254780563

254780563

extracellular solute-binding protein

GeneID in NCBI database:8209560Locus tag:CLIBASIA_02250
Protein GI in NCBI database:254780563Protein Accession:YP_003064976.1
Gene range:-(716860, 717447)Protein Length:195aa
Gene description:extracellular solute-binding protein
COG prediction:[P] ABC-type Fe3+ transport system, periplasmic component
KEGG prediction:extracellular solute-binding protein; K02012 iron(III) transport system substrate-binding protein
SEED prediction:iron ABC transporter, periplasmic iron-binding protein
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYKR
cHHHHHHHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHcccccccEEEEccHHHHHHHccccccccHHHHHcccHHHccccccEEEEEEEEEEEEEEHHHHccccccccHHHHHcHHHcccEEEEcccccHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHccc
cccHHHHHHHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHccccccEEEEccHHHHHHHccccccccHHHHHHccHHcccccccEEEEEEEEEEEEEccccccHHHcccHHHHHccccHcccEEEccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHccHHEccc
MFKRTIYTYLLLLCGFteafstentTKYLTLYtdqnqsvmlpiihsfeertgvkispiytssiqrppitqgspvdviitkdetSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTkrikiadlpksvFDLTNAQWKKrlsiapnniSFHRLLNtmeqtpnktVVQDFIKNITANeiltkykr
MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISpiytssiqrppitqgspvDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKrikiadlpksvFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKnitaneiltkykr
MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYKR
***RTIYTYLLLLCGFTEA****NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY****************VIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEI******
MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYKR
MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYKR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYKR
MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYKR
MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYKR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target195 extracellular solute-binding protein [Candidatus Liberi
238059298 347 extracellular solute-binding protein [Micromonospora sp 1 1e-18
159037068 355 extracellular solute-binding protein [Salinispora areni 1 5e-18
312114161 331 extracellular solute-binding protein family 1 [Rhodomic 1 1e-17
330466473 352 extracellular solute-binding protein [Verrucosispora ma 1 2e-17
262199751 356 extracellular solute-binding protein family 1 [Haliangi 1 2e-17
328951243 333 extracellular solute-binding protein family 1 [Marinith 1 3e-17
91065105 332 permease [Theonella swinhoei bacterial symbiont clone p 1 1e-16
297623762 329 family 1 extracellular solute-binding protein [Truepera 1 3e-16
260771842 332 ferric iron ABC transporter iron-binding protein [Vibri 1 1e-15
239917160 363 ABC-type Fe3+ transport system, periplasmic component [ 1 2e-14
>gi|238059298|ref|ZP_04604007.1| extracellular solute-binding protein [Micromonospora sp. ATCC 39149] Length = 347 Back     alignment and organism information
 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 92/184 (50%), Gaps = 6/184 (3%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--I 68
           L  CG  E    +   K LT+Y+ +++S++ P++  FE+ +GV +   Y ++ Q     +
Sbjct: 21  LTACGGDEGDPGKPGDKRLTIYSGRSESLVKPVLEKFEKSSGVTVDVRYGTTAQMAAQLL 80

Query: 69  TQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVL 124
            +G  SP DV   +D  +L       L   LP  L+ +     +    + + +S  ++VL
Sbjct: 81  EEGGRSPADVFFAQDAGALGAVTKAGLFAVLPQDLLDRVPAAYRAAGGQWVGVSGRSRVL 140

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNI 184
           AY+  ++    LP SVF+LT+ +WK RL +AP N SF   +  +         ++F+  +
Sbjct: 141 AYNVDQVTKEQLPTSVFELTDPKWKGRLGVAPTNGSFQAFVTALRVQHGDAKAREFLTGL 200

