254780567

254780567

hypothetical protein CLIBASIA_02270

GeneID in NCBI database:8209564Locus tag:CLIBASIA_02270
Protein GI in NCBI database:254780567Protein Accession:YP_003064980.1
Gene range:+(714486, 715226)Protein Length:246aa
Gene description:hypothetical protein
COG prediction:[L] ATPase involved in DNA replication initiation
KEGG prediction:hypothetical protein
SEED prediction:Chromosomal replication initiator protein DnaA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:DNA-replication
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MNLMKEDYSFFVPDKQKNDQPKNKEEQLFFSFPRCLGISRDDLLVHSAIEQAVRLIDSWPSWPSRVVILVGPSGSGKSCLANIWSDKSRSTRFSNIAKSLDSILIDTRKPVLLEDIDLLDFNDTQLFHIINSIHQYDSSLLMTARTFPVSWGVCLPDLCSRLKAATVVKISLPDDDFLEKVIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEVLKETQQCD
ccccHHHHHEEccccccccccccccccccccccccccccHHHccccccHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHEEccHHHccccHHHHHHHHHHHHHcccEEEEEEccccHHcccccHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccc
ccHccccHcccccccccccccccccccccccccccccccccccEEcccHHHHHHHHHHccccccccEEEEccccccHHHHHHHHHHHcccccHHHHHHHHcHHHHHHcccEEEEccccccccHHHHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHEEEcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHcHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccc
mnlmkedysffvpdkqkndqpknkeeqlffsfprclgisrddLLVHSAIEQAVRLIdswpswpsrvvilvgpsgsgksclaniwsdksrstRFSNIAKSLDSilidtrkpvlledidlldfndtqLFHIINSIHQYdssllmtartfpvswgvclpdlCSRLKAATVVkislpdddFLEKVIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEVLKETQQCD
mnlmkedysffvpdkqkndqpkNKEEQLFFSFPRCLGISRDDLLVHSAIEQAVRlidswpswpSRVVILvgpsgsgksclaniwsdksrstRFSNIAKSLDSILIDTRKPVLLEDIDLLDFNDTQLFHIINSIHQYDSSLLMTARTFPVSWGVCLPDLCSRLKAATVVkislpdddfLEKVIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEVLKETQQCD
MNLMKEDYSFFVPDKQKNDQPKNKEEQLFFSFPRCLGISRDDLLVHSAIEQAVRLIDSWPSWPSRVVILVGPSGSGKSCLANIWSDKSRSTRFSNIAKSLDSILIDTRKPVLLEDIDLLDFNDTQLFHIINSIHQYDSSLLMTARTFPVSWGVCLPDLCSRLKAATVVKISLPDDDFLEKVIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEVLKETQQCD
*****EDYSF********************SFPRCLGISRDDLLVHSAIEQAVRLIDSWPSWPSRVVILVGPSGSGKSCLANIWSDKSRSTRFSNIAKSLDSILIDTRKPVLLEDIDLLDFNDTQLFHIINSIHQYDSSLLMTARTFPVSWGVCLPDLCSRLKAATVVKISLPDDDFLEKVIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEV*KE*****
MNLMKEDYSFFVPDKQKNDQPKNKEEQLFFSFPRCLGISRDDLLVHSAIEQAVRLIDSWPSWPSRVVILVGPSGSGKSCLANIWSDKSRSTRFSNIAKSLDSILIDTRKPVLLEDIDLLDFNDTQLFHIINSIHQYDSSLLMTARTFPVSWGVCLPDLCSRLKAATVVKISLPDDDFLEKVIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEVLKETQQCD
*****ED******************EQLFFSFPRCLGISRDDLLVHSAIEQAVRLIDSWPSWPSRVVILVGPSGSGKSCLANIWSDKSRSTRFSNIAKSLDSILIDTRKPVLLEDIDLLDFNDTQLFHIINSIHQYDSSLLMTARTFPVSWGVCLPDLCSRLKAATVVKISLPDDDFLEKVIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEVLKET****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLMKEDYSFFVPDKQKNDQPKNKEEQLFFSFPRCLGISRDDLLVHSAIEQAVRLIDSWPSWPSRVVILVGPSGSGKSCLANIWSDKSRSTRFSNIAKSLDSILIDTRKPVLLEDIDLLDFNDTQLFHIINSIHQYDSSLLMTARTFPVSWGVCLPDLCSRLKAATVVKISLPDDDFLEKVIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEVLKETQQCD
MNLMKEDYSFFVPDKQKNDQPKNKEEQLFFSFPRCLGISRDDLLVHSAIEQAVRLIDSWPSWPSRVVILVGPSGSGKSCLANIWSDKSRSTRFSNIAKSLDSILIDTRKPVLLEDIDLLDFNDTQLFHIINSIHQYDSSLLMTARTFPVSWGVCLPDLCSRLKAATVVKISLPDDDFLEKVIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEVLKETQQCD
MNLMKEDYSFFVPDKQKNDQPKNKEEQLFFSFPRCLGISRDDLLVHSAIEQAVRLIDSWPSWPSRVVILVGPSGSGKSCLANIWSDKSRSTRFSNIAKSLDSILIDTRKPVLLEDIDLLDFNDTQLFHIINSIHQYDSSLLMTARTFPVSWGVCLPDLCSRLKAATVVKISLPDDDFLEKVIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEVLKETQQCD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target246 hypothetical protein CLIBASIA_02270 [Candidatus Liberib
254781060249 ABC transporter, nucleotide binding/ATPase protein 0.009
254780718240 putative high-affinity zinc uptake system ATP-bind 0.013
254780552334 Holliday junction DNA helicase RuvB [Candidatus Li 0.048
>gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Back     alignment
 Score = 32.0 bits (71), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 18/23 (78%)

Query: 63 PSRVVILVGPSGSGKSCLANIWS 85
          PS VV ++GP+GSGKS L+ + S
Sbjct: 28 PSEVVAIMGPNGSGKSTLSYLLS 50

>gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Back     alignment
 Score = 31.6 bits (70), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 63 PSRVVILVGPSGSGKSCLANIWSDKSRST 91
          P+ +V L+GP+GSGKS +A + +   + T
Sbjct: 35 PNEIVTLIGPNGSGKSTIAKLITGIIKPT 63

>gi|254780552|ref|YP_003064965.1| Holliday junction DNA helicase RuvB [Candidatus Liberibacter asiaticus str. psy62] Length = 334 Back     alignment
