255764501

255764501

thiamine transporter membrane protein

GeneID in NCBI database:8209557Locus tag:CLIBASIA_02235
Protein GI in NCBI database:255764501Protein Accession:YP_003064973.2
Gene range:+(719549, 721156)Protein Length:535aa
Gene description:thiamine transporter membrane protein
COG prediction:none
KEGG prediction:thiP; thiamine transporter membrane protein; K02063 thiamine transport system permease protein
SEED prediction:Thiamin ABC transporter, transmembrane component
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:Thiamin biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM12 TM-Helix
TOPPRED12 TM-Helix
HMMTOP12 TM-Helix
MEMSAT8 TM-Helix
MEMSAT_SVM10 TM-Helix
PHOBIUS12 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-----
MAKCCQPSIRNALWPGVIISCFLNFIFFLVVYSLWRHMPLISWREFMEDSYLWHVIGFTFWQALLSTLLSVIPSIFLAKSLFRRHFPGRILFLRLHTMIFVLPVFVVIMGVFTVYGRTGWIAQLCQWLGIVYQFNLYGIKGILLVHVFFNMPLAIRMLLQALDSISIEQRQLALQLGMNPWYFFRFVEWPYLRRQILPTSSLIFMLCFASFATVLTLGGGPASTTIELAIYQSLSYDFDLNKAAFLSLVQIFCCLSLVLFNQKFNVSFSSGYSSRFLWKNEDDSRWSRWWDFFLISCAIWFFILPLLAIIIEGMNAKLLLRLLQQSGLWSSFFNSIYIAINAGVLCMIFTIMLLWTKRELRLRRLKFFNHIFELSELLILAVPSIVLAVGFFLLLKNTVNLTSSSYSLIIVTNALMAVPYAVKILENPMYDLAERYNALCISLQIKGINRLYLIEFKALKRLMAQTFSFSCLLSIGDFGIIALFGNDNFCTLPCYLYQQLGSYRQSDAVVTALLLLSLCLGLFSLLEYLSGKEYD
ccccccHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccc
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHcccHHEccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcHHHHHHHHHcccccccEEEEEEcHHcHHHHHHHHHHHHHHHHHHccHEEEEccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccc
makccqpsirnalwpgvIISCFLNFIFFLVVYSLWRHMPLISWREFMEDSYLWHVIGFTFWQALLSTLLSVIPSIFLAKSLfrrhfpgriLFLRLHTMIFVLPVFVVIMGVFTVYGRTGWIAQLCQWLGIVYQFNLYGIKGILLVHVFFNMPLAIRMLLQALDSISIEQRQLALQLgmnpwyffrfvewpylrrqilptssLIFMLCFASFATVltlgggpastTIELAIYQSlsydfdlnKAAFLSLVQIFCCLSLVLFnqkfnvsfssgyssrflwkneddsrwsrWWDFFLISCAIWFFILPLLAIIIEGMNAKLLLRLLQQSGLWSSFFNSIYIAINAGVLCMIFTIMLLWTKRELRLRRLKFFNHIFELSELLILAVPSIVLAVGFFLLLKNTVNLTSSSYSLIIVTNALMAVPYAVKILENPMYDLAERYNALCISLQIKGINRLYLIEFKALKRLMAQTFSFSCLLsigdfgiialfgndnfctlpcylyqqlgsyrqSDAVVTALLLLSLCLGLFSLleylsgkeyd
MAKCCQPSIRNALWPGVIISCFLNFIFFLVVYSLWRHMPLISWREFMEDSYLWHVIGFTFWQALLSTLLSVIPSIFLAKSLFRRHFPGRILFLRLHTMIFVLPVFVVIMGVFTVYGRTGWIAQLCQWLGIVYQFNLYGIKGILLVHVFFNMPLAIRMLLQALDSISIEQRQLALQLGMNPWYFFRFVEWPYLRRQILPTSSLIFMLCFASFATVLTLGGGPASTTIELAIYQSLSYDFDLNKAAFLSLVQIFCCLSLVLFNQKFNVSFSSGYSSRFLWKNEDDSRWSRWWDFFLISCAIWFFILPLLAIIIEGMNAKLLLRLLQQSGLWSSFFNSIYIAINAGVLCMIFTIMLLWTKRELRLRRLKFFNHIFELSELLILAVPSIVLAVGFFLLLKNTVNLTSSSYSLIIVTNALMAVPYAVKILENPMYDLAERYNALCISLQIKGINRLYLIEFKALKRLMAQTFSFSCLLSIGDFGIIALFGNDNFCTLPCYLYQQLGSYRQSDAVVTALLLLSLCLGLFSlleylsgkeyd
MAKCCQPSIRNALWPGVIISCFLNFIFFLVVYSLWRHMPLISWREFMEDSYLWHVIGFTFWQALLSTLLSVIPSIFLAKSLFRRHFPGRILFLRLHTMIFVLPVFVVIMGVFTVYGRTGWIAQLCQWLGIVYQFNLYGIKGILLVHVFFNMPLAIRMLLQALDSISIEQRQLALQLGMNPWYFFRFVEWPYLRRQILPTSSLIFMLCFASFATVLTLGGGPASTTIELAIYQSLSYDFDLNKAAFLSLVQIFCCLSLVLFNQKFNVSFSSGYSSRFLWKNEDDSRWSRWWDFFLISCAIWFFILPLLAIIIEGMNAKlllrllqqsglwssFFNSIYIAINAGVLCMIFTIMllwtkrelrlrrlKFFNHIFELSELLILAVPSIVLAVGFFLLLKNTVNLTSSSYSLIIVTNALMAVPYAVKILENPMYDLAERYNALCISLQIKGINRLYLIEFKALKRLMAQTFSFSCLLSIGDFGIIALFGNDNFCTLPCYLYQQLGSYRQSDAVVTAllllslclglfslleylsGKEYD
*********RNALWPGVIISCFLNFIFFLVVYSLWRHMPLISWREFMEDSYLWHVIGFTFWQALLSTLLSVIPSIFLAKSLFRRHFPGRILFLRLHTMIFVLPVFVVIMGVFTVYGRTGWIAQLCQWLGIVYQFNLYGIKGILLVHVFFNMPLAIRMLLQALDSISIEQRQLALQLGMNPWYFFRFVEWPYLRRQILPTSSLIFMLCFASFATVLTLGGGPASTTIELAIYQSLSYDFDLNKAAFLSLVQIFCCLSLVLFNQKF*********************WSRWWDFFLISCAIWFFILPLLAIIIEGMNAKLLLRLLQQSGLWSSFFNSIYIAINAGVLCMIFTIMLLWTKRELRLRRLKFFNHIFELSELLILAVPSIVLAVGFFLLLKNTVNLTSSSYSLIIVTNALMAVPYAVKILENPMYDLAERYNALCISLQIKGINRLYLIEFKALKRLMAQTFSFSCLLSIGDFGIIALFGNDNFCTLPCYLYQQLGSYRQSDAVVTALLLLSLCLGLFSLL**LS*****
MAKCCQPSIRNALWPGVIISCFLNFIFFLVVYSLWRHMPLISWREFMEDSYLWHVIGFTFWQALLSTLLSVIPSIFLAKSLFRRHFPGRILFLRLHTMIFVLPVFVVIMGVFTVYGRTGWIAQLCQWLGIVYQFNLYGIKGILLVHVFFNMPLAIRMLLQALDSISIEQRQLALQLGMNPWYFFRFVEWPYLRRQILPTSSLIFMLCFASFATVLTLGGGPASTTIELAIYQSLSYDFDLNKAAFLSLVQIFCCLSLVLFNQKFNVSFSSGYSSRFLWKNEDDSRWSRWWDFFLISCAIWFFILPLLAIIIEGMNAKLLLRLLQQSGLWSSFFNSIYIAINAGVLCMIFTIMLLWTKRELRLRRLKFFNHIFELSELLILAVPSIVLAVGFFLLLKNTVNLTSSSYSLIIVTNALMAVPYAVKILENPMYDLAERYNALCISLQIKGINRLYLIEFKALKRLMAQTFSFSCLLSIGDFGIIALFGNDNFCTLPCYLYQQLGSYRQSDAVVTALLLLSLCLGLFSLLEYLSGKEYD
*****QPSIRNALWPGVIISCFLNFIFFLVVYSLWRHMPLISWREFMEDSYLWHVIGFTFWQALLSTLLSVIPSIFLAKSLFRRHFPGRILFLRLHTMIFVLPVFVVIMGVFTVYGRTGWIAQLCQWLGIVYQFNLYGIKGILLVHVFFNMPLAIRMLLQALDSISIEQRQLALQLGMNPWYFFRFVEWPYLRRQILPTSSLIFMLCFASFATVLTLGGGPASTTIELAIYQSLSYDFDLNKAAFLSLVQIFCCLSLVLFNQKFNVSF******RFLWKNEDDSRWSRWWDFFLISCAIWFFILPLLAIIIEGMNAKLLLRLLQQSGLWSSFFNSIYIAINAGVLCMIFTIMLLWTKRELRLRRLKFFNHIFELSELLILAVPSIVLAVGFFLLLKNTVNLTSSSYSLIIVTNALMAVPYAVKILENPMYDLAERYNALCISLQIKGINRLYLIEFKALKRLMAQTFSFSCLLSIGDFGIIALFGNDNFCTLPCYLYQQLGSYRQSDAVVTALLLLSLCLGLFSLLEYLSGKE**
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiii
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxx
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiii
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiii
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKCCQPSIRNALWPGVIISCFLNFIFFLVVYSLWRHMPLISWREFMEDSYLWHVIGFTFWQALLSTLLSVIPSIFLAKSLFRRHFPGRILFLRLHTMIFVLPVFVVIMGVFTVYGRTGWIAQLCQWLGIVYQFNLYGIKGILLVHVFFNMPLAIRMLLQALDSISIEQRQLALQLGMNPWYFFRFVEWPYLRRQILPTSSLIFMLCFASFATVLTLGGGPASTTIELAIYQSLSYDFDLNKAAFLSLVQIFCCLSLVLFNQKFNVSFSSGYSSRFLWKNEDDSRWSRWWDFFLISCAIWFFILPLLAIIIEGMNAKLLLRLLQQSGLWSSFFNSIYIAINAGVLCMIFTIMLLWTKRELRLRRLKFFNHIFELSELLILAVPSIVLAVGFFLLLKNTVNLTSSSYSLIIVTNALMAVPYAVKILENPMYDLAERYNALCISLQIKGINRLYLIEFKALKRLMAQTFSFSCLLSIGDFGIIALFGNDNFCTLPCYLYQQLGSYRQSDAVVTALLLLSLCLGLFSLLEYLSGKEYD
MAKCCQPSIRNALWPGVIISCFLNFIFFLVVYSLWRHMPLISWREFMEDSYLWHVIGFTFWQALLSTLLSVIPSIFLAKSLFRRHFPGRILFLRLHTMIFVLPVFVVIMGVFTVYGRTGWIAQLCQWLGIVYQFNLYGIKGILLVHVFFNMPLAIRMLLQALDSISIEQRQLALQLGMNPWYFFRFVEWPYLRRQILPTSSLIFMLCFASFATVLTLGGGPASTTIELAIYQSLSYDFDLNKAAFLSLVQIFCCLSLVLFNQKFNVSFSSGYSSRFLWKNEDDSRWSRWWDFFLISCAIWFFILPLLAIIIEGMNAKLLLRLLQQSGLWSSFFNSIYIAINAGVLCMIFTIMLLWTKRELRLRRLKFFNHIFELSELLILAVPSIVLAVGFFLLLKNTVNLTSSSYSLIIVTNALMAVPYAVKILENPMYDLAERYNALCISLQIKGINRLYLIEFKALKRLMAQTFSFSCLLSIGDFGIIALFGNDNFCTLPCYLYQQLGSYRQSDAVVTALLLLSLCLGLFSLLEYLSGKEYD
MAKCCQPSIRNALWPGVIISCFLNFIFFLVVYSLWRHMPLISWREFMEDSYLWHVIGFTFWQALLSTLLSVIPSIFLAKSLFRRHFPGRILFLRLHTMIFVLPVFVVIMGVFTVYGRTGWIAQLCQWLGIVYQFNLYGIKGILLVHVFFNMPLAIRMLLQALDSISIEQRQLALQLGMNPWYFFRFVEWPYLRRQILPTSSLIFMLCFASFATVLTLGGGPASTTIELAIYQSLSYDFDLNKAAFLSLVQIFCCLSLVLFNQKFNVSFSSGYSSRFLWKNEDDSRWSRWWDFFLISCAIWFFILPLLAIIIEGMNAKLLLRLLQQSGLWSSFFNSIYIAINAGVLCMIFTIMLLWTKRELRLRRLKFFNHIFELSELLILAVPSIVLAVGFFLLLKNTVNLTSSSYSLIIVTNALMAVPYAVKILENPMYDLAERYNALCISLQIKGINRLYLIEFKALKRLMAQTFSFSCLLSIGDFGIIALFGNDNFCTLPCYLYQQLGSYRQSDAVVTALLLLSLCLGLFSLLEYLSGKEYD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target535 thiamine transporter membrane protein [Candidatus Liber
315121754534 thiamine transporter membrane protein [Candidatus Liber 1 0.0
284008555534 thiamine ABC transporter, permease protein [Arsenophonu 1 0.0
170025758535 thiamine transporter membrane protein [Yersinia pseudot 1 1e-176
332160270535 thiamine transporter membrane protein [Yersinia enteroc 1 1e-175
162421651535 thiamine transporter membrane protein [Yersinia pestis 1 1e-175
22127526539 thiamine transporter membrane protein [Yersinia pestis 1 1e-175
238791145523 Thiamine transport system permease protein thiP [Yersin 1 1e-174
51595013535 thiamine transporter membrane protein [Yersinia pseudot 1 1e-174
318607161535 thiamin ABC transporter, transmembrane component [Yersi 1 1e-174
238752403512 Thiamine transport system permease protein thiP [Yersin 1 1e-174
>gi|315121754|ref|YP_004062243.1| thiamine transporter membrane protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 534 Back     alignment and organism information
 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/535 (75%), Positives = 452/535 (84%), Gaps = 1/535 (0%)

Query: 1   MAKCCQPSIRNALWPGVIISCFLNFIFFLVVYSLWRHMPLISWREFMEDSYLWHVIGFTF 60
           MA+CCQ  I +ALWPG+I+SC L  I  L   SLW +MP ISW EF+ DSYLWHVI FTF
Sbjct: 1   MARCCQSPIGSALWPGIIVSCLLISISLLTCGSLWLYMPQISWEEFISDSYLWHVIIFTF 60

Query: 61  WQALLSTLLSVIPSIFLAKSLFRRHFPGRILFLRLHTMIFVLPVFVVIMGVFTVYGRTGW 120
           WQALLSTLLSVIP+IFLA+SLFRRHF GR+LFLRLH+MIFVLPVFVVIMG+ TVYGR GW
Sbjct: 61  WQALLSTLLSVIPAIFLAQSLFRRHFLGRMLFLRLHSMIFVLPVFVVIMGLLTVYGRMGW 120

Query: 121 IAQLCQWLGIVYQFNLYGIKGILLVHVFFNMPLAIRMLLQALDSISIEQRQLALQLGMNP 180
           IAQ CQWLG+  QFN YG+KGILL H+FFN+PLA RMLLQAL+SIS+EQRQL+ QLGMN 
Sbjct: 121 IAQFCQWLGMRCQFNFYGLKGILLAHMFFNLPLASRMLLQALESISVEQRQLSAQLGMNQ 180

Query: 181 WYFFRFVEWPYLRRQILPTSSLIFMLCFASFATVLTLGGGPASTTIELAIYQSLSYDFDL 240
           W FFR VEWPYLRRQIL TS+LIFMLCF SFAT+L LGGGPA+TTIELAIYQ+LSYDFDL
Sbjct: 181 WQFFRLVEWPYLRRQILSTSTLIFMLCFTSFATILALGGGPAATTIELAIYQALSYDFDL 240

Query: 241 NKAAFLSLVQIFCCLSLVLFNQKFNVSFSSGYSSRFLWKNEDDSRWSRWWDFFLISCAIW 300
           NKA+FLSL+Q+F CL LVL NQK N  F SGY+ + LWKN DD+RW +WWDF +I  AI 
Sbjct: 241 NKASFLSLIQLFFCLGLVLLNQKLNTPFFSGYNRQLLWKNPDDNRWRKWWDFCIIGFAIL 300

Query: 301 FFILPLLAIIIEGMNAKLLLRLLQQSGLWSSFFNSIYIAINAGVLCMIFTIMLLWTKREL 360
           FFI PLLAIII+G+N K LL+ LQQ GLW +F NS YIA+++G+LCM  TIMLLWT REL
Sbjct: 301 FFIPPLLAIIIDGLN-KTLLQALQQLGLWKAFVNSAYIAVSSGLLCMALTIMLLWTGREL 359

Query: 361 RLRRLKFFNHIFELSELLILAVPSIVLAVGFFLLLKNTVNLTSSSYSLIIVTNALMAVPY 420
           RLRRL FFN   ELS LLILA+PSIVLAVGFFLL  N V L SSSYSLII+TNALMAVPY
Sbjct: 360 RLRRLIFFNQALELSGLLILAMPSIVLAVGFFLLFNNAVGLASSSYSLIILTNALMAVPY 419

Query: 421 AVKILENPMYDLAERYNALCISLQIKGINRLYLIEFKALKRLMAQTFSFSCLLSIGDFGI 480
           A K LENPMYDLAERYN+LC SLQIKGINRLYLIE   LK ++AQTF+F+CLLS+GDFGI
Sbjct: 420 AFKSLENPMYDLAERYNSLCFSLQIKGINRLYLIELNYLKPIIAQTFAFACLLSLGDFGI 479

Query: 481 IALFGNDNFCTLPCYLYQQLGSYRQSDAVVTALLLLSLCLGLFSLLEYLSGKEYD 535