Query: 185 TANE 188
            ANE
Sbjct: 201 KANE 204


Species: Micromonospora sp. ATCC 39149
Genus: Micromonospora
Family: Micromonosporaceae
Order: Actinomycetales
Class: Actinobacteria (class)
Phylum: Actinobacteria
Superkingdom: Bacteria
>gi|159037068|ref|YP_001536321.1| extracellular solute-binding protein [Salinispora arenicola CNS-205] Length = 355 Back     alignment and organism information
>gi|312114161|ref|YP_004011757.1| extracellular solute-binding protein family 1 [Rhodomicrobium vannielii ATCC 17100] Length = 331 Back     alignment and organism information
>gi|330466473|ref|YP_004404216.1| extracellular solute-binding protein [Verrucosispora maris AB-18-032] Length = 352 Back     alignment and organism information
>gi|262199751|ref|YP_003270960.1| extracellular solute-binding protein family 1 [Haliangium ochraceum DSM 14365] Length = 356 Back     alignment and organism information
>gi|328951243|ref|YP_004368578.1| extracellular solute-binding protein family 1 [Marinithermus hydrothermalis DSM 14884] Length = 333 Back     alignment and organism information
>gi|91065105|gb|ABE03937.1| permease [Theonella swinhoei bacterial symbiont clone pSW1H8] Length = 332 Back     alignment and organism information
>gi|297623762|ref|YP_003705196.1| family 1 extracellular solute-binding protein [Truepera radiovictrix DSM 17093] Length = 329 Back     alignment and organism information
>gi|260771842|ref|ZP_05880760.1| ferric iron ABC transporter iron-binding protein [Vibrio metschnikovii CIP 69.14] Length = 332 Back     alignment and organism information
>gi|239917160|ref|YP_002956718.1| ABC-type Fe3+ transport system, periplasmic component [Micrococcus luteus NCTC 2665] Length = 363 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target195 extracellular solute-binding protein [Candidatus Liberi
COG0725258 COG0725, ModA, ABC-type molybdate transport system, per 8e-05
>gnl|CDD|31069 COG0725, ModA, ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 195 extracellular solute-binding protein [Candidatus Liberi
TIGR03261 334 phnS2 putative 2-aminoethylphosphonate ABC transport sy 100.0
TIGR03227 367 PhnS 2-aminoethylphosphonate ABC transporter, periplasm 100.0
PRK11205 326 tbpA thiamine transporter substrate binding subunit; Pr 100.0
COG4143 336 TbpA ABC-type thiamine transport system, periplasmic co 99.96
PRK09501 348 potD spermidine/putrescine ABC transporter periplasmic 99.89
TIGR01254 324 sfuA ABC transporter periplasmic binding protein, thiB 99.88
PRK10682 370 putrescine transporter subunit: periplasmic-binding com 99.83
COG0687 363 PotD Spermidine/putrescine-binding periplasmic protein 99.77
PRK09474 394 malE maltose ABC transporter periplasmic protein; Revie 99.5
TIGR01276 326 thiB thiamin/thiamin pyrophosphate ABC transporter, thi 99.42
PRK11622 401 putative ABC transporter solute-binding protein; Provis 99.01
PRK10852 338 thiosulfate transporter subunit; Provisional 98.88
PRK10752 329 sulfate transporter subunit; Provisional 98.76
TIGR03431 288 PhnD phosphonate ABC transporter, periplasmic phosphona 98.4
COG1613 348 Sbp ABC-type sulfate transport system, periplasmic comp 98.38
COG4588252 AcfC Accessory colonization factor AcfC, contains ABC-t 98.36
COG4150 341 CysP ABC-type sulfate transport system, periplasmic com 97.97
COG3221 299 PhnD ABC-type phosphate/phosphonate transport system, p 97.8
TIGR01098299 3A0109s03R phosphonate ABC transporter, periplasmic pho 97.54
PRK10918 346 phosphate transporter subunit; Provisional 96.18
PRK11119 332 proX glycine betaine transporter periplasmic subunit; P 94.77
COG0226 318 PstS ABC-type phosphate transport system, periplasmic c 93.76
PRK12679316 cbl transcriptional regulator Cbl; Reviewed 92.35
COG1840 299 AfuA ABC-type Fe3+ transport system, periplasmic compon 99.9
COG4134 384 ABC-type uncharacterized transport system, periplasmic 98.63
TIGR00971 320 3a0106s03 sulfate ABC transporter, sulfate-binding prot 96.68
PRK10677257 modA molybdate transporter periplasmic protein; Provisi 99.1
COG2998280 TupB ABC-type tungstate transport system, permease comp 97.47
PRK09495247 glnH glutamine ABC transporter periplasmic protein; Rev 96.94
PRK11553 314 alkanesulfonate transporter substrate-binding subunit; 96.74
COG1464268 NlpA ABC-type metal ion transport system, periplasmic c 95.37
PRK11480 320 tauA taurine transporter substrate binding subunit; Pro 95.12
COG2113 302 ProX ABC-type proline/glycine betaine transport systems 95.11
COG3019149 Predicted metal-binding protein [General function predi 92.87
PRK09861272 cytoplasmic membrane lipoprotein-28; Provisional 92.67
COG2182 420 MalE Maltose-binding periplasmic proteins/domains [Carb 98.99
PRK10974 439 glycerol-3-phosphate transporter periplasmic binding pr 98.92
PRK04168 336 hypothetical protein; Provisional 98.82
COG1653 433 UgpB ABC-type sugar transport system, periplasmic compo 98.71
COG0725258 ModA ABC-type molybdate transport system, periplasmic c 98.7
TIGR01256225 modA molybdate ABC transporter, periplasmic molybdate-b 95.99
COG1732300 OpuBC Periplasmic glycine betaine/choline-binding (lipo 95.77
PRK10797302 glutamate and aspartate transporter subunit; Provisiona 96.98
PRK11260264 cystine transporter subunit; Provisional 96.96
pfam01547260 SBP_bac_1 Bacterial extracellular solute-binding protei 96.55
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glutamat 90.3
PRK11063271 metQ DL-methionine transporter substrate-binding subuni 94.65
PRK01326310 prsA foldase protein PrsA; Reviewed 93.25
PRK12450309 foldase protein PrsA; Reviewed 92.19
PRK10641 615 btuB vitamin B12/cobalamin outer membrane transporter; 91.31
PRK03002285 prsA peptidylprolyl isomerase; Reviewed 91.16
>TIGR03261 phnS2 putative 2-aminoethylphosphonate ABC transport system, 1-aminoethylphosphonate-binding protein component Back     alignment and domain information
>TIGR03227 PhnS 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate binding protein Back     alignment and domain information
>PRK11205 tbpA thiamine transporter substrate binding subunit; Provisional Back     alignment and domain information
>COG4143 TbpA ABC-type thiamine transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed Back     alignment and domain information
>TIGR01254 sfuA ABC transporter periplasmic binding protein, thiB subfamily; InterPro: IPR005948 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK10682 putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional Back     alignment and domain information
>COG0687 PotD Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09474 malE maltose ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>TIGR01276 thiB thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin pyrophospate-binding protein; InterPro: IPR005967 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK11622 putative ABC transporter solute-binding protein; Provisional Back     alignment and domain information
>PRK10852 thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK10752 sulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>COG1613 Sbp ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4588 AcfC Accessory colonization factor AcfC, contains ABC-type periplasmic domain [General function prediction only] Back     alignment and domain information
>COG4150 CysP ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01098 3A0109s03R phosphonate ABC transporter, periplasmic phosphonate-binding protein; InterPro: IPR005770 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>PRK10918 phosphate transporter subunit; Provisional Back     alignment and domain information
>PRK11119 proX glycine betaine transporter periplasmic subunit; Provisional Back     alignment and domain information
>COG0226 PstS ABC-type phosphate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12679 cbl transcriptional regulator Cbl; Reviewed Back     alignment and domain information
>COG1840 AfuA ABC-type Fe3+ transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4134 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>TIGR00971 3a0106s03 sulfate ABC transporter, sulfate-binding protein; InterPro: IPR005669 Thiosulphate-binding proteins (gene cysP) specifically binds thiosulphate and are involved in the transport systems for this nutrients , Back     alignment and domain information
>PRK10677 modA molybdate transporter periplasmic protein; Provisional Back     alignment and domain information
>COG2998 TupB ABC-type tungstate transport system, permease component [Coenzyme metabolism] Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>COG1464 NlpA ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11480 tauA taurine transporter substrate binding subunit; Provisional Back     alignment and domain information
>COG2113 ProX ABC-type proline/glycine betaine transport systems, periplasmic components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3019 Predicted metal-binding protein [General function prediction only] Back     alignment and domain information
>PRK09861 cytoplasmic membrane lipoprotein-28; Provisional Back     alignment and domain information
>COG2182 MalE Maltose-binding periplasmic proteins/domains [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10974 glycerol-3-phosphate transporter periplasmic binding protein; Provisional Back     alignment and domain information
>PRK04168 hypothetical protein; Provisional Back     alignment and domain information
>COG1653 UgpB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0725 ModA ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01256 modA molybdate ABC transporter, periplasmic molybdate-binding protein; InterPro: IPR005950 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG1732 OpuBC Periplasmic glycine betaine/choline-binding (lipo)protein of an ABC-type transport system (osmoprotectant binding protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>pfam01547 SBP_bac_1 Bacterial extracellular solute-binding protein Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>PRK11063 metQ DL-methionine transporter substrate-binding subunit; Provisional Back     alignment and domain information
>PRK01326 prsA foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK12450 foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK10641 btuB vitamin B12/cobalamin outer membrane transporter; Provisional Back     alignment and domain information
>PRK03002 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target195 extracellular solute-binding protein [Candidatus Liberi
1q35_A 320 Crystal Structure Of Pasteurella Haemolytica Apo Fe 1e-23
2pt1_A 334 Futa1 Synechocystis Pcc 6803 Length = 334 2e-23
2voz_A 346 Apo Futa2 From Synechocystis Pcc6803 Length = 346 5e-22
1xvx_A 312 Crystal Structure Of Iron-Loaded Yersinia Enterocol 1e-21
1xvy_A 309 Crystal Structure Of Iron-Free Serratia Marcescens 6e-21
1y9u_A 323 Bordetella Ferric Binding Protein Length = 323 2e-19
1y4t_A 322 Ferric Binding Protein From Campylobacter Jejuni Le 5e-18
3kn8_A 309 Crystal Structure Of Haemophilus Influenzae Y196a M 2e-15
3kn7_A 309 Crystal Structure Of Haemophilus Influenzae Y195a M 2e-15
2o69_A 309 Crystal Structure Of Haemophilus Influenzae N193l M 3e-15
1qw0_A 309 Crystal Structure Of Haemophilus Influenzae N175l M 3e-15
1d9v_A 309 Haemophilus Influenzae Ferric-Binding Protein Apo F 3e-15
2o6a_A 309 Crystal Structure Of The Haemophilus Influenzae E57 4e-15
2o68_A 309 Crystal Structure Of Haemophilus Influenzae Q58l Mu 5e-15
1nnf_A 309 Crystal Structure Analysis Of Haemophlius Influenza 6e-15
1r1n_A 309 Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding 1e-14
1o7t_A 309 Metal Nanoclusters Bound To The Ferric Binding Prot 1e-14
1d9y_A 309 Neisseria Gonorrhoeae Ferric Binding Protein Length 1e-14
1qvs_A 309 Crystal Structure Of Haemophilus Influenzae H9a Mut 2e-14
2qry_A 330 Periplasmic Thiamin Binding Protein Length = 330 1e-06
>gi|39654597|pdb|1Q35|A Chain A, Crystal Structure Of Pasteurella Haemolytica Apo Ferric Ion- Binding Protein A Length = 320 Back     alignment and structure
 Score =  113 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 70/174 (40%), Gaps = 7/174 (4%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQGSPVDVIITKDE 82
              + +Y+ +   ++ P++ +FE+ TG+K++ I+       +     + SP DV++T D 
Sbjct: 1   ANEVNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADKGLVDRVKQEGELSPADVLLTVDI 60