 Score = 29.6 bits (65), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 67  VILVGPSGSGKSCLANIWSDKS----RSTRFSNIAKSLDSILIDTRKPVLLEDIDLLDFN 122
           V+ VGP G GK+ LA + + +     RST    IAK+ D   + T     LED D+L  +
Sbjct: 57  VLFVGPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTN----LEDRDVLFID 112

Query: 123 DTQLFHII 130
           +     II
Sbjct: 113 EIHRLSII 120

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target246 hypothetical protein CLIBASIA_02270 [Candidatus Liberib
315121761247 hypothetical protein CKC_00055 [Candidatus Liberibacter 1 1e-100
222085485237 DNA replication initiation ATPase protein [Agrobacteriu 1 7e-62
325292517242 DNA replication initiation ATPase protein [Agrobacteriu 1 4e-61
218675452237 hypothetical protein RetlG_30801 [Rhizobium etli GR56] 1 1e-59
327192210237 hypothetical protein RHECNPAF_237005 [Rhizobium etli CN 1 2e-59
190891172237 hypothetical protein RHECIAT_CH0001558 [Rhizobium etli 1 3e-59
209548700237 hypothetical protein Rleg2_1097 [Rhizobium leguminosaru 1 2e-58
86357128237 hypothetical protein RHE_CH01490 [Rhizobium etli CFN 42 1 2e-58
241203978237 hypothetical protein Rleg_1243 [Rhizobium leguminosarum 1 3e-58
116251364237 hypothetical protein RL1598 [Rhizobium leguminosarum bv 1 3e-58
>gi|315121761|ref|YP_004062250.1| hypothetical protein CKC_00055 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 247 Back     alignment and organism information
 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/247 (74%), Positives = 210/247 (85%), Gaps = 2/247 (0%)

Query: 1   MNLMKEDYSFFVPDKQKNDQPKNKEEQLFFSFPRCLG-ISRDDLLVHSAIEQAVRLIDSW 59
           MN + + Y+   P K++ D+ K K EQLF SFPRC   I+RDDLLVH +IEQAVR+IDSW
Sbjct: 1   MNFITKGYNLVFPAKERVDRGK-KGEQLFLSFPRCFTKINRDDLLVHDSIEQAVRIIDSW 59

Query: 60  PSWPSRVVILVGPSGSGKSCLANIWSDKSRSTRFSNIAKSLDSILIDTRKPVLLEDIDLL 119
           PSW S  +I VGPSGSGKSCLANIWS KS++ R S +A+ LDS LIDTRKP+LLED D  
Sbjct: 60  PSWISPTMIFVGPSGSGKSCLANIWSQKSKAQRLSGLARGLDSSLIDTRKPILLEDADRF 119

Query: 120 DFNDTQLFHIINSIHQYDSSLLMTARTFPVSWGVCLPDLCSRLKAATVVKISLPDDDFLE 179
           D NDT+LFHIINSIHQ+DSSLLMTARTFPVSW V LPDL SRLKAAT+VK+SLPDDDFLE
Sbjct: 120 DLNDTELFHIINSIHQHDSSLLMTARTFPVSWSVRLPDLRSRLKAATIVKMSLPDDDFLE 179

Query: 180 KVIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEVL 239
           K IVKMFADRQIFID++LA YIVQRMERSLVFAEKLV++MD+LALSRG GITRSLA+EVL
Sbjct: 180 KAIVKMFADRQIFIDERLAFYIVQRMERSLVFAEKLVNRMDDLALSRGTGITRSLASEVL 239

Query: 240 KETQQCD 246
           +E Q+CD
Sbjct: 240 EEIQKCD 246


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085485|ref|YP_002544015.1| DNA replication initiation ATPase protein [Agrobacterium radiobacter K84] Length = 237 Back     alignment and organism information
>gi|325292517|ref|YP_004278381.1| DNA replication initiation ATPase protein [Agrobacterium sp. H13-3] Length = 242 Back     alignment and organism information
>gi|218675452|ref|ZP_03525121.1| hypothetical protein RetlG_30801 [Rhizobium etli GR56] Length = 237 Back     alignment and organism information
>gi|327192210|gb|EGE59179.1| hypothetical protein RHECNPAF_237005 [Rhizobium etli CNPAF512] Length = 237 Back     alignment and organism information
>gi|190891172|ref|YP_001977714.1| hypothetical protein RHECIAT_CH0001558 [Rhizobium etli CIAT 652] Length = 237 Back     alignment and organism information
>gi|209548700|ref|YP_002280617.1| hypothetical protein Rleg2_1097 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 237 Back     alignment and organism information
>gi|86357128|ref|YP_469020.1| hypothetical protein RHE_CH01490 [Rhizobium etli CFN 42] Length = 237 Back     alignment and organism information
>gi|241203978|ref|YP_002975074.1| hypothetical protein Rleg_1243 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 237 Back     alignment and organism information
>gi|116251364|ref|YP_767202.1| hypothetical protein RL1598 [Rhizobium leguminosarum bv. viciae 3841] Length = 237 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target246 hypothetical protein CLIBASIA_02270 [Candidatus Liberib
PRK09087226 PRK09087, PRK09087, hypothetical protein; Validated 7e-75
PRK06620214 PRK06620, PRK06620, hypothetical protein; Validated 3e-22
PRK05642234 PRK05642, PRK05642, DNA replication initiation factor; 1e-06
COG0593408 COG0593, DnaA, ATPase involved in DNA replication initi 7e-31
TIGR03420226 TIGR03420, DnaA_homol_Hda, DnaA regulatory inactivator 8e-14
PRK08903227 PRK08903, PRK08903, DnaA regulatory inactivator Hda; Va 3e-07
PRK08727233 PRK08727, PRK08727, hypothetical protein; Validated 3e-06
PRK06893229 PRK06893, PRK06893, DNA replication initiation factor; 0.001
TIGR00362405 TIGR00362, DnaA, chromosomal replication initiator prot 0.002