           IA FGN+NF TLP YLYQQL SYRQ+DA VTALLLL LC  LFSLLEYLSGKE+D
Sbjct: 480 IAFFGNENFYTLPYYLYQQLSSYRQNDAAVTALLLLLLCFSLFSLLEYLSGKEHD 534


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|284008555|emb|CBA75106.1| thiamine ABC transporter, permease protein [Arsenophonus nasoniae] Length = 534 Back     alignment and organism information
>gi|170025758|ref|YP_001722263.1| thiamine transporter membrane protein [Yersinia pseudotuberculosis YPIII] Length = 535 Back     alignment and organism information
>gi|332160270|ref|YP_004296847.1| thiamine transporter membrane protein [Yersinia enterocolitica subsp. palearctica 105.5R(r)] Length = 535 Back     alignment and organism information
>gi|162421651|ref|YP_001607321.1| thiamine transporter membrane protein [Yersinia pestis Angola] Length = 535 Back     alignment and organism information
>gi|22127526|ref|NP_670949.1| thiamine transporter membrane protein [Yersinia pestis KIM 10] Length = 539 Back     alignment and organism information
>gi|238791145|ref|ZP_04634784.1| Thiamine transport system permease protein thiP [Yersinia intermedia ATCC 29909] Length = 523 Back     alignment and organism information
>gi|51595013|ref|YP_069204.1| thiamine transporter membrane protein [Yersinia pseudotuberculosis IP 32953] Length = 535 Back     alignment and organism information
>gi|318607161|emb|CBY28659.1| thiamin ABC transporter, transmembrane component [Yersinia enterocolitica subsp. palearctica Y11] Length = 535 Back     alignment and organism information
>gi|238752403|ref|ZP_04613880.1| Thiamine transport system permease protein thiP [Yersinia rohdei ATCC 43380] Length = 512 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target535 thiamine transporter membrane protein [Candidatus Liber
PRK09433525 PRK09433, thiP, thiamine transporter membrane protein; 0.0
TIGR01253519 TIGR01253, thiP, thiamine ABC transporter, permease pro 1e-147
COG1178540 COG1178, ThiP, ABC-type Fe3+ transport system, permease 8e-79
TIGR02141208 TIGR02141, modB_ABC, molybdate ABC transporter, permeas 3e-21
PRK15050296 PRK15050, PRK15050, 2-aminoethylphosphonate transport s 9e-17
COG4149225 COG4149, ModC, ABC-type molybdate transport system, per 8e-16
TIGR03226312 TIGR03226, PhnU, 2-aminoethylphosphonate ABC transporte 1e-14
cd06261190 cd06261, TM_PBP2, Transmembrane subunit (TM) found in P 5e-14
COG1177267 COG1177, PotC, ABC-type spermidine/putrescine transport 9e-12
COG1175295 COG1175, UgpA, ABC-type sugar transport systems, permea 2e-11
TIGR01581225 TIGR01581, Mo_ABC_porter, NifC-like ABC-type porter 4e-11
COG4208287 COG4208, CysW, ABC-type sulfate transport system, perme 7e-10
COG0395281 COG0395, UgpE, ABC-type sugar transport system, permeas 2e-09
TIGR02140261 TIGR02140, permease_CysW, sulfate ABC transporter, perm 2e-09
PRK10971277 PRK10971, PRK10971, sulfate/thiosulfate transporter sub 2e-08
COG4662227 COG4662, TupA, ABC-type tungstate transport system, per 6e-07
pfam00528183 pfam00528, BPD_transp_1, Binding-protein-dependent tran 7e-05
COG0555274 COG0555, CysU, ABC-type sulfate transport system, perme 2e-19
COG1176287 COG1176, PotB, ABC-type spermidine/putrescine transport 2e-16
TIGR02139265 TIGR02139, permease_CysT, sulfate ABC transporter, perm 4e-14
TIGR00969271 TIGR00969, 3a0106s02, sulfate ABC transporter, permease 7e-13
PRK09433525 PRK09433, thiP, thiamine transporter membrane protein; 2e-12
COG4135551 COG4135, COG4135, ABC-type uncharacterized transport sy 4e-04
CHL00187237 CHL00187, cysT, sulfate transport protein; Provisional 1e-13
PRK09421229 PRK09421, modB, molybdate ABC transporter permease prot 8e-10
COG4132282 COG4132, COG4132, ABC-type uncharacterized transport sy 9e-10
PRK11602283 PRK11602, cysW, sulfate/thiosulfate transporter permeas 3e-07
TIGR03262546 TIGR03262, PhnU2, putative 2-aminoethylphosphonate ABC 2e-10
COG0555274 COG0555, CysU, ABC-type sulfate transport system, perme 3e-09
COG1177267 COG1177, PotC, ABC-type spermidine/putrescine transport 5e-09
cd06261190 cd06261, TM_PBP2, Transmembrane subunit (TM) found in P 3e-05
TIGR01253 519 TIGR01253, thiP, thiamine ABC transporter, permease pro 0.001
>gnl|CDD|181853 PRK09433, thiP, thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>gnl|CDD|130320 TIGR01253, thiP, thiamine ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|31371 COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|162726 TIGR02141, modB_ABC, molybdate ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|185010 PRK15050, PRK15050, 2-aminoethylphosphonate transport system permease PhnU; Provisional Back     alignment and domain information
>gnl|CDD|33901 COG4149, ModC, ABC-type molybdate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132270 TIGR03226, PhnU, 2-aminoethylphosphonate ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|119394 cd06261, TM_PBP2, Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>gnl|CDD|31370 COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31368 COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|130643 TIGR01581, Mo_ABC_porter, NifC-like ABC-type porter Back     alignment and domain information