Query: 83  TSLALNEDLLHKLPAH---LIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           + +    +           L K      ++ N +   ++   +V+  S  R+        
Sbjct: 61  SRVMEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDRVGKLPAGFD 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITANEILTK 192
             DL   ++K ++ +     S++  L   M +       + F++ + AN     
Sbjct: 121 YLDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKANLARKP 174


>gi|152149368|pdb|2PT1|A Chain A, Futa1 Synechocystis Pcc 6803 Length = 334 Back     alignment and structure
gi|170785082|pdb|2VOZ|A Chain A, Apo Futa2 From Synechocystis Pcc6803 Length = 346 Back     alignment and structure
>gi|61679630|pdb|1XVX|A Chain A, Crystal Structure Of Iron-Loaded Yersinia Enterocolitica Yfua Length = 312 Back     alignment and structure
>gi|61679631|pdb|1XVY|A Chain A, Crystal Structure Of Iron-Free Serratia Marcescens Sfua Length = 309 Back     alignment and structure
>gi|60594186|pdb|1Y9U|A Chain A, Bordetella Ferric Binding Protein Length = 323 Back     alignment and structure
>gi|60594117|pdb|1Y4T|A Chain A, Ferric Binding Protein From Campylobacter Jejuni Length = 322 Back     alignment and structure
>gi|306991649|pdb|3KN8|A Chain A, Crystal Structure Of Haemophilus Influenzae Y196a Mutant Holo Ferric Ion-Binding Protein A Length = 309 Back     alignment and structure
>gi|306991648|pdb|3KN7|A Chain A, Crystal Structure Of Haemophilus Influenzae Y195a Mutant Holo Ferric Ion-Binding Protein A Length = 309 Back     alignment and structure
>gi|145579974|pdb|2O69|A Chain A, Crystal Structure Of Haemophilus Influenzae N193l Mutant Fbpa Length = 309 Back     alignment and structure
>gi|38492941|pdb|1QW0|A Chain A, Crystal Structure Of Haemophilus Influenzae N175l Mutant Holo Ferric Ion-Binding Protein A Length = 309 Back     alignment and structure
>gi|6573533|pdb|1D9V|A Chain A, Haemophilus Influenzae Ferric-Binding Protein Apo Form Length = 309 Back     alignment and structure
>gi|145579975|pdb|2O6A|A Chain A, Crystal Structure Of The Haemophilus Influenzae E57a Mutant Fbpa Length = 309 Back     alignment and structure
>gi|145579973|pdb|2O68|A Chain A, Crystal Structure Of Haemophilus Influenzae Q58l Mutant Fbpa Length = 309 Back     alignment and structure
>gi|29726721|pdb|1NNF|A Chain A, Crystal Structure Analysis Of Haemophlius Influenzae Ferric- Ion Binding Protein H9q Mutant Form Length = 309 Back     alignment and structure
>gi|47168691|pdb|1R1N|A Chain A, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding Protein From N. Gonorrhoeae Length = 309 Back     alignment and structure
>gi|28948312|pdb|1O7T|A Chain A, Metal Nanoclusters Bound To The Ferric Binding Protein From Neisseria Gonorrhoeae. Length = 309 Back     alignment and structure
>gi|6573535|pdb|1D9Y|A Chain A, Neisseria Gonorrhoeae Ferric Binding Protein Length = 309 Back     alignment and structure
>gi|38492940|pdb|1QVS|A Chain A, Crystal Structure Of Haemophilus Influenzae H9a Mutant Holo Ferric Ion-Binding Protein A Length = 309 Back     alignment and structure
>gi|167013282|pdb|2QRY|A Chain A, Periplasmic Thiamin Binding Protein Length = 330 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target195 extracellular solute-binding protein [Candidatus Liberi
1xvx_A 312 YFUA; periplasmic iron binding protein; 1.53A {Yersinia 3e-12
3e13_X 322 Putative iron-uptake ABC transport system, periplasmic 4e-09
1q35_A 320 Iron binding protein FBPA; metal binding protein; 1.20A 1e-08
1nnf_A 309 Iron-utilization periplasmic protein; iron-binding prot 1e-08
1y9u_A 323 Putative iron binding protein; periplasmic binding prot 6e-06
2pt1_A 334 Iron transport protein; C-clamp, iron-binding protein, 4e-05
2xd3_A 416 MALX, maltose/maltodextrin-binding protein; solute-bind 5e-05
3c9h_A 355 ABC transporter, substrate binding protein; structural 0.003
3h3g_A 539 Fusion protein of maltose-binding periplasmic domain an 7e-04
3dm0_A 694 Maltose-binding periplasmic protein fused with RACK1; M 0.003
3f5f_A 658 Maltose-binding periplasmic protein, heparan sulfate 2- 0.004
1mg1_A 450 Protein (HTLV-1 GP21 ectodomain/maltose-binding protein 0.004
3iot_A 449 Maltose-binding protein, huntingtin fusion protein; HTT 0.002
1y4c_A 494 Maltose binding protein fused with designed helical pro 0.003
>1xvx_A YFUA; periplasmic iron binding protein; 1.53A {Yersinia enterocolitica} SCOP: c.94.1.1 PDB: 1xvy_A* Length = 312 Back     alignment and structure
 Score = 66.6 bits (161), Expect = 3e-12
 Identities = 37/171 (21%), Positives = 83/171 (48%), Gaps = 6/171 (3%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG--SPVDVII 78
           E+    + +Y  Q+++++   +  F + TG+K++        +    + +G  SP DV +
Sbjct: 1   ESNDSGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSASPADVFL 60

