254780562

254780562

hypothetical protein CLIBASIA_02245

GeneID in NCBI database:8209559Locus tag:CLIBASIA_02245
Protein GI in NCBI database:254780562Protein Accession:YP_003064975.1
Gene range:+(717731, 717964)Protein Length:77aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized homolog of plant Iojap protein
KEGG prediction:hypothetical protein; K09710 hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70-------
MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN
cccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEccccccHHcEEEEEEcccccHHHHHHHHHHHHHHHcc
cccccHHHHHccHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccEEEEEEccccHHHHHHHHHHHHHHHHcc
MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN
mlantekqalqtadhldSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN
MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN
********************ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL*K**
***********TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN
*LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN
MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN
MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target77 hypothetical protein CLIBASIA_02245 [Candidatus Liberib
254780277 976 DNA polymerase I [Candidatus Liberibacter asiaticu 0.026
>gi|254780277|ref|YP_003064690.1| DNA polymerase I [Candidatus Liberibacter asiaticus str. psy62] Length = 976 Back     alignment
 Score = 28.1 bits (61), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 35  ICHIENTSLRSL---ICDNMVIVSGRSTKHVASIADNLISYLKKK 76
           + H    S+R     +  + V+ SGRS+  +ASIA   +SY +K+
Sbjct: 475 VLHRYGISMRGFEDIMLMSYVLDSGRSSHDIASIAQKWLSYTRKE 519

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target77 hypothetical protein CLIBASIA_02245 [Candidatus Liberib
31512175686 hypothetical protein CKC_00030 [Candidatus Liberibacter 1 2e-21
58582948138 hypothetical protein XOO3325 [Xanthomonas oryzae pv. or 1 2e-07
21243504137 hypothetical protein XAC2777 [Xanthomonas axonopodis pv 1 2e-07
188577782116 domain of unknown function superfamily [Xanthomonas ory 1 3e-07
325920736136 iojap-related protein [Xanthomonas gardneri ATCC 19865] 1 1e-06
188990941141 hypothetical protein xccb100_1545 [Xanthomonas campestr 1 2e-06
21232046139 hypothetical protein XCC2615 [Xanthomonas campestris pv 1 2e-06
325917118119 iojap-related protein [Xanthomonas vesicatoria ATCC 359 1 2e-06
154251929168 iojap-like protein [Parvibaculum lavamentivorans DS-1] 1 6e-06
227823688148 hypothetical protein NGR_c31740 [Sinorhizobium fredii N 1 2e-05
>gi|315121756|ref|YP_004062245.1| hypothetical protein CKC_00030 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 86 Back     alignment and organism information
 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%)

Query: 1  MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60
          M  NT+K   Q  D++ +C+ T++ECL ELKAEDI HIENTS +SLICDNMVIVSGRSTK
Sbjct: 1  MPVNTKKTEEQINDNIAACVTTIIECLTELKAEDIRHIENTSAQSLICDNMVIVSGRSTK 60