>gnl|CDD|33937 COG4208, CysW, ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|30744 COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|162725 TIGR02140, permease_CysW, sulfate ABC transporter, permease protein CysW Back     alignment and domain information
>gnl|CDD|182873 PRK10971, PRK10971, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|34280 COG4662, TupA, ABC-type tungstate transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|144205 pfam00528, BPD_transp_1, Binding-protein-dependent transport system inner membrane component Back     alignment and domain information
>gnl|CDD|30901 COG0555, CysU, ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31369 COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|131194 TIGR02139, permease_CysT, sulfate ABC transporter, permease protein CysT Back     alignment and domain information
>gnl|CDD|162139 TIGR00969, 3a0106s02, sulfate ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|181853 PRK09433, thiP, thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>gnl|CDD|33891 COG4135, COG4135, ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>gnl|CDD|164564 CHL00187, cysT, sulfate transport protein; Provisional Back     alignment and domain information
>gnl|CDD|181841 PRK09421, modB, molybdate ABC transporter permease protein; Reviewed Back     alignment and domain information
>gnl|CDD|33888 COG4132, COG4132, ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>gnl|CDD|183225 PRK11602, cysW, sulfate/thiosulfate transporter permease subunit; Provisional Back     alignment and domain information
>gnl|CDD|132306 TIGR03262, PhnU2, putative 2-aminoethylphosphonate ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|30901 COG0555, CysU, ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31370 COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|119394 cd06261, TM_PBP2, Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>gnl|CDD|130320 TIGR01253, thiP, thiamine ABC transporter, permease protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 535 thiamine transporter membrane protein [Candidatus Liber
PRK09433536 thiP thiamine transporter membrane protein; Reviewed 100.0
COG1178540 ThiP ABC-type Fe3+ transport system, permease component 100.0
TIGR01253519 thiP thiamine/thiamine pyrophosphate ABC transporter, p 100.0
TIGR03262546 PhnU2 putative 2-aminoethylphosphonate ABC transport sy 100.0
COG4135551 ABC-type uncharacterized transport system, permease com 100.0
COG4986523 ABC-type anion transport system, duplicated permease co 99.79
TIGR03226312 PhnU 2-aminoethylphosphonate ABC transporter, permease 100.0
PRK10971277 sulfate/thiosulfate transporter subunit; Provisional 100.0
PRK11602291 cysW sulfate/thiosulfate transporter permease subunit; 100.0
TIGR02139265 permease_CysT sulfate ABC transporter, permease protein 100.0
TIGR00969280 3a0106s02 sulfate ABC transporter, permease protein; In 100.0
COG0555274 CysU ABC-type sulfate transport system, permease compon 100.0
TIGR02140275 permease_CysW sulfate ABC transporter, permease protein 100.0
COG4208287 CysW ABC-type sulfate transport system, permease compon 100.0
COG4132282 ABC-type uncharacterized transport system, permease com 99.97
COG4135551 ABC-type uncharacterized transport system, permease com 99.72
PRK10683317 putrescine transporter subunit: membrane component of A 100.0
PRK09497285 potB spermidine/putrescine ABC transporter membrane pro 100.0
PRK10592281 putrescine transporter subunit: membrane component of A 100.0
COG1176287 PotB ABC-type spermidine/putrescine transport system, p 100.0
COG1175295 UgpA ABC-type sugar transport systems, permease compone 100.0
PRK09421229 modB molybdate ABC transporter permease protein; Review 100.0
PRK10561280 glycerol-3-phosphate transporter permease; Provisional 100.0
PRK09500257 potC spermidine/putrescine ABC transporter membrane pro 100.0
COG1177267 PotC ABC-type spermidine/putrescine transport system, p 100.0
PRK10999520 malF maltose transporter membrane protein; Provisional 100.0
TIGR02141212 modB_ABC molybdate ABC transporter, permease protein; I 100.0
TIGR01581226 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR0 100.0
TIGR03255272 PhnV 2-aminoethylphosphonate ABC transport system, memb 100.0
COG4149225 ModC ABC-type molybdate transport system, permease comp 100.0
TIGR03262546 PhnU2 putative 2-aminoethylphosphonate ABC transport sy 100.0
COG0395281 UgpE ABC-type sugar transport system, permease componen 100.0
PRK10998296 malG maltose transporter permease; Provisional 100.0
PRK10973281 glycerol-3-phosphate transporter membrane protein; Prov 100.0