Query: 79  TKDETSL--ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADL 136
           T++  ++    N  L   L A    + +   + E+ +   I+  + V  Y+ ++I  A+L
Sbjct: 61  TENSPAMVLVDNAKLFAPLDAVTQAQVAQEYRPEHGRWTGIAARSTVFVYNPEKISEAEL 120

Query: 137 PKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           PKS+ DL   +WK R + +P+   F  +++ M +   +    +++K +  N
Sbjct: 121 PKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLKAMKTN 171


>3e13_X Putative iron-uptake ABC transport system, periplasmic iron-binding protein; beta sheet surrounded by alpha helices; 1.60A {Campylobacter jejuni} PDB: 1y4t_A Length = 322 Back     alignment and structure
>1q35_A Iron binding protein FBPA; metal binding protein; 1.20A {Mannheimia haemolytica} SCOP: c.94.1.1 PDB: 1si0_A 1si1_A Length = 320 Back     alignment and structure
>1nnf_A Iron-utilization periplasmic protein; iron-binding protein, EDTA-Fe-protein complex, metal binding protein; HET: EDT; 1.10A {Haemophilus influenzae} SCOP: c.94.1.1 PDB: 1mrp_A 1d9v_A 1qvs_A 2o6a_A 2o68_A 2o69_A 1qw0_A 1o7t_A* 1xc1_A* 1r1n_A* 1d9y_A Length = 309 Back     alignment and structure
>1y9u_A Putative iron binding protein; periplasmic binding protein, iron tyrosinate interaction, metal binding protein; 1.39A {Bordetella pertussis tohama I} SCOP: c.94.1.1 PDB: 2ows_A 2owt_A Length = 323 Back     alignment and structure
>2pt1_A Iron transport protein; C-clamp, iron-binding protein, solute-binding protein, periplasmic binding protein, ABC transporter, metal transport; 2.00A {Synechocystis SP} PDB: 2pt2_A 3f11_A Length = 334 Back     alignment and structure
>2xd3_A MALX, maltose/maltodextrin-binding protein; solute-binding protein, sugar binding protein, virulence, alpha-glucan, sugar transport; HET: GLC; 2.00A {Streptococcus pneumoniae} PDB: 2xd2_A* Length = 416 Back     alignment and structure
>3c9h_A ABC transporter, substrate binding protein; structural genomics, MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str} Length = 355 Back     alignment and structure
>3h3g_A Fusion protein of maltose-binding periplasmic domain and human parathyroid hormone...; GPCR, extracellular domain, PTHRP, PTH, PThr1, periplasm, sugar transport, transport, membrane protein; HET: MAL; 1.94A {Escherichia coli} PDB: 3c4m_A* 3l2j_A* 3ehs_A* 3ehu_A* 3eht_A* Length = 539 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3f5f_A Maltose-binding periplasmic protein, heparan sulfate 2-O-sulfotransferase 1; maltose binding protein, fusion, heparan sulfate biosynthesis; HET: GLC A3P; 2.65A {Escherichia coli k-12} Length = 658 Back     alignment and structure
>1mg1_A Protein (HTLV-1 GP21 ectodomain/maltose-binding protein chimera); human T cell leukemia virus type 1, envelope protein; HET: MAL; 2.50A {Human t-lymphotropic virus 1} SCOP: c.94.1.1 h.3.2.1 Length = 450 Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protein; HTT-EX1, HD, sugar transport, transport, apoptosis, cytoplasm, disease mutation; 3.50A {Escherichia coli k-12} PDB: 3ior_A 3iou_A 3iov_A 3iow_A Length = 449 Back     alignment and structure
>1y4c_A Maltose binding protein fused with designed helical protein; de novo designed helical protein, maltose binding protein fusion, de novo protein; HET: GLC; 1.90A {Escherichia coli} Length = 494 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target195 extracellular solute-binding protein [Candidatus Liberi
1xvx_A 312 YFUA; periplasmic iron binding protein; 1.53A {Yersinia 99.96
1nnf_A 309 Iron-utilization periplasmic protein; iron-binding prot 99.92
2qry_A 330 Thiamine-binding periplasmic protein; thiamin binding p 99.91
3e13_X 322 Putative iron-uptake ABC transport system, periplasmic 99.9
1q35_A 320 Iron binding protein FBPA; metal binding protein; 1.20A 99.89
2pt1_A 334 Iron transport protein; C-clamp, iron-binding protein, 99.85
2voz_A 346 FUTA2, periplasmic iron-binding protein; ferric binding 99.84
1y9u_A 323 Putative iron binding protein; periplasmic binding prot 99.82
3c9h_A 355 ABC transporter, substrate binding protein; structural 99.81
2v84_A 343 Spermidine/putrescine ABC transporter, periplasmic bind 99.72
1pot_A 325 POTD, spermidine/putrescine-binding protein; polyamine 99.69
1a99_A 344 POTF, putrescine-binding protein; transport, periplasmi 99.51
3gzg_A253 Molybdate-binding periplasmic protein; permease; molybd 99.41
1sbp_A 310 Sulfate-binding protein; 1.70A {Salmonella typhimurium} 99.35
2hxw_A237 Major antigenic peptide PEB3; periplasmic binding prote 99.32
1amf_A233 Molybdate transport protein MODA; periplasmic, binding 99.2
3mq9_A 471 Bone marrow stromal antigen 2 fused to maltose-BI perip 99.13
3kjt_A 372 Maltose-binding periplasmic protein; alternate conforma 99.11
3h3g_A 539 Fusion protein of maltose-binding periplasmic domain an 99.07
1r6z_P 509 Chimera of maltose-binding periplasmic protein and argo 99.05
3dm0_A 694 Maltose-binding periplasmic protein fused with RACK1; M 99.05
3lr1_A236 Tungstate ABC transporter, periplasmic tungstate- bindi 99.04
2vgq_A 477 Maltose-binding periplasmic protein, mitochondrial anti 99.03
3muq_A237 Uncharacterized conserved protein; structural genomics, 99.03
2nvu_B 805 Maltose binding protein/NEDD8-activating enzyme E1 cata 99.02
3iot_A 449 Maltose-binding protein, huntingtin fusion protein; HTT 98.99
1y4c_A 494 Maltose binding protein fused with designed helical pro 98.97
1hsj_A 487 Fusion protein consisting of staphylococcus accessary r 98.97
3k01_A 412 Acarbose/maltose binding protein GACH; ABC transporter, 98.96
2zxt_A 465 Maltose-binding periplasmic protein, linker, mitochondr 98.96
1mh3_A 421 Maltose binding-A1 homeodomain protein chimera; MATA1, 98.96
3o3u_N 581 Maltose-binding periplasmic protein, advanced Gly END p 98.95
1atg_A231 MODA, periplasmic molybdate-binding protein; tungstate, 98.94
3csg_A 461 MBP, maltose-binding protein monobody YS1 fusion, MMBP; 98.93
2zyo_A 397 Solute-binding protein; open form, sugar binding protei 98.93
2gha_A 382 Maltose ABC transporter, periplasmic maltose- binding p 98.92
3i3v_A 405 Probable secreted solute-binding lipoprotein; transport 98.87
3h4z_A 568 Maltose-binding periplasmic protein fused with Al DERP7 98.84
1twy_A 290 ABC transporter, periplasmic substrate-binding protein; 98.84
1urs_A 402 Maltose-binding protein; maltodextrin-binding protein, 98.8
2z8f_A 412 Galacto-N-biose/lacto-N-biose I transporter substrate-b 98.51
1us5_A 314 Putative GLUR0 ligand binding core; receptor, membrane 96.1
3f5f_A 658 Maltose-binding periplasmic protein, heparan sulfate 2- 98.98
2heu_A 401 Sugar ABC transporter, sugar-binding protein; periplasm 98.96
2xd3_A 416 MALX, maltose/maltodextrin-binding protein; solute-bind 98.82
2gh9_A 386 Maltose/maltodextrin-binding protein; MBP, maltose bind 98.75
3kn3_A242 Putative periplasmic protein; alpha-beta structure, per 98.7
3omb_A 535 Extracellular solute-binding protein, family 1; PSI-2, 98.56
1elj_A 381 Maltodextrin-binding protein; protein-carbohydrate comp 98.55
1eu8_A 409 Trehalose/maltose binding protein; protein-carbohydrate 98.28
2w7y_A 430 FCSSBP, probable sugar ABC transporter, sugar-binding p 98.25
2b3f_A 400 Glucose-binding protein; protein-carbohydrate complex, 98.1
3cvg_A 294 Putative metal binding protein; PSI-II, NYSGXRC, peripl 98.06
2uvj_A 408 TOGB, ABC type periplasmic sugar-binding protein; perip 98.04
3thi_A 371 Protein (thiaminase I); thiamin degradation, transferas 97.82
1j1n_A 492 ALGQ2; alginate, suger binding protein; HET: BEM MAV LG 97.11
2rin_A 298 Putative glycine betaine-binding ABC transporter protei 93.91
3k6v_A 354 Solute-binding protein MA_0280; MODA, molybdate, peripl 97.91
3cfx_A 296 UPF0100 protein MA_0280; ABC transporter, binding prote 97.91
3cfz_A 292 UPF0100 protein MJ1186; ABC transporter, binding protei 97.5
3cij_A 295 UPF0100 protein AF_0094; archaeal periplasmic binding p 97.33
3cg1_A 296 UPF0100 protein PF0080; ABC transporter, binding protei 97.28
2v25_A259 Major cell-binding factor; antigen, adhesin, aspartate, 96.56
1p99_A295 Hypothetical protein PG110; structural genomics, PSI, p 93.44
3myu_A 344 High affinity transport system protein P37; Mg289, CYPL 92.85
1xs5_A241 29 kDa protein, membrane lipoprotein TPN32; periplasmic 92.48
>1xvx_A YFUA; periplasmic iron binding protein; 1.53A {Yersinia enterocolitica} SCOP: c.94.1.1 PDB: 1xvy_A* Back     alignment and structure
Probab=99.96  E-value=3e-28  Score=179.59  Aligned_cols=166  Identities=21%  Similarity=0.393  Sum_probs=146.2

