 Back     alignment and structure
>gi|145579975|pdb|2O6A|A Chain A, Crystal Structure Of The Haemophilus Influenzae E57a Mutant Fbpa Length = 309 Back     alignment and structure
>gi|29726721|pdb|1NNF|A Chain A, Crystal Structure Analysis Of Haemophlius Influenzae Ferric- Ion Binding Protein H9q Mutant Form Length = 309 Back     alignment and structure
>gi|38492941|pdb|1QW0|A Chain A, Crystal Structure Of Haemophilus Influenzae N175l Mutant Holo Ferric Ion-Binding Protein A Length = 309 Back     alignment and structure
>gi|145579974|pdb|2O69|A Chain A, Crystal Structure Of Haemophilus Influenzae N193l Mutant Fbpa Length = 309 Back     alignment and structure
>gi|306991649|pdb|3KN8|A Chain A, Crystal Structure Of Haemophilus Influenzae Y196a Mutant Holo Ferric Ion-Binding Protein A Length = 309 Back     alignment and structure
>gi|38492940|pdb|1QVS|A Chain A, Crystal Structure Of Haemophilus Influenzae H9a Mutant Holo Ferric Ion-Binding Protein A Length = 309 Back     alignment and structure
>gi|3891734|pdb|1A99|A Chain A, Putrescine Receptor (Potf) From E. Coli Length = 344 Back     alignment and structure
>gi|306991648|pdb|3KN7|A Chain A, Crystal Structure Of Haemophilus Influenzae Y195a Mutant Holo Ferric Ion-Binding Protein A Length = 309 Back     alignment and structure
>gi|28948312|pdb|1O7T|A Chain A, Metal Nanoclusters Bound To The Ferric Binding Protein From Neisseria Gonorrhoeae. Length = 309 Back     alignment and structure
>gi|47168691|pdb|1R1N|A Chain A, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding Protein From N. Gonorrhoeae Length = 309 Back     alignment and structure
>gi|6573535|pdb|1D9Y|A Chain A, Neisseria Gonorrhoeae Ferric Binding Protein Length = 309 Back     alignment and structure
>gi|61679631|pdb|1XVY|A Chain A, Crystal Structure Of Iron-Free Serratia Marcescens Sfua Length = 309 Back     alignment and structure
>gi|61679630|pdb|1XVX|A Chain A, Crystal Structure Of Iron-Loaded Yersinia Enterocolitica Yfua Length = 312 Back     alignment and structure
>gi|315364756|pdb|3PU5|A Chain A, The Crystal Structure Of A Putative Extracellular Solute-Binding Protein From Bordetella Parapertussis Length = 333 Back     alignment and structure
>gi|169404757|pdb|3C9H|A Chain A, Crystal Structure Of The Substrate Binding Protein Of The Abc Transporter From Agrobacterium Tumefaciens Length = 355 Back     alignment and structure
>gi|332639948|pdb|3RPW|A Chain A, The Crystal Structure Of An Abc Transporter From Rhodopseudomonas Palustris Cga009 Length = 365 Back     alignment and structure
>gi|157833787|pdb|1SBP|A Chain A, 1.7 Angstroms Refined Structure Of Sulfate-Binding Protein Involved In Active Transport And Novel Mode Of Sulfate Binding Length = 310 Back     alignment and structure
>gi|158431076|pdb|2V84|A Chain A, Crystal Structure Of The Tp0655 (Tppotd) Lipoprotein Of Treponema Pallidum Length = 343 Back     alignment and structure
gi|288965511|pdb|3JYR|A Chain A, Crystal Structures Of The Gach Receptor Of Streptomyces Glaucescens Gla.O In The Unliganded Form And In Complex With Acarbose And An Acarbose Homolog. Comparison With Acarbose-Loaded Maltose Binding Protein Of Salmonella Typhimurium. Length = 396 Back     alignment and structure
>gi|126031226|pdb|2NVU|B Chain B, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 805 Back     alignment and structure
>gi|215794623|pdb|3D4C|A Chain A, Zp-N Domain Of Mammalian Sperm Receptor Zp3 (Crystal Form I) Length = 481 Back     alignment and structure
>gi|308387909|pdb|3O3U|N Chain N, Crystal Structure Of Human Receptor For Advanced Glycation Endproducts (Rage) Length = 581 Back     alignment and structure
>gi|321159878|pdb|3OB4|A Chain A, Mbp-Fusion Protein Of The Major Peanut Allergen Ara H 2 Length = 500 Back     alignment and structure
>gi|332138136|pdb|3MP1|A Chain A, Complex Structure Of Sgf29 And Trimethylated H3k4 Length = 522 Back     alignment and structure
>gi|297787547|pdb|2XD2|A Chain A, The Crystal Structure Of Malx From Streptococcus Pneumoniae Length = 416 Back     alignment and structure