>gnl|CDD|169652 PRK09087, PRK09087, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|168630 PRK06620, PRK06620, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|168147 PRK05642, PRK05642, DNA replication initiation factor; Validated Back     alignment and domain information
>gnl|CDD|30938 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|163254 TIGR03420, DnaA_homol_Hda, DnaA regulatory inactivator Hda Back     alignment and domain information
>gnl|CDD|181578 PRK08903, PRK08903, DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>gnl|CDD|181541 PRK08727, PRK08727, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|168719 PRK06893, PRK06893, DNA replication initiation factor; Validated Back     alignment and domain information
>gnl|CDD|161840 TIGR00362, DnaA, chromosomal replication initiator protein DnaA Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 246 hypothetical protein CLIBASIA_02270 [Candidatus Liberib
PRK09087226 hypothetical protein; Validated 100.0
PRK08084235 DNA replication initiation factor; Provisional 100.0
PRK06620214 hypothetical protein; Validated 100.0
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 100.0
PRK08903227 hypothetical protein; Validated 100.0
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 100.0
PRK05642234 DNA replication initiation factor; Validated 100.0
PRK08727233 hypothetical protein; Validated 100.0
PRK06893229 DNA replication initiation factor; Validated 100.0
PRK00149447 dnaA chromosomal replication initiation protein; Review 100.0
PRK12422 455 chromosomal replication initiation protein; Provisional 100.0
pfam00308219 Bac_DnaA Bacterial dnaA protein. 100.0
TIGR00362 493 DnaA chromosomal replication initiator protein DnaA; In 99.96
PRK13342 417 recombination factor protein RarA; Reviewed 99.78
PRK13341 726 recombination factor protein RarA/unknown domain fusion 99.75
PRK04195 403 replication factor C large subunit; Provisional 99.7
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 99.7
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.68
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 99.66
PRK00440318 rfc replication factor C small subunit; Reviewed 99.66
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 99.65
PRK12402337 replication factor C small subunit 2; Reviewed 99.63
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 99.48
TIGR02397 363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 99.47
KOG2028 554 consensus 99.46
KOG0989346 consensus 99.43
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 99.42
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 99.41
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 99.38
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 99.36
PRK00411 394 cdc6 cell division control protein 6; Reviewed 99.32
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 99.31
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 99.31
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 99.31
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 99.28
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 99.28
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 99.26
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 99.25
CHL00176 631 ftsH cell division protein; Validated 99.25
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 99.2
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.1
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 99.1
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 99.08
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 99.08
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 99.08
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 99.05
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 99.02
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 99.02
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 99.02
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 99.01
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 98.94
TIGR02902 532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 98.93
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 98.92
TIGR02903 616 spore_lon_C ATP-dependent protease, Lon family; InterPr 98.91
KOG1969 877 consensus 98.68
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 98.64
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 98.62
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 98.56
PRK09112352 DNA polymerase III subunit delta'; Validated 98.56
PRK10365441 transcriptional regulatory protein ZraR; Provisional 98.54
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 98.53
KOG0731 774 consensus 98.47