Q ss_pred             CCCCCEEEECCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHH---HH-HHCCCCCEEEECCHHHH--HHHHHHHCCCCC
Q ss_conf             4588089981899899999999999875986210000135667---65-21066655750422332--343310000123
Q gi|254780563|r   24 NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP---PI-TQGSPVDVIITKDETSL--ALNEDLLHKLPA   97 (195)
Q Consensus        24 ~~~~~lvVYs~~~~~~~~~~~~~Fek~tgIkV~~~~~~~~~~~---~~-~~~~~~d~~~~~d~~~l--~~~~~~l~~~~~   97 (195)
                      +.+++|+|||+++++.+++++++||++|||+|+++.+++.+..   .. ++++++|++++.+...+  ..+.+++.++.+
T Consensus         2 ~~~~~lvVYs~~~e~~~~~l~~~FeketGIkV~~~~~~~~~~~~ki~aeg~~~~~Dv~~~~~~~~~~~~~~~gl~~~~~~   81 (312)
T 1xvx_A            2 SNDSGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDA   81 (312)
T ss_dssp             CCCSCEEEEECSCHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHGGGCCCSEEEESSSHHHHHHHHTTCBCCCCH
T ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHCCHHHHHHH
T ss_conf             98984999979887799999999888659889999898099999999638999963999887789888775152454311


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEEEEEHHHHCCCCCCCCHHHHCCHHHCCEEEECCCCCCHHHHHHHHHHHHCHHHH
Q ss_conf             42223472000122222344345058887334401344557888840866768599628983049999999996086999
Q gi|254780563|r   98 HLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV  177 (195)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~P~sw~DL~~p~~kG~i~~~~~~~s~~~~~~a~~~~~G~~~~  177 (195)
                      ....++++.+++++++|+++.....+++||++.++..++|+||+||.+|.++|+++++.++.++..++..+....|.+.+
T Consensus        82 ~~~~~i~~~~~~~~~~~~~~~~~~~~~~yn~~~~~~~~~P~t~~dl~~~~~~g~~~~~~~~~~~~~~~~~~~~~~g~~~~  161 (312)
T 1xvx_A           82 VTQAQVAQEYRPEHGRWTGIAARSTVFVYNPEKISEAELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKAT  161 (312)
T ss_dssp             HHHHHBCGGGSCSSSSCEEEEEEEEEEEECTTTSCGGGSCSSGGGGGSGGGTTSEEECTTSHHHHHHHHHHHHHHCHHHH
T ss_pred             CCHHHHHHHHCCCCCEEEEEEEEEEEEEECHHHCCCCCCCCCHHHHHCCHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             00222236526679808999864699997100146566987899871402124210120145688998876641335679


Q ss_pred             HHHHHHHHHCCC
Q ss_conf             999999860887
Q gi|254780563|r  178 QDFIKNITANEI  189 (195)
Q Consensus       178 ~~~l~~l~~N~~  189 (195)
                      +++++.++.|..
T Consensus       162 ~~~~~~~~~~~~  173 (312)
T 1xvx_A          162 LEWLKAMKTNFT  173 (312)
T ss_dssp             HHHHHHHHHHEE
T ss_pred             HHHHHHHHHCCC
T ss_conf             999986310441