Query: 61 HVASIADNLISY 72
          HVASIADNLISY
Sbjct: 61 HVASIADNLISY 72


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|58582948|ref|YP_201964.1| hypothetical protein XOO3325 [Xanthomonas oryzae pv. oryzae KACC10331] Length = 138 Back     alignment and organism information
>gi|21243504|ref|NP_643086.1| hypothetical protein XAC2777 [Xanthomonas axonopodis pv. citri str. 306] Length = 137 Back     alignment and organism information
>gi|188577782|ref|YP_001914711.1| domain of unknown function superfamily [Xanthomonas oryzae pv. oryzae PXO99A] Length = 116 Back     alignment and organism information
>gi|325920736|ref|ZP_08182642.1| iojap-related protein [Xanthomonas gardneri ATCC 19865] Length = 136 Back     alignment and organism information
>gi|188990941|ref|YP_001902951.1| hypothetical protein xccb100_1545 [Xanthomonas campestris pv. campestris str. B100] Length = 141 Back     alignment and organism information
>gi|21232046|ref|NP_637963.1| hypothetical protein XCC2615 [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 139 Back     alignment and organism information
>gi|325917118|ref|ZP_08179351.1| iojap-related protein [Xanthomonas vesicatoria ATCC 35937] Length = 119 Back     alignment and organism information
>gi|154251929|ref|YP_001412753.1| iojap-like protein [Parvibaculum lavamentivorans DS-1] Length = 168 Back     alignment and organism information
>gi|227823688|ref|YP_002827661.1| hypothetical protein NGR_c31740 [Sinorhizobium fredii NGR234] Length = 148 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target77 hypothetical protein CLIBASIA_02245 [Candidatus Liberib
TIGR0009099 TIGR00090, iojap_ybeB, iojap-like ribosome-associated p 3e-11
COG0799115 COG0799, COG0799, Uncharacterized homolog of plant Ioja 5e-09
PRK11538105 PRK11538, PRK11538, ribosome-associated protein; Provis 2e-05
KOG3212208 KOG3212, KOG3212, KOG3212, Uncharacterized conserved pr 0.001
pfam0241099 pfam02410, DUF143, Domain of unknown function DUF143 3e-10
>gnl|CDD|161702 TIGR00090, iojap_ybeB, iojap-like ribosome-associated protein Back     alignment and domain information
>gnl|CDD|31142 COG0799, COG0799, Uncharacterized homolog of plant Iojap protein [Function unknown] Back     alignment and domain information
>gnl|CDD|183184 PRK11538, PRK11538, ribosome-associated protein; Provisional Back     alignment and domain information
>gnl|CDD|38422 KOG3212, KOG3212, KOG3212, Uncharacterized conserved protein related to IojAP [Function unknown] Back     alignment and domain information
>gnl|CDD|145515 pfam02410, DUF143, Domain of unknown function DUF143 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 77 hypothetical protein CLIBASIA_02245 [Candidatus Liberib
COG0799115 Uncharacterized homolog of plant Iojap protein [Functio 99.79
PRK11538105 hypothetical protein; Provisional 99.78
TIGR00090155 TIGR00090 iojap homolog; InterPro: IPR004394 The gene i 99.74
pfam0241099 DUF143 Domain of unknown function DUF143. This domain h 99.69
KOG3212208 consensus 99.16
>COG0799 Uncharacterized homolog of plant Iojap protein [Function unknown] Back     alignment and domain information
>PRK11538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00090 TIGR00090 iojap homolog; InterPro: IPR004394 The gene iojap is a pattern-striping gene in maize, reflecting a chloroplast development defect in some cells Back     alignment and domain information
>pfam02410 DUF143 Domain of unknown function DUF143 Back     alignment and domain information
>KOG3212 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target77 hypothetical protein CLIBASIA_02245 [Candidatus Liberib
2id1_A130 X-Ray Crystal Structure Of Protein Cv0518 From Chro 5e-09
2o5a_A125 Crystal Structure Of Q9kd89 From Bacillus Haloduran 7e-08
>gi|116668109|pdb|2ID1|A Chain A, X-Ray Crystal Structure Of Protein Cv0518 From Chromobacterium Violaceum, Northeast Structural Genomics Consortium Target Cvr5. Length = 130 Back     alignment and structure
 Score = 64.3 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 13/61 (21%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74
           +       +E L+++K +DI  ++ TS  + +    ++ +G S + V ++A+++   LK
Sbjct: 2  EIQEISKLAIEALEDIKGKDIIELD-TSKLTSLFQRXIVATGDSNRQVKALANSVQVKLK 60

Query: 75 K 75
          +
Sbjct: 61 E 61


>gi|122921438|pdb|2O5A|A Chain A, Crystal Structure Of Q9kd89 From Bacillus Halodurans. Northeast Structural Genomics Target Bhr21 Length = 125 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target77 hypothetical protein CLIBASIA_02245 [Candidatus Liberib
2o5a_A125 BH1328 protein; BHR21, NESG, structural genomics, PSI-2 3e-06
2id1_A130 Hypothetical protein; alpha-beta protein, structural ge 4e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 9e-04
>2o5a_A BH1328 protein; BHR21, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.70A {Bacillus halodurans} SCOP: d.218.1.12 Length = 125 Back     alignment and structure
 Score = 45.7 bits (108), Expect = 3e-06
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 1/58 (1%)

Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77
          +   +  + + KAE +  + N    SLI D  +I  G S K V +IA  L    +++ 
Sbjct: 7  LQLAVNAVDDKKAEQVVAL-NMKGISLIADFFLICHGNSEKQVQAIAHELKKVAQEQG 63


>2id1_A Hypothetical protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.00A {Chromobacterium violaceum atcc 12472} SCOP: d.218.1.12 Length = 130 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target77 hypothetical protein CLIBASIA_02245 [Candidatus Liberib
2o5a_A125 BH1328 protein; BHR21, NESG, structural genomics, PSI-2 99.74
2id1_A130 Hypothetical protein; alpha-beta protein, structural ge 99.72
>2o5a_A BH1328 protein; BHR21, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.70A {Bacillus halodurans} SCOP: d.218.1.12 Back     alignment and structure
Probab=99.74  E-value=2.6e-18  Score=119.11  Aligned_cols=61  Identities=25%  Similarity=0.357  Sum_probs=56.9

Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHCEEEEEEECCHHHHHHHHHHHHHHHHHCC
Q ss_conf             99999999999984368634989804888720008788951886899999999999997439
Q gi|254780562|r   16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN   77 (77)
Q Consensus        16 ~~~~l~~i~~~l~dkKa~dI~~ldv~~~~s~~~D~fVIatg~S~rhv~Aia~~v~~~lk~~n   77 (77)
                      .+++++.++++|+|+||+||+++|+++ .|+++||||||||+|.||++|||++|.+.+|+++
T Consensus         3 ~~el~~~i~~~l~dkKa~DI~vldv~~-~s~~~Dy~VIaT~~S~rh~~aia~~v~~~lk~~~   63 (125)
T 2o5a_A            3 NQELLQLAVNAVDDKKAEQVVALNMKG-ISLIADFFLICHGNSEKQVQAIAHELKKVAQEQG   63 (125)
T ss_dssp             CHHHHHHHHHHHHHTTCEEEEEEECBT-TBC--CEEEEEEESSHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCC-CCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCC
T ss_conf             799999999999974898659997789-9743278999986779999999999999999839



>2id1_A Hypothetical protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.00A {Chromobacterium violaceum atcc 12472} SCOP: d.218.1.12 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 77 hypothetical protein CLIBASIA_02245 [Candidatus Liberib
d2o5aa1113 d.218.1.12 (A:2-114) Uncharacterized protein BH1328 {Ba 1e-06
d2id1a1120 d.218.1.12 (A:1-120) Hypothetical protein CV0518 {Chrom 1e-05
>d2o5aa1 d.218.1.12 (A:2-114) Uncharacterized protein BH1328 {Bacillus halodurans [TaxId: 86665]} Length = 113 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nucleotidyltransferase
superfamily: Nucleotidyltransferase
family: Iojap/YbeB-like
domain: Uncharacterized protein BH1328
species: Bacillus halodurans [TaxId: 86665]
 Score = 45.3 bits (107), Expect = 1e-06
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 1/58 (1%)

Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77
          +   +  + + KAE +  + N    SLI D  +I  G S K V +IA  L    +++ 
Sbjct: 6  LQLAVNAVDDKKAEQVVAL-NMKGISLIADFFLICHGNSEKQVQAIAHELKKVAQEQG 62


>d2id1a1 d.218.1.12 (A:1-120) Hypothetical protein CV0518 {Chromobacterium violaceum [TaxId: 536]} Length = 120 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target77 hypothetical protein CLIBASIA_02245 [Candidatus Liberib
d2o5aa1113 Uncharacterized protein BH1328 {Bacillus halodurans [Ta 99.73
d2id1a1120 Hypothetical protein CV0518 {Chromobacterium violaceum 99.73
>d2o5aa1 d.218.1.12 (A:2-114) Uncharacterized protein BH1328 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nucleotidyltransferase
superfamily: Nucleotidyltransferase
family: Iojap/YbeB-like
domain: Uncharacterized protein BH1328
species: Bacillus halodurans [TaxId: 86665]
Probab=99.73  E-value=4.6e-18  Score=116.50  Aligned_cols=61  Identities=25%  Similarity=0.357  Sum_probs=56.9

Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHCEEEEEEECCHHHHHHHHHHHHHHHHHCC
Q ss_conf             99999999999984368634989804888720008788951886899999999999997439
Q gi|254780562|r   16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN   77 (77)
Q Consensus        16 ~~~~l~~i~~~l~dkKa~dI~~ldv~~~~s~~~D~fVIatg~S~rhv~Aia~~v~~~lk~~n   77 (77)
                      .+++++.++++|+|+||+||++||+++ .|+++||||||||+|.||++||+++|.+.+|+++
T Consensus         2 ~~el~~~i~~~l~dkKa~dI~vldv~~-~~~~~D~~VIatg~S~rh~~aia~~v~~~~k~~~   62 (113)
T d2o5aa1           2 NQELLQLAVNAVDDKKAEQVVALNMKG-ISLIADFFLICHGNSEKQVQAIAHELKKVAQEQG   62 (113)
T ss_dssp             CHHHHHHHHHHHHHTTCEEEEEEECBT-TBC--CEEEEEEESSHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCC-CCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHHC
T ss_conf             799999999999974899769997789-9732378999985778999999999999999853



>d2id1a1 d.218.1.12 (A:1-120) Hypothetical protein CV0518 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 77 hypothetical protein CLIBASIA_02245 [Candidatus Li
2o5a_A_125 (A:) BH1328 protein; BHR21, NESG, structural genom 1e-08
2id1_A_130 (A:) Hypothetical protein; alpha-beta protein, str 1e-07
>2o5a_A (A:) BH1328 protein; BHR21, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.70A {Bacillus halodurans}Length = 125 Back     alignment and structure
 Score = 53.3 bits (128), Expect = 1e-08
 Identities = 13/58 (22%), Positives = 25/58 (43%), Gaps = 1/58 (1%)

Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77
          +   +  + + KAE +  +    +   I D  +I  G S K V +IA  L    +++ 
Sbjct: 7  LQLAVNAVDDKKAEQVVALNXKGISL-IADFFLICHGNSEKQVQAIAHELKKVAQEQG 63


>2id1_A (A:) Hypothetical protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.00A {Chromobacterium violaceum atcc 12472}Length = 130 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target77 hypothetical protein CLIBASIA_02245 [Candidatus Liberib
2id1_A_130 Hypothetical protein; alpha-beta protein, structur 99.73
2o5a_A_125 BH1328 protein; BHR21, NESG, structural genomics, 99.7
>2id1_A (A:) Hypothetical protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.00A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
Probab=99.73  E-value=7.9e-18  Score=117.33  Aligned_cols=62  Identities=18%  Similarity=0.411  Sum_probs=58.2

Q ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHCEEEEEEECCHHHHHHHHHHHHHHHHHCC
Q ss_conf             999999999999984368634989804888720008788951886899999999999997439
Q gi|254780562|r   15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN   77 (77)
Q Consensus        15 ~~~~~l~~i~~~l~dkKa~dI~~ldv~~~~s~~~D~fVIatg~S~rhv~Aia~~v~~~lk~~n   77 (77)
                      ++.++++.++++|+++||+||++||+++ .|+++||||||||+|.||++||+++|.+.+|+++
T Consensus         2 ~~~~l~~~i~~~l~~~ka~DI~vidv~~-~~~~~dy~VI~T~~S~rh~~aia~~i~~~~k~~~   63 (130)
T 2id1_A            2 EIQEISKLAIEALEDIKGKDIIELDTSK-LTSLFQRXIVATGDSNRQVKALANSVQVKLKEAG   63 (130)
T ss_dssp             CHHHHHHHHHHHHHHTTCEEEEEEEGGG-TCSSCSEEEEEECSSHHHHHHHHHHHHHHHHHTT
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEEEECCC-CCCHHHEEEEEEECCHHHHHHHHHHHHHHHHHCC
T ss_conf             8899999999999973888639997889-8624316799775467999999999999999839



>2o5a_A (A:) BH1328 protein; BHR21, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.70A {Bacillus halodurans} Back     alignment and structure