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 98.46
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 98.45
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 98.42
KOG0734 752 consensus 98.39
PRK07399314 DNA polymerase III subunit delta'; Validated 98.29
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational modi 98.07
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 98.04
KOG0991333 consensus 98.01
PRK05022510 anaerobic nitric oxide reductase transcription regulato 97.97
KOG0742630 consensus 97.95
COG1221403 PspF Transcriptional regulators containing an AAA-type 97.82
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 97.64
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 97.62
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 97.62
KOG2170344 consensus 97.58
COG2204464 AtoC Response regulator containing CheY-like receiver, 97.55
KOG0741 744 consensus 97.33
COG0714329 MoxR-like ATPases [General function prediction only] 97.24
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 97.13
KOG0990360 consensus 97.09
TIGR01817 574 nifA Nif-specific regulatory protein; InterPro: IPR0101 97.0
TIGR02442 688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 96.61
TIGR00390 463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 96.53
COG3284606 AcoR Transcriptional activator of acetoin/glycerol meta 95.98
COG2842297 Uncharacterized ATPase, putative transposase [General f 95.16
PRK08116262 hypothetical protein; Validated 99.63
PRK06921265 hypothetical protein; Provisional 99.47
PRK07952242 DNA replication protein DnaC; Validated 99.43
PRK06835330 DNA replication protein DnaC; Validated 99.42
PRK12377248 putative replication protein; Provisional 99.33
PRK09183258 transposase/IS protein; Provisional 99.18
PRK08181269 transposase; Validated 99.17
PRK06526254 transposase; Provisional 99.14
COG1484254 DnaC DNA replication protein [DNA replication, recombin 99.09
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 98.74
KOG0738491 consensus 98.59
CHL00095 823 clpC Clp protease ATP binding subunit 98.29
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 98.12
KOG0743457 consensus 98.08
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 97.92
KOG2228 408 consensus 97.76
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 97.71
PRK07132303 DNA polymerase III subunit delta'; Validated 97.54
PRK00300208 gmk guanylate kinase; Provisional 97.16
KOG0741744 consensus 97.07
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 97.06
COG1162301 Predicted GTPases [General function prediction only] 95.17
PRK03992390 proteasome-activating nucleotidase; Provisional 99.4
CHL00195491 ycf46 Ycf46; Provisional 99.14
KOG0730693 consensus 99.14
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 99.07
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 98.94
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 98.91
KOG0735 952 consensus 98.89
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 98.87
KOG2035351 consensus 98.83
CHL00181287 cbbX CbbX; Provisional 98.8
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 98.77
KOG0733802 consensus 98.74
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 98.7
KOG0740428 consensus 98.66
PRK11608325 pspF phage shock protein operon transcriptional activat 98.59
PTZ00112 650 origin recognition complex 1 protein; Provisional 98.57
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 98.53
KOG1514 767 consensus 98.5
pfam05621302 TniB Bacterial TniB protein. This family consists of se 98.48
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 98.47
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 98.43
KOG0727408 consensus 98.4
KOG0726440 consensus 98.36
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 98.33
KOG2004 906 consensus 98.31
PRK10865857 protein disaggregation chaperone; Provisional 98.22
CHL00095823 clpC Clp protease ATP binding subunit 98.18
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 98.15
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 98.14
COG1373 398 Predicted ATPase (AAA+ superfamily) [General function p 98.01
KOG1970 634 consensus 97.96
KOG0728404 consensus 97.87
KOG1968 871 consensus 97.81
KOG0729435 consensus 97.79
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 97.75
KOG0736 953 consensus 97.69
PRK06585 343 holA DNA polymerase III subunit delta; Reviewed 97.59
KOG0732 1080 consensus 97.56
pfam00493327 MCM MCM2/3/5 family. 97.5
KOG2227 529 consensus 97.31
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 97.17
smart00350509 MCM minichromosome maintenance proteins. 97.09
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 96.88