>1nnf_A Iron-utilization periplasmic protein; iron-binding protein, EDTA-Fe-protein complex, metal binding protein; HET: EDT; 1.10A {Haemophilus influenzae} SCOP: c.94.1.1 PDB: 1mrp_A 1d9v_A 1qvs_A 2o6a_A 2o68_A 2o69_A 1qw0_A 1o7t_A* 1xc1_A* 1r1n_A* 1d9y_A Back     alignment and structure
>2qry_A Thiamine-binding periplasmic protein; thiamin binding protein, ABC transporter, transport protein; HET: TPS; 2.25A {Escherichia coli} Back     alignment and structure
>3e13_X Putative iron-uptake ABC transport system, periplasmic iron-binding protein; beta sheet surrounded by alpha helices; 1.60A {Campylobacter jejuni} PDB: 1y4t_A Back     alignment and structure
>1q35_A Iron binding protein FBPA; metal binding protein; 1.20A {Mannheimia haemolytica} SCOP: c.94.1.1 PDB: 1si0_A 1si1_A Back     alignment and structure
>2pt1_A Iron transport protein; C-clamp, iron-binding protein, solute-binding protein, periplasmic binding protein, ABC transporter, metal transport; 2.00A {Synechocystis SP} PDB: 2pt2_A 3f11_A Back     alignment and structure
>2voz_A FUTA2, periplasmic iron-binding protein; ferric binding protein, metal-binding protein, TAT; 1.70A {Synechocystis SP} PDB: 2vp1_A* Back     alignment and structure
>1y9u_A Putative iron binding protein; periplasmic binding protein, iron tyrosinate interaction, metal binding protein; 1.39A {Bordetella pertussis tohama I} SCOP: c.94.1.1 PDB: 2ows_A 2owt_A Back     alignment and structure
>3c9h_A ABC transporter, substrate binding protein; structural genomics, MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>2v84_A Spermidine/putrescine ABC transporter, periplasmic binding protein; polyamine binding, syphilis, lipoprotein, transport protein; HET: MES; 1.78A {Treponema pallidum} Back     alignment and structure
>1pot_A POTD, spermidine/putrescine-binding protein; polyamine transport protein; HET: SPD; 1.80A {Escherichia coli} SCOP: c.94.1.1 PDB: 1poy_1* Back     alignment and structure
>1a99_A POTF, putrescine-binding protein; transport, periplasmic putrescine binding protein (POTF); 2.20A {Escherichia coli} SCOP: c.94.1.1 Back     alignment and structure
>3gzg_A Molybdate-binding periplasmic protein; permease; molybdate complex, mutant K127S, metal binding protein; 1.55A {Xanthomonas axonopodis PV} PDB: 2h5y_A Back     alignment and structure
>1sbp_A Sulfate-binding protein; 1.70A {Salmonella typhimurium} SCOP: c.94.1.1 Back     alignment and structure
>2hxw_A Major antigenic peptide PEB3; periplasmic binding protein, N-glycosylation, structural genomics; HET: FLC; 1.60A {Campylobacter jejuni} PDB: 3fjm_A 3fjg_A 3fir_A* 3fj7_A* Back     alignment and structure
>1amf_A Molybdate transport protein MODA; periplasmic, binding protein; 1.75A {Escherichia coli} SCOP: c.94.1.1 PDB: 1wod_A Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3kjt_A Maltose-binding periplasmic protein; alternate conformation, sugar transport, transpor transport protein; 1.50A {Escherichia coli k-12} PDB: 3hpi_A 1anf_A* 1dmb_A* 1ez9_A* 1jw4_A 1jw5_A* 1lls_A 1omp_A 2d21_A 2r6g_E* 3mbp_A* 4mbp_A* 1fqa_A* 1fqb_A* 1fqc_A* 1fqd_A* 1ezo_A 1ezp_A 2h25_A 2klf_A ... Back     alignment and structure
>3h3g_A Fusion protein of maltose-binding periplasmic domain and human parathyroid hormone...; GPCR, extracellular domain, PTHRP, PTH, PThr1, periplasm, sugar transport, transport, membrane protein; HET: MAL; 1.94A {Escherichia coli} PDB: 3c4m_A* 3l2j_A* 3ehs_A* 3ehu_A* 3eht_A* Back     alignment and structure
>1r6z_P Chimera of maltose-binding periplasmic protein and argonaute 2; deviant OB fold, RNAI, gene regulation; HET: MAL; 2.80A {Escherichia coli} SCOP: b.34.14.1 c.94.1.1 PDB: 1t2r_A 1t2s_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3lr1_A Tungstate ABC transporter, periplasmic tungstate- binding protein; the tungstate ABC transporter, structural genomics, PSI, MCSG; 1.80A {Geobacter sulfurreducens} Back     alignment and structure
>2vgq_A Maltose-binding periplasmic protein, mitochondrial antiviral-signaling protein; immune system/transport, IPS1/MAVS/VISA/cardif; HET: MTT; 2.1A {Escherichia coli} Back     alignment and structure
>3muq_A Uncharacterized conserved protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.05A {Vibrio parahaemolyticus} Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protein; HTT-EX1, HD, sugar transport, transport, apoptosis, cytoplasm, disease mutation; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>1y4c_A Maltose binding protein fused with designed helical protein; de novo designed helical protein, maltose binding protein fusion, de novo protein; HET: GLC; 1.90A {Escherichia coli} Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>3k01_A Acarbose/maltose binding protein GACH; ABC transporter, acarbose-binding protein, transport protein; 1.35A {Streptomyces glaucescens} PDB: 3jzj_A* 3k00_A* 3k02_A* Back     alignment and structure
>2zxt_A Maltose-binding periplasmic protein, linker, mitochondrial intermembrane space import...; disulfide bond, alpha helix, fusion, sugar transport; HET: MAL; 3.00A {Escherichia coli} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3cjj_A 2e5e_A Back     alignment and structure
>1atg_A MODA, periplasmic molybdate-binding protein; tungstate, ABC transporter; 1.20A {Azotobacter vinelandii} SCOP: c.94.1.1 Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* 3g7v_A* Back     alignment and structure
>2zyo_A Solute-binding protein; open form, sugar binding protein; HET: GLC; 1.55A {Thermoactinomyces vulgaris} PDB: 2zyk_A* 2zym_A* 2zyn_A* 2dfz_A* Back     alignment and structure
>2gha_A Maltose ABC transporter, periplasmic maltose- binding protein; periplasmic binding protein, MBP, maltotriose, sugar binding protein; HET: MLR; 1.60A {Thermotoga maritima MSB8} PDB: 2ghb_A 2fnc_A* Back     alignment and structure
>3i3v_A Probable secreted solute-binding lipoprotein; transporter, PSI-II, structural genomics, protein structure initiative; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>3h4z_A Maltose-binding periplasmic protein fused with Al DERP7; MBP fusion, AHA1/BPI domain-like, super roll, sugar T transport, allergen; HET: GLC; 2.35A {Escherichia coli} PDB: 1mg1_A* Back     alignment and structure
>1twy_A ABC transporter, periplasmic substrate-binding protein; nysgxrc target, structural genomics, protein structure initiative; 1.65A {Vibrio cholerae o1 biovar eltor str} SCOP: c.94.1.1 Back     alignment and structure