COG4209309 LplB ABC-type polysaccharide transport system, permease 100.0
cd06261190 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic 100.0
COG3833282 MalG ABC-type maltose transport systems, permease compo 100.0
COG4662227 TupA ABC-type tungstate transport system, periplasmic c 99.93
PRK11268292 pstA phosphate transporter permease subunit; Provisiona 99.89
PRK11275319 pstC phosphate transporter permease subunit; Provisiona 99.89
COG0581292 PstA ABC-type phosphate transport system, permease comp 99.88
PRK10782217 DL-methionine transporter permease subunit; Provisional 99.86
COG0573310 PstC ABC-type phosphate transport system, permease comp 99.86
TIGR03416267 ABC_choXWV_perm choline ABC transporter, permease prote 99.85
PRK10952354 glycine betaine transporter membrane protein; Provision 99.85
TIGR00974302 3a0107s02c phosphate ABC transporter, permease protein 99.83
COG4176290 ProW ABC-type proline/glycine betaine transport system, 99.79
PRK09494219 glnP glutamine ABC transporter permease protein; Review 99.74
PRK10160275 taurine transporter subunit; Provisional 99.74
COG2011222 AbcD ABC-type metal ion transport system, permease comp 99.73
PRK11122222 artM arginine transporter permease subunit ArtM; Provis 99.71
PRK11123238 arginine transporter permease subunit ArtQ; Provisional 99.7
COG0765222 HisM ABC-type amino acid transport system, permease com 99.66
COG4215230 ArtQ ABC-type arginine transport system, permease compo 99.49
COG3639283 ABC-type phosphate/phosphonate transport system, permea 99.47
PRK10352314 nickel transporter permease NikB; Provisional 99.25
TIGR03003218 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, pe 99.05
COG4160228 ArtM ABC-type arginine/histidine transport system, perm 99.04
TIGR01097192 3A0109s02M phosphonate ABC transporter, permease protei 98.71
COG4168321 SapB ABC-type antimicrobial peptide transport system, p 96.74
TIGR02789315 nickel_nikB nickel ABC transporter, permease subunit Ni 92.76
CHL00187235 cysT sulfate transport protein; Provisional 100.0
TIGR03255272 PhnV 2-aminoethylphosphonate ABC transport system, memb 100.0
TIGR03226312 PhnU 2-aminoethylphosphonate ABC transporter, permease 100.0
PRK09500257 potC spermidine/putrescine ABC transporter membrane pro 100.0
PRK10592281 putrescine transporter subunit: membrane component of A 100.0
PRK10971277 sulfate/thiosulfate transporter subunit; Provisional 100.0
COG1177267 PotC ABC-type spermidine/putrescine transport system, p 100.0
PRK09497285 potB spermidine/putrescine ABC transporter membrane pro 100.0
PRK11602291 cysW sulfate/thiosulfate transporter permease subunit; 100.0
PRK10683317 putrescine transporter subunit: membrane component of A 100.0
TIGR02139265 permease_CysT sulfate ABC transporter, permease protein 100.0
TIGR00969280 3a0106s02 sulfate ABC transporter, permease protein; In 100.0
COG0555274 CysU ABC-type sulfate transport system, permease compon 100.0
COG1178 540 ThiP ABC-type Fe3+ transport system, permease component 100.0
PRK09433 536 thiP thiamine transporter membrane protein; Reviewed 100.0
TIGR02140275 permease_CysW sulfate ABC transporter, permease protein 100.0
TIGR01581226 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR0 100.0
COG1176287 PotB ABC-type spermidine/putrescine transport system, p 100.0
PRK10561280 glycerol-3-phosphate transporter permease; Provisional 100.0
COG0395281 UgpE ABC-type sugar transport system, permease componen 100.0
PRK10998296 malG maltose transporter permease; Provisional 100.0
COG1175295 UgpA ABC-type sugar transport systems, permease compone 100.0
PRK10973281 glycerol-3-phosphate transporter membrane protein; Prov 100.0
COG4208287 CysW ABC-type sulfate transport system, permease compon 100.0
PRK10999520 malF maltose transporter membrane protein; Provisional 99.98
COG3833282 MalG ABC-type maltose transport systems, permease compo 99.97
COG4132282 ABC-type uncharacterized transport system, permease com 99.92
TIGR01253 519 thiP thiamine/thiamine pyrophosphate ABC transporter, p 99.89
COG4209309 LplB ABC-type polysaccharide transport system, permease 99.89
PRK09421229 modB molybdate ABC transporter permease protein; Review 100.0
TIGR02141212 modB_ABC molybdate ABC transporter, permease protein; I 100.0
COG4149225 ModC ABC-type molybdate transport system, permease comp 100.0
cd06261190 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic 99.95
COG0581292 PstA ABC-type phosphate transport system, permease comp 99.94
PRK11268292 pstA phosphate transporter permease subunit; Provisiona 99.93
PRK11275319 pstC phosphate transporter permease subunit; Provisiona 99.92
TIGR00974302 3a0107s02c phosphate ABC transporter, permease protein 99.9
COG0573310 PstC ABC-type phosphate transport system, permease comp 99.88
COG4662227 TupA ABC-type tungstate transport system, periplasmic c 99.86
PRK10782217 DL-methionine transporter permease subunit; Provisional 99.85