KOG2543 438 consensus 96.59
PRK06762166 hypothetical protein; Provisional 96.16
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 96.1
PRK05818262 DNA polymerase III subunit delta'; Validated 96.07
TIGR02974349 phageshock_pspF psp operon transcriptional activator Ps 95.22
COG1241682 MCM2 Predicted ATPase involved in replication control, 95.01
PRK06217185 hypothetical protein; Validated 94.92
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 99.25
PRK08939306 primosomal protein DnaI; Reviewed 99.16
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 97.12
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 95.87
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 95.4
PRK09354 350 recA recombinase A; Provisional 94.9
KOG0733 802 consensus 98.75
KOG0730 693 consensus 98.63
pfam03969361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 98.59
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 98.53
KOG0737386 consensus 98.43
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 98.28
pfam00004131 AAA ATPase family associated with various cellular acti 98.26
KOG0652424 consensus 98.13
KOG0744423 consensus 98.09
KOG0739439 consensus 98.09
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 97.83
PRK08769319 DNA polymerase III subunit delta'; Validated 97.66
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Esch 97.66
PRK07940 395 DNA polymerase III subunit delta'; Validated 97.56
KOG0736953 consensus 97.5
PRK08233182 hypothetical protein; Provisional 97.28
PRK06871324 DNA polymerase III subunit delta'; Validated 97.26
PRK05707328 DNA polymerase III subunit delta'; Validated 97.2
PRK11784333 tRNA 2-selenouridine synthase; Provisional 97.13
PRK03731172 aroL shikimate kinase II; Reviewed 97.12
PRK02496185 adk adenylate kinase; Provisional 97.05
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 97.02
pfam00625182 Guanylate_kin Guanylate kinase. 96.94
PRK06090319 DNA polymerase III subunit delta'; Validated 96.93
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 96.9
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 96.85
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 96.68
PRK07993334 DNA polymerase III subunit delta'; Validated 96.67
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 96.59
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 96.55
TIGR00678216 holB DNA polymerase III, delta' subunit; InterPro: IPR0 96.5
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 96.5
PRK07261171 topology modulation protein; Provisional 96.48
KOG0478 804 consensus 96.41
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 96.34
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 96.31
PRK00889175 adenylylsulfate kinase; Provisional 96.23
PRK13949169 shikimate kinase; Provisional 96.19
PTZ00088225 adenylate kinase 1; Provisional 96.15
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 96.05
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 95.94
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 95.81
TIGR02322183 phosphon_PhnN phosphonate metabolism protein/1,5-bispho 95.79
PRK13808 297 adenylate kinase; Provisional 95.65
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 95.61
TIGR00017223 cmk cytidylate kinase; InterPro: IPR003136 This family 95.5
pfam00406186 ADK Adenylate kinase. 95.49
PRK03846198 adenylylsulfate kinase; Provisional 95.4
PRK05541176 adenylylsulfate kinase; Provisional 95.24
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 95.22
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 94.97
KOG0735952 consensus 98.57
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 98.44
PRK05564313 DNA polymerase III subunit delta'; Validated 98.43
PRK07471363 DNA polymerase III subunit delta'; Validated 98.21
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 98.19
pfam00931285 NB-ARC NB-ARC domain. 98.14
PRK08058329 DNA polymerase III subunit delta'; Validated 97.72
PRK04841 903 transcriptional regulator MalT; Provisional 97.59
PRK08118167 topology modulation protein; Reviewed 96.9
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 95.88
TIGR01618229 phage_P_loop phage nucleotide-binding protein; InterPro 95.68
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 98.49
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 98.38
KOG1942456 consensus 98.0
PRK07452 326 DNA polymerase III subunit delta; Validated 97.8
COG1466 334 HolA DNA polymerase III, delta subunit [DNA replication 97.79
PRK13407334 bchI magnesium chelatase subunit I; Provisional 97.61
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 96.95
pfam06144172 DNA_pol3_delta DNA polymerase III, delta subunit. DNA p 96.68