>1urs_A Maltose-binding protein; maltodextrin-binding protein, acidophIle, thermoacidophIle, hyperthermophIle, thermophIle; HET: MLR; 1.45A {Alicyclobacillus acidocaldarius} SCOP: c.94.1.1 PDB: 1urg_A* 1urd_A* Back     alignment and structure
>2z8f_A Galacto-N-biose/lacto-N-biose I transporter substrate-binding protein; ABC transporter, mucin core-1, human MILK oligosacchalide; HET: BGC GAL NAG MES; 1.65A {Bifidobacterium longum} PDB: 2z8e_A* 2z8d_A* Back     alignment and structure
>1us5_A Putative GLUR0 ligand binding core; receptor, membrane protein, glutamate receptor, L-glutamate; HET: GLU; 1.5A {Thermus thermophilus} SCOP: c.94.1.1 PDB: 1us4_A* Back     alignment and structure
>3f5f_A Maltose-binding periplasmic protein, heparan sulfate 2-O-sulfotransferase 1; maltose binding protein, fusion, heparan sulfate biosynthesis; HET: GLC A3P; 2.65A {Escherichia coli k-12} Back     alignment and structure
>2heu_A Sugar ABC transporter, sugar-binding protein; periplasmic binding protein, transport protein; 1.04A {Streptococcus pneumoniae} PDB: 2hq0_A 2i58_A* 2hfb_A Back     alignment and structure
>2xd3_A MALX, maltose/maltodextrin-binding protein; solute-binding protein, sugar binding protein, virulence, alpha-glucan, sugar transport; HET: GLC; 2.00A {Streptococcus pneumoniae} PDB: 2xd2_A* Back     alignment and structure
>2gh9_A Maltose/maltodextrin-binding protein; MBP, maltose binding protein, thermophilic protein, periplasmic binding protein; HET: MLR; 1.95A {Thermus thermophilus HB27} Back     alignment and structure
>3kn3_A Putative periplasmic protein; alpha-beta structure, periplasmic binding protein fold, structural genomics, PSI-2; HET: GTT CIT; 2.41A {Wolinella succinogenes} Back     alignment and structure
>3omb_A Extracellular solute-binding protein, family 1; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG; 2.10A {Bifidobacterium longum subsp} Back     alignment and structure
>1elj_A Maltodextrin-binding protein; protein-carbohydrate complex, maltose binding protein, MBP fold, ABC transporter fold, thermophilic protein; HET: CME GLC; 1.85A {Pyrococcus furiosus} SCOP: c.94.1.1 Back     alignment and structure
>1eu8_A Trehalose/maltose binding protein; protein-carbohydrate complex, MBP 2 fold, ABC transporter fold, thermophilic protein; HET: TRE; 1.90A {Thermococcus litoralis} SCOP: c.94.1.1 Back     alignment and structure
>2w7y_A FCSSBP, probable sugar ABC transporter, sugar-binding protein; solute-binding protein, blood group antigen, carbohydrate transport; HET: A2G GAL FUC; 2.35A {Streptococcus pneumoniae} Back     alignment and structure
>2b3f_A Glucose-binding protein; protein-carbohydrate complex, periplasmic binding protein, galactose, GBP, sugar binding protein; HET: GAL; 1.56A {Thermus thermophilus HB27} PDB: 2b3b_A* Back     alignment and structure
>3cvg_A Putative metal binding protein; PSI-II, NYSGXRC, periplasmic, structural genomics, protein structure initiative; 1.97A {Coccidioides immitis RS} Back     alignment and structure
>2uvj_A TOGB, ABC type periplasmic sugar-binding protein; periplasmic binding protein, pectin degradation, trigalacturonic acid; HET: ADA; 1.8A {Yersinia enterocolitica} PDB: 2uvi_A* 2uvh_A* 2uvg_A Back     alignment and structure
>3thi_A Protein (thiaminase I); thiamin degradation, transferase; 2.00A {Bacillus subtilis} SCOP: c.94.1.1 PDB: 2thi_A 4thi_A Back     alignment and structure
>1j1n_A ALGQ2; alginate, suger binding protein; HET: BEM MAV LGU; 1.60A {Sphingomonas SP} SCOP: c.94.1.1 PDB: 1kwh_A 1y3n_A* 1y3p_A* 1y3q_A Back     alignment and structure
>2rin_A Putative glycine betaine-binding ABC transporter protein; type II binding protein, aromatic BOX, acetylcholine, protein binding; HET: ACH; 1.80A {Rhizobium meliloti} PDB: 2rej_A 2rf1_A 2reg_A* 3hcq_A Back     alignment and structure
>3k6v_A Solute-binding protein MA_0280; MODA, molybdate, periplasmic binding protein, ABC transporter, transport protein, ligand; HET: CIT; 1.69A {Methanosarcina acetivorans} PDB: 3k6u_A* 3k6w_A 3k6x_A Back     alignment and structure
>3cfx_A UPF0100 protein MA_0280; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.60A {Methanosarcina acetivorans} Back     alignment and structure
>3cfz_A UPF0100 protein MJ1186; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3cij_A UPF0100 protein AF_0094; archaeal periplasmic binding protein, unknown function, metal binding protein, transport protein; 1.07A {Archaeoglobus fulgidus} PDB: 2ons_A 2onk_E 2onr_A Back     alignment and structure
>3cg1_A UPF0100 protein PF0080; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.60A {Pyrococcus furiosus} PDB: 3cg3_A Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>1p99_A Hypothetical protein PG110; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.70A {Staphylococcus aureus subsp} SCOP: c.94.1.1 Back     alignment and structure
>3myu_A High affinity transport system protein P37; Mg289, CYPL, extracytoplasmic, thiamine binding protein, lipoprotein; HET: VIB; 1.95A {Mycoplasma genitalium} Back     alignment and structure
>1xs5_A 29 kDa protein, membrane lipoprotein TPN32; periplasmic binding protein, methionine, membrane protein; 1.85A {Treponema pallidum} SCOP: c.94.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 195 extracellular solute-binding protein [Candidatus Liberi
d1xvxa_ 311 c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia ent 1e-13
d1q35a_ 318 c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia h 5e-09
d1y4ta_ 317 c.94.1.1 (A:) Ferric-binding protein FbpA {Campylobacte 4e-08
d1nnfa_ 308 c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus 9e-08
d1y9ua_ 318 c.94.1.1 (A:) Ferric-binding protein FbpA {Bordetella p 2e-06
d1atga_231 c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobac 0.002
>d1xvxa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia enterocolitica, YfuA [TaxId: 630]} Length = 311 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Ferric-binding protein FbpA
species: Yersinia enterocolitica, YfuA [TaxId: 630]
 Score = 69.7 bits (169), Expect = 1e-13
 Identities = 36/165 (21%), Positives = 81/165 (49%), Gaps = 6/165 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG--SPVDVIITKDETS 84
           + +Y  Q+++++   +  F + TG+K++        +    + +G  SP DV +T++  +
Sbjct: 6   IVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSASPADVFLTENSPA 65