TIGR02138317 phosphate_pstC phosphate ABC transporter, permease prot 99.84
PRK10160275 taurine transporter subunit; Provisional 99.76
TIGR03416267 ABC_choXWV_perm choline ABC transporter, permease prote 99.74
PRK09494219 glnP glutamine ABC transporter permease protein; Review 99.72
PRK10952354 glycine betaine transporter membrane protein; Provision 99.72
COG2011222 AbcD ABC-type metal ion transport system, permease comp 99.68
PRK11365263 ssuC alkanesulfonate transporter permease subunit; Prov 99.67
PRK11123238 arginine transporter permease subunit ArtQ; Provisional 99.65
COG4176290 ProW ABC-type proline/glycine betaine transport system, 99.64
PRK11122222 artM arginine transporter permease subunit ArtM; Provis 99.63
COG0765222 HisM ABC-type amino acid transport system, permease com 99.61
PRK09881296 ATP-dependent peptide transporter membrane subunit; Pro 99.52
COG1173289 DppC ABC-type dipeptide/oligopeptide/nickel transport s 99.52
COG1174221 OpuBB ABC-type proline/glycine betaine transport system 99.51
COG0600258 TauC ABC-type nitrate/sulfonate/bicarbonate transport s 99.51
PRK10913300 dipeptide transporter; Provisional 99.41
COG4215230 ArtQ ABC-type arginine transport system, permease compo 99.4
PRK10417272 nikC nickel transporter permease NikC; Provisional 99.39
COG3639283 ABC-type phosphate/phosphonate transport system, permea 99.36
PRK10352314 nickel transporter permease NikB; Provisional 99.07
PRK09471306 oppB oligopeptide transporter permease; Reviewed 99.01
COG0601317 DppB ABC-type dipeptide/oligopeptide/nickel transport s 99.0
PRK10914339 dipeptide transporter permease DppB; Provisional 98.94
COG4160228 ArtM ABC-type arginine/histidine transport system, perm 98.92
TIGR03004216 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, pe 98.83
TIGR02790258 nickel_nikC nickel ABC transporter, permease subunit Ni 98.65
TIGR01097192 3A0109s02M phosphonate ABC transporter, permease protei 98.39
COG4168321 SapB ABC-type antimicrobial peptide transport system, p 96.31
CHL00187235 cysT sulfate transport protein; Provisional 100.0
TIGR02138317 phosphate_pstC phosphate ABC transporter, permease prot 99.88
PRK11365263 ssuC alkanesulfonate transporter permease subunit; Prov 99.75
pfam00528183 BPD_transp_1 Binding-protein-dependent transport system 99.7
COG0600258 TauC ABC-type nitrate/sulfonate/bicarbonate transport s 99.64
COG1174221 OpuBB ABC-type proline/glycine betaine transport system 99.63
PRK10417272 nikC nickel transporter permease NikC; Provisional 99.55
COG1173289 DppC ABC-type dipeptide/oligopeptide/nickel transport s 99.47
PRK09881296 ATP-dependent peptide transporter membrane subunit; Pro 99.4
PRK10913300 dipeptide transporter; Provisional 99.34
PRK09471306 oppB oligopeptide transporter permease; Reviewed 99.16
TIGR02790258 nickel_nikC nickel ABC transporter, permease subunit Ni 99.12
TIGR03004216 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, pe 98.84
COG4239341 ABC-type uncharacterized transport system, permease com 98.28
COG4171296 SapC ABC-type antimicrobial peptide transport system, p 97.88
COG4174364 ABC-type uncharacterized transport system, permease com 92.94
pfam00528183 BPD_transp_1 Binding-protein-dependent transport system 99.57
TIGR03003218 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, pe 99.16
COG4597397 BatB ABC-type amino acid transport system, permease com 97.79
TIGR01183203 ntrB nitrate ABC transporter, permease protein; InterPr 94.3
COG0601317 DppB ABC-type dipeptide/oligopeptide/nickel transport s 99.15
PRK10914339 dipeptide transporter permease DppB; Provisional 98.96
COG4590733 ABC-type uncharacterized transport system, permease com 99.08
COG4986523 ABC-type anion transport system, duplicated permease co 98.64
COG4590733 ABC-type uncharacterized transport system, permease com 98.63
COG4597397 BatB ABC-type amino acid transport system, permease com 97.09
COG4239341 ABC-type uncharacterized transport system, permease com 98.46
COG4171296 SapC ABC-type antimicrobial peptide transport system, p 98.27
COG4174364 ABC-type uncharacterized transport system, permease com 96.35
TIGR0172699 HEQRo_perm_3TM amino acid ABC transporter, permease pro 92.24
>PRK09433 thiP thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01253 thiP thiamine/thiamine pyrophosphate ABC transporter, permease protein; InterPro: IPR005947 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein Back     alignment and domain information
>COG4135 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4986 ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03226 PhnU 2-aminoethylphosphonate ABC transporter, permease protein Back     alignment and domain information
>PRK10971 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK11602 cysW sulfate/thiosulfate transporter permease subunit; Provisional Back     alignment and domain information