PRK04132863 replication factor C small subunit; Provisional 96.55
KOG2680454 consensus 94.76
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 98.47
PRK06964342 DNA polymerase III subunit delta'; Validated 96.48
PRK10536262 hypothetical protein; Provisional 95.21
COG1485367 Predicted ATPase [General function prediction only] 98.46
KOG2383 467 consensus 97.74
KOG0651388 consensus 97.65
PRK11545177 gntK gluconate kinase 1; Provisional 97.29
PRK09825176 idnK D-gluconate kinase; Provisional 97.17
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 97.15
KOG3354191 consensus 96.44
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome biog 96.26
COG3265161 GntK Gluconate kinase [Carbohydrate transport and metab 95.62
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 98.36
PRK10865 857 protein disaggregation chaperone; Provisional 98.29
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 97.78
smart00382148 AAA ATPases associated with a variety of cellular activ 97.24
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 97.08
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 97.08
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 96.97
COG3842 352 PotA ABC-type spermidine/putrescine transport systems, 96.88
COG3839 338 MalK ABC-type sugar transport systems, ATPase component 96.88
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 96.81
PRK00131175 aroK shikimate kinase; Reviewed 96.79
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 96.78
PRK13947171 shikimate kinase; Provisional 96.76
pfam07726131 AAA_3 ATPase family associated with various cellular ac 96.74
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 96.7
PRK05057172 aroK shikimate kinase I; Reviewed 96.7
PRK05917290 DNA polymerase III subunit delta'; Validated 96.68
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 96.59
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 96.59
PRK00091 304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.56
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 96.55
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 96.54
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 96.52
pfam03266168 DUF265 Protein of unknown function, DUF265. 96.52
PHA02244383 ATPase-like protein 96.46
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 96.41
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 96.4
PRK13946195 shikimate kinase; Provisional 96.34
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 96.33
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 96.33
TIGR02142 361 modC_ABC molybdate ABC transporter, ATP-binding protein 96.32
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 96.31
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 96.31
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 96.3
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 96.29
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 96.28
PRK13900332 type IV secretion system ATPase VirB11; Provisional 96.28
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 96.28
COG4525259 TauB ABC-type taurine transport system, ATPase componen 96.27
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 96.2
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 96.19
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 96.19
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 96.17
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 96.16
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provisiona 96.16
TIGR01189204 ccmA heme ABC exporter, ATP-binding protein CcmA; Inter 96.12
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 96.11
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 96.1
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 96.1
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereus E33 96.07
TIGR00954788 3a01203 Peroxysomal long chain fatty acyl transporter; 96.04
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, ATPa 96.04
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 96.04
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 96.04
PRK00279215 adk adenylate kinase; Reviewed 96.03
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 96.02
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 96.0
PRK10070 400 glycine betaine transporter ATP-binding subunit; Provis 95.99
TIGR01187 331 potA polyamine ABC transporter, ATP-binding protein; In 95.98
PRK08699 325 DNA polymerase III subunit delta'; Validated 95.95
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 95.95
PRK11144 352 modC molybdate transporter ATP-binding protein; Provisi 95.95
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 95.92