Query: 85  L--ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           +    N  L   L A    + +   + E+ +   I+  + V  Y+ ++I  A+LPKS+ D
Sbjct: 66  MVLVDNAKLFAPLDAVTQAQVAQEYRPEHGRWTGIAARSTVFVYNPEKISEAELPKSIMD 125

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           L   +WK R + +P+   F  +++ M +   +    +++K +  N
Sbjct: 126 LAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLKAMKTN 170


>d1q35a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]} Length = 318 Back     information, alignment and structure
>d1y4ta_ c.94.1.1 (A:) Ferric-binding protein FbpA {Campylobacter jejuni [TaxId: 197]} Length = 317 Back     information, alignment and structure
>d1nnfa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus influenzae [TaxId: 727]} Length = 308 Back     information, alignment and structure
>d1y9ua_ c.94.1.1 (A:) Ferric-binding protein FbpA {Bordetella pertussis [TaxId: 520]} Length = 318 Back     information, alignment and structure
>d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]} Length = 231 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target195 extracellular solute-binding protein [Candidatus Liberi
d1xvxa_ 311 Ferric-binding protein FbpA {Yersinia enterocolitica, Y 99.97
d1q35a_ 318 Ferric-binding protein FbpA {Mannheimia haemolytica [Ta 99.96
d1nnfa_ 308 Ferric-binding protein FbpA {Haemophilus influenzae [Ta 99.93
d1y4ta_ 317 Ferric-binding protein FbpA {Campylobacter jejuni [TaxI 99.91
d1y9ua_ 318 Ferric-binding protein FbpA {Bordetella pertussis [TaxI 99.84
d1pota_ 322 Spermidine/putrescine-binding protein PotD {Escherichia 99.69
d1sbpa_ 309 Sulphate-binding protein {Salmonella typhimurium [TaxId 99.43
d1amfa_231 Molybdate-binding protein, ModA {Escherichia coli [TaxI 99.25
d1a99a_ 341 Putrescine receptor (PotF) {Escherichia coli [TaxId: 56 99.2
d1atga_231 Molybdate-binding protein, ModA {Azotobacter vinelandii 99.0
d1laxa_ 369 D-maltodextrin-binding protein, MBP {Escherichia coli [ 98.87
d1ursa_ 367 D-maltodextrin-binding protein, MBP {Alicyclobacillus a 98.64
d1twya_249 ABC transporter, periplasmic substrate-binding protein 97.31
d1elja_ 380 D-maltodextrin-binding protein, MBP {Archaeon Pyrococcu 98.65
d1eu8a_ 407 D-maltodextrin-binding protein, MBP {Archaeon Thermococ 98.23
d3thia_ 362 Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 492 97.91
d1j1na_ 492 Alginate-binding periplasmic protein AlgQ2 {Sphingomona 97.25
d2onsa1 311 Molybdate-binding protein, ModA {Archaeoglobus fulgidus 97.56
d1p99a_255 Putative lipoprotein (NlpA family) {Staphylococcus aure 90.23
>d1xvxa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia enterocolitica, YfuA [TaxId: 630]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Ferric-binding protein FbpA
species: Yersinia enterocolitica, YfuA [TaxId: 630]
Probab=99.97  E-value=3.7e-30  Score=189.15  Aligned_cols=164  Identities=21%  Similarity=0.397  Sum_probs=145.3

Q ss_pred             CCCCEEEECCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHH---HH-HHCCCCCEEEECCHHHH--HHHHHHHCCCCCC
Q ss_conf             588089981899899999999999875986210000135667---65-21066655750422332--3433100001234
Q gi|254780563|r   25 TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP---PI-TQGSPVDVIITKDETSL--ALNEDLLHKLPAH   98 (195)
Q Consensus        25 ~~~~lvVYs~~~~~~~~~~~~~Fek~tgIkV~~~~~~~~~~~---~~-~~~~~~d~~~~~d~~~l--~~~~~~l~~~~~~   98 (195)
                      .+++|||||+++++.+++++++|||+|||+|+++.+++.+..   .. +.++++|++++.+...+  ....+++.++.+.
T Consensus         2 ~~~~lvvYs~~~~~~~~~ii~~Fek~tGI~V~~~~~~s~~l~~ki~aeg~~~~~Dv~~~~d~~~~~~~~~~~l~~~~~~~   81 (311)
T d1xvxa_           2 NDSGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAV   81 (311)
T ss_dssp             CCSCEEEEECSCHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHGGGCCCSEEEESSSHHHHHHHHTTCBCCCCHH
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHCCCCCCCCCC
T ss_conf             99709999798877999999999886698899998985999999997478999878997878999988755862222333


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEEEEEEHHHHCCCCCCCCHHHHCCHHHCCEEEECCCCCCHHHHHHHHHHHHCHHHHH
Q ss_conf             22234720001222223443450588873344013445578888408667685996289830499999999960869999
Q gi|254780563|r   99 LIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQ  178 (195)
Q Consensus        99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~P~sw~DL~~p~~kG~i~~~~~~~s~~~~~~a~~~~~G~~~~~  178 (195)
                      ...++++.+++++++|+++.....+++||++.++..++|++|+||++|+|||++++++++.++..+...+....|.+.++
T Consensus        82 ~~~~i~~~~~d~~~~~~~~~~~~~~i~yn~~~~~~~~~P~t~~dl~~~~~~g~~~~~~~~~~~~~~~~~~~~~~g~~~~~  161 (311)
T d1xvxa_          82 TQAQVAQEYRPEHGRWTGIAARSTVFVYNPEKISEAELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATL  161 (311)
T ss_dssp             HHHHBCGGGSCSSSSCEEEEEEEEEEEECTTTSCGGGSCSSGGGGGSGGGTTSEEECTTSHHHHHHHHHHHHHHCHHHHH
T ss_pred             CCCCCCCCCCCCCCCEEEEEECEEEEEEECCCCCCCCCCCCHHHHCCHHHHCCCCCCHHHHHHHHHHHHHHHHCCCHHHH
T ss_conf             32235521003478122210032899986110454569855776426022023222112557999999999841827789


Q ss_pred             HHHHHHHHCC
Q ss_conf             9999986088
Q gi|254780563|r  179 DFIKNITANE  188 (195)
Q Consensus       179 ~~l~~l~~N~  188 (195)
                      +|+++|+.|.
T Consensus       162 ~~~~~l~~~~  171 (311)
T d1xvxa_         162 EWLKAMKTNF  171 (311)
T ss_dssp             HHHHHHHHHE
T ss_pred             HHHHHHHCCC
T ss_conf             9998751254



>d1q35a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]} Back     information, alignment and structure
>d1nnfa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y4ta_ c.94.1.1 (A:) Ferric-binding protein FbpA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1y9ua_ c.94.1.1 (A:) Ferric-binding protein FbpA {Bordetella pertussis [TaxId: 520]} Back     information, alignment and structure
>d1pota_ c.94.1.1 (A:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sbpa_ c.94.1.1 (A:) Sulphate-binding protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1amfa_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a99a_ c.94.1.1 (A:) Putrescine receptor (PotF) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1laxa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ursa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1twya_ c.94.1.1 (A:) ABC transporter, periplasmic substrate-binding protein VCA0807 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1elja_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]} Back     information, alignment and structure