>TIGR02139 permease_CysT sulfate ABC transporter, permease protein CysT; InterPro: IPR011865 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR00969 3a0106s02 sulfate ABC transporter, permease protein; InterPro: IPR005667 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>COG0555 CysU ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02140 permease_CysW sulfate ABC transporter, permease protein CysW; InterPro: IPR011866 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4208 CysW ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4132 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4135 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PRK10683 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>PRK09497 potB spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>PRK10592 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>COG1176 PotB ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism] Back     alignment and domain information
>COG1175 UgpA ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09421 modB molybdate ABC transporter permease protein; Reviewed Back     alignment and domain information
>PRK10561 glycerol-3-phosphate transporter permease; Provisional Back     alignment and domain information
>PRK09500 potC spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>COG1177 PotC ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10999 malF maltose transporter membrane protein; Provisional Back     alignment and domain information
>TIGR02141 modB_ABC molybdate ABC transporter, permease protein; InterPro: IPR011867 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR01581 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR006469 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR03255 PhnV 2-aminoethylphosphonate ABC transport system, membrane component PhnV Back     alignment and domain information
>COG4149 ModC ABC-type molybdate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein Back     alignment and domain information
>COG0395 UgpE ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10998 malG maltose transporter permease; Provisional Back     alignment and domain information
>PRK10973 glycerol-3-phosphate transporter membrane protein; Provisional Back     alignment and domain information
>COG4209 LplB ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06261 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>COG3833 MalG ABC-type maltose transport systems, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4662 TupA ABC-type tungstate transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>PRK11268 pstA phosphate transporter permease subunit; Provisional Back     alignment and domain information
>PRK11275 pstC phosphate transporter permease subunit; Provisional Back     alignment and domain information
>COG0581 PstA ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10782 DL-methionine transporter permease subunit; Provisional Back     alignment and domain information
>COG0573 PstC ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03416 ABC_choXWV_perm choline ABC transporter, permease protein Back     alignment and domain information
>PRK10952 glycine betaine transporter membrane protein; Provisional Back     alignment and domain information
>TIGR00974 3a0107s02c phosphate ABC transporter, permease protein PstA; InterPro: IPR005672 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>COG4176 ProW ABC-type proline/glycine betaine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09494 glnP glutamine ABC transporter permease protein; Reviewed Back     alignment and domain information
>PRK10160 taurine transporter subunit; Provisional Back     alignment and domain information
>COG2011 AbcD ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11122 artM arginine transporter permease subunit ArtM; Provisional Back     alignment and domain information
>PRK11123 arginine transporter permease subunit ArtQ; Provisional Back     alignment and domain information
>COG0765 HisM ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4215 ArtQ ABC-type arginine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>COG3639 ABC-type phosphate/phosphonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10352 nickel transporter permease NikB; Provisional Back     alignment and domain information
>TIGR03003 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, permease protein EhuD; InterPro: IPR014341 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4160 ArtM ABC-type arginine/histidine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01097 3A0109s02M phosphonate ABC transporter, permease protein; InterPro: IPR005769 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>COG4168 SapB ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Back     alignment and domain information