>gi|42543511|pdb|1R6Z|P Chain P, The Crystal Structure Of The Argonaute2 Paz Domain (As A Mbp Fusion) Length = 509 Back     alignment and structure
>gi|61680509|pdb|1Y4C|A Chain A, Designed Helical Protein Fusion Mbp Length = 494 Back     alignment and structure
>gi|34809631|pdb|1NL5|A Chain A, Engineered High-Affinity Maltose-Binding Protein Length = 366 Back     alignment and structure
>gi|34809628|pdb|1N3W|A Chain A, Engineered High-Affinity Maltose-Binding Protein Length = 366 Back     alignment and structure
>gi|325053859|pdb|2XZ3|A Chain A, Blv Tm Hairpin Length = 463 Back     alignment and structure
>gi|310689838|pdb|3MQ9|A Chain A, Crystal Structure Of Ectodomain Mutant Of Bst-2TETHERINCD317 FUSED To Mbp Length = 471 Back     alignment and structure
>gi|292659601|pdb|3H4Z|A Chain A, Crystal Structure Of An Mbp-Der P 7 Fusion Protein Length = 568 Back     alignment and structure
>gi|255311747|pdb|2ZXT|A Chain A, Crystal Structure Of Tim40MIA40, A DISULFIDE RELAY SYSTEM In Mitochondria, Solved As Mbp Fusion Protein Length = 465 Back     alignment and structure
>gi|198443285|pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>gi|255311751|pdb|3A3C|A Chain A, Crystal Structure Of Tim40MIA40 FUSING MBP, C296S AND C298S Mutant Length = 451 Back     alignment and structure
>gi|285803624|pdb|3L2J|A Chain A, Dimeric Structure Of The Ligand-Free Extracellular Domain Of Parathyroid Hormone Receptor (Pth1r) Length = 535 Back     alignment and structure
>gi|218681912|pdb|3F5F|A Chain A, Crystal Structure Of Heparan Sulfate 2-O-Sulfotransferase From Gallus Gallus As A Maltose Binding Protein Fusion Length = 658 Back     alignment and structure
>gi|208435769|pdb|3EHU|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Corticotropin Releasing Factor Receptor Type 1 (Crfr1) In Complex With Crf Length = 476 Back     alignment and structure
>gi|14488506|pdb|1HSJ|A Chain A, Sarr Mbp Fusion Structure Length = 487 Back     alignment and structure
>gi|178847557|pdb|3C4M|A Chain A, Structure Of Human Parathyroid Hormone In Complex With The Extracellular Domain Of Its G-Protein-Coupled Receptor (Pth1r) Length = 539 Back     alignment and structure
>gi|208435766|pdb|3EHS|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Corticotropin Releasing Factor Receptor Type 1 (Crfr1) Length = 476 Back     alignment and structure
>gi|194368745|pdb|3CSB|A Chain A, Crystal Structure Of Monobody Ysx1MALTOSE BINDING PROTEIN Fusion Complex Length = 465 Back     alignment and structure
>gi|260100151|pdb|3IOR|A Chain A, Huntingtin Amino-Terminal Region With 17 Gln Residues - Crystal C95 Length = 449 Back     alignment and structure
>gi|809263|pdb|1MDP|1 Chain 1, Refined Structures Of Two Insertion(Slash)deletion Mutants Probe Function Of The Maltodextrin Binding Protein Length = 363 Back     alignment and structure
>gi|85544034|pdb|1ZIU|A Chain A, Crystal Structure Of Nickel-Bound Engineered Maltose Binding Protein Length = 370 Back     alignment and structure
>gi|208435767|pdb|3EHT|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Corticotropin Releasing Factor Receptor Type 1 (Crfr1) In Complex With Crf Length = 476 Back     alignment and structure
>gi|51247494|pdb|1T0K|A Chain A, Joint X-Ray And Nmr Refinement Of Yeast L30e-Mrna Complex Length = 381 Back     alignment and structure
>gi|3318911|pdb|1A7L|A Chain A, Dominant B-Cell Epitope From The Pres2 Region Of Hepatitis B Virus In The Form Of An Inserted Peptide Segment In Maltodextrin-Binding Protein Length = 389 Back     alignment and structure
>gi|24159066|pdb|1MH3|A Chain A, Maltose Binding-A1 Homeodomain Protein Chimera, Crystal Form I Length = 421 Back     alignment and structure
>gi|194368746|pdb|3CSG|A Chain A, Crystal Structure Of Monobody Ys1(Mbp-74)MALTOSE BINDING Protein Fusion Complex Length = 461 Back     alignment and structure
>gi|28948969|pdb|1NMU|A Chain A, Mbp-L30 Length = 382 Back     alignment and structure