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 95.91
PRK10851 352 sulfate/thiosulfate transporter subunit; Provisional 95.91
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 95.9
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 95.89
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 95.88
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 95.84
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 95.84
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 95.83
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 95.82
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 95.82
PRK11650 358 ugpC glycerol-3-phosphate transporter ATP-binding subun 95.81
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 95.81
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 95.81
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 95.81
COG0606 490 Predicted ATPase with chaperone activity [Posttranslati 95.79
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 95.78
TIGR00618 1063 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins 95.78
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 95.78
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 95.77
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 95.76
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 95.76
KOG0060659 consensus 95.75
COG4619223 ABC-type uncharacterized transport system, ATPase compo 95.74
cd03234226 ABCG_White The White subfamily represents ABC transport 95.73
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 95.69
KOG3347176 consensus 95.67
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 95.66
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 95.65
pfam02367123 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This 95.65
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 95.63
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.6
PRK13768253 GTPase; Provisional 95.6
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 95.6
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IISP) Fa 95.57
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 95.57
TIGR02525374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 95.56
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 95.56
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like protei 95.55
PRK10246 1047 exonuclease subunit SbcC; Provisional 95.55
PRK13948182 shikimate kinase; Provisional 95.52
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 95.51
cd03246173 ABCC_Protease_Secretion This family represents the ABC 95.51
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 95.51
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 95.5
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 95.5
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 95.49
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.48
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 95.47
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.47
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 95.47
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 95.46
pfam02456 370 Adeno_IVa2 Adenovirus IVa2 protein. IVa2 protein can in 95.43
PRK10908222 cell division protein FtsE; Provisional 95.43
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 95.4
PRK13544208 consensus 95.4
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 95.37
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 95.36
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 95.36
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 95.35
PRK07667190 uridine kinase; Provisional 95.34
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 95.34
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 95.34
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 95.33
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 95.33
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 95.31
cd01394218 radB RadB. The archaeal protein radB shares similarity 95.29
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 95.28
PRK10744257 phosphate transporter subunit; Provisional 95.27
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 95.26
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 95.26
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 95.25
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 95.25
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 95.24
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.24
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 95.22
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 95.21
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 95.21