>TIGR02789 nickel_nikB nickel ABC transporter, permease subunit NikB; InterPro: IPR014156 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>CHL00187 cysT sulfate transport protein; Provisional Back     alignment and domain information
>TIGR03255 PhnV 2-aminoethylphosphonate ABC transport system, membrane component PhnV Back     alignment and domain information
>TIGR03226 PhnU 2-aminoethylphosphonate ABC transporter, permease protein Back     alignment and domain information
>PRK09500 potC spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>PRK10592 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>PRK10971 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>COG1177 PotC ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09497 potB spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>PRK11602 cysW sulfate/thiosulfate transporter permease subunit; Provisional Back     alignment and domain information
>PRK10683 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>TIGR02139 permease_CysT sulfate ABC transporter, permease protein CysT; InterPro: IPR011865 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR00969 3a0106s02 sulfate ABC transporter, permease protein; InterPro: IPR005667 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>COG0555 CysU ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09433 thiP thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>TIGR02140 permease_CysW sulfate ABC transporter, permease protein CysW; InterPro: IPR011866 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR01581 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR006469 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG1176 PotB ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10561 glycerol-3-phosphate transporter permease; Provisional Back     alignment and domain information
>COG0395 UgpE ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10998 malG maltose transporter permease; Provisional Back     alignment and domain information
>COG1175 UgpA ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10973 glycerol-3-phosphate transporter membrane protein; Provisional Back     alignment and domain information
>COG4208 CysW ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10999 malF maltose transporter membrane protein; Provisional Back     alignment and domain information
>COG3833 MalG ABC-type maltose transport systems, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4132 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR01253 thiP thiamine/thiamine pyrophosphate ABC transporter, permease protein; InterPro: IPR005947 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4209 LplB ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09421 modB molybdate ABC transporter permease protein; Reviewed Back     alignment and domain information
>TIGR02141 modB_ABC molybdate ABC transporter, permease protein; InterPro: IPR011867 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4149 ModC ABC-type molybdate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd06261 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>COG0581 PstA ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11268 pstA phosphate transporter permease subunit; Provisional Back     alignment and domain information
>PRK11275 pstC phosphate transporter permease subunit; Provisional Back     alignment and domain information
>TIGR00974 3a0107s02c phosphate ABC transporter, permease protein PstA; InterPro: IPR005672 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>COG0573 PstC ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4662 TupA ABC-type tungstate transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>PRK10782 DL-methionine transporter permease subunit; Provisional Back     alignment and domain information
>TIGR02138 phosphate_pstC phosphate ABC transporter, permease protein PstC; InterPro: IPR011864 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK10160 taurine transporter subunit; Provisional Back     alignment and domain information
>TIGR03416 ABC_choXWV_perm choline ABC transporter, permease protein Back     alignment and domain information
>PRK09494 glnP glutamine ABC transporter permease protein; Reviewed Back     alignment and domain information
>PRK10952 glycine betaine transporter membrane protein; Provisional Back     alignment and domain information
>COG2011 AbcD ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11365 ssuC alkanesulfonate transporter permease subunit; Provisional Back     alignment and domain information
>PRK11123 arginine transporter permease subunit ArtQ; Provisional Back     alignment and domain information
>COG4176 ProW ABC-type proline/glycine betaine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11122 artM arginine transporter permease subunit ArtM; Provisional Back     alignment and domain information
>COG0765 HisM ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information