>gi|145579987|pdb|2OBG|A Chain A, Crystal Structure Of Monobody Mbp-74MALTOSE BINDING Protein Fusion Complex Length = 461 Back     alignment and structure
>gi|241913343|pdb|3G7V|A Chain A, Islet Amyloid Polypeptide (Iapp Or Amylin) Fused To Maltose Binding Protein Length = 408 Back     alignment and structure
>gi|15988454|pdb|1JVY|A Chain A, Maltodextrin-Binding Protein Variant D207cA301GSP316C With Beta-Mercaptoethanol Mixed Disulfides Length = 372 Back     alignment and structure
>gi|4930066|pdb|1MG1|A Chain A, Htlv-1 Gp21 EctodomainMALTOSE-Binding Protein Chimera Length = 450 Back     alignment and structure
>gi|162330189|pdb|2VGQ|A Chain A, Crystal Structure Of Human Ips-1 Card Length = 477 Back     alignment and structure
>gi|49259168|pdb|1SVX|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 395 Back     alignment and structure
>gi|157831957|pdb|1MDQ|A Chain A, Refined Structures Of Two Insertion(Slash)deletion Mutants Probe Function Of The Maltodextrin Binding Protein Length = 371 Back     alignment and structure
>gi|15988453|pdb|1JVX|A Chain A, Maltodextrin-Binding Protein Variant D207cA301GSP316C Cross-Linked In Crystal Length = 372 Back     alignment and structure
>gi|309319976|pdb|3N93|A Chain A, Crystal Structure Of Human Crfr2 Alpha Extracellular Domain In Complex With Urocortin 3 Length = 482 Back     alignment and structure
>gi|295321672|pdb|3HST|A Chain A, N-Terminal Rnase H Domain Of Rv2228c From Mycobacterium Tube As A Fusion Protein With Maltose Binding Protein Length = 387 Back     alignment and structure
>gi|241913347|pdb|3G7W|A Chain A, Islet Amyloid Polypeptide (Iapp Or Amylin) Residues 1 To 22 Fused To Maltose Binding Protein Length = 393 Back     alignment and structure
>gi|14277996|pdb|1EZP|A Chain A, Global Fold Of Maltodextrin Binding Protein Complexed With Beta-Cyclodextrin Using Peptide Orientations From Dipolar Couplings Length = 370 Back     alignment and structure
>gi|18655519|pdb|1EZ9|A Chain A, Structure Of Maltotetraitol Bound To Open-Form Maltodextrin Binding Protein In P1 Crystal Form Length = 370 Back     alignment and structure
>gi|146387613|pdb|2OK2|A Chain A, Muts C-Terminal Domain Fused To Maltose Binding Protein Length = 402 Back     alignment and structure
>gi|13787059|pdb|1FQA|A Chain A, Structure Of Maltotetraitol Bound To Open-Form Maltodextrin Binding Protein In P2(1)crystal Form Length = 370 Back     alignment and structure
>gi|325533972|pdb|3PGF|A Chain A, Crystal Structure Of Maltose Bound Mbp With A Conformationally Specific Synthetic Antigen Binder (Sab) Length = 398 Back     alignment and structure
>gi|323462857|pdb|3LBS|A Chain A, Crystal Structure Of The Cytoplasmic Tail Of (Pro)renin Receptor As A Mbp Fusion (Maltose-Bound Form) Length = 384 Back     alignment and structure
>gi|288562995|pdb|3HPI|A Chain A, Crystal Structure Of Maltose-Binding Protein Mutant With Bound Sucrose Length = 372 Back     alignment and structure
>gi|66361194|pdb|1YTV|A Chain A, Maltose-Binding Protein Fusion To A C-Terminal Fragment Of The V1a Vasopressin Receptor Length = 366 Back     alignment and structure
>gi|157832032|pdb|1MPB|A Chain A, Maltodextrin-Binding Protein (Maltose-Binding Protein) Mutant, With Arginine Replacing Tryptophan At Position 230 (Trp-230-Arg) Length = 370 Back     alignment and structure
>gi|224983580|pdb|3FIR|A Chain A, Crystal Structure Of Glycosylated K135e Peb3 Length = 251 Back     alignment and structure
>gi|224983584|pdb|3FJG|A Chain A, Crystal Structure Of 3pg Bound Peb3 Length = 251 Back     alignment and structure
>gi|28948475|pdb|1LAX|A Chain A, Crystal Structure Of Male31, A Defective Folding Mutant Of Maltose-Binding Protein Length = 370 Back     alignment and structure
>gi|126030563|pdb|2GHA|A Chain A, Thermotoga Maritima Maltotriose Binding Protein Bound With Maltotriose Length = 382 Back     alignment and structure
>gi|223365792|pdb|2ZYK|A Chain A, Crystal Structure Of CycloMALTODEXTRIN-Binding Protein Complexed With Gamma-Cyclodextrin Length = 397 Back     alignment and structure