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 95.2
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 95.19
TIGR02546430 III_secr_ATP type III secretion apparatus H+-transporti 95.17
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 95.17
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 95.17
PRK11607 377 potG putrescine transporter ATP-binding subunit; Provis 95.17
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.16
PTZ00301210 uridine kinase; Provisional 95.15
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.14
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 95.14
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 95.13
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 95.13
PRK13542224 consensus 95.09
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 95.08
COG2884223 FtsE Predicted ATPase involved in cell division [Cell d 95.08
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.07
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 95.07
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 95.07
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 95.06
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 95.06
PRK03839180 putative kinase; Provisional 95.06
PRK10522547 multidrug transporter membrane component/ATP-binding co 95.04
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 95.04
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 95.02
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 95.02
PRK10646153 putative ATPase; Provisional 95.02
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 95.01
PRK10790593 putative multidrug transporter membrane\ATP-binding com 95.01
COG0419 908 SbcC ATPase involved in DNA repair [DNA replication, re 95.01
COG4133209 CcmA ABC-type transport system involved in cytochrome c 95.0
PRK12288344 ribosome-associated GTPase; Reviewed 95.0
PRK03918 882 chromosome segregation protein; Provisional 94.99
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 94.99
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 94.97
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 94.96
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 94.95
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.95
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 94.95
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 94.95
COG0324 308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 94.94
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 94.94
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 94.92
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.91
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 94.9
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 94.89
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.89
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 94.89
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 94.89
COG4107258 PhnK ABC-type phosphonate transport system, ATPase comp 94.88
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.87
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 94.86
COG3911183 Predicted ATPase [General function prediction only] 94.83
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 94.83
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.82
PRK00625173 shikimate kinase; Provisional 94.81
PRK05480209 uridine kinase; Provisional 94.81
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 94.79
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 94.79
TIGR00929 931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 94.75
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 94.7
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.7
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.7
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 94.7
PRK05574 336 holA DNA polymerase III subunit delta; Reviewed 98.03
PRK08487 328 DNA polymerase III subunit delta; Validated 96.72
PRK05629 331 hypothetical protein; Validated 96.42
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 97.69
PRK13695174 putative NTPase; Provisional 96.99
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 95.56
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 95.28
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 96.71
TIGR00368 505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 96.53
COG4178604 ABC-type uncharacterized transport system, permease and 96.39
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like subgro 96.25
PRK13894320 conjugal transfer ATPase TrbB; Provisional 96.18
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.07
cd00106328 KISc Kinesin motor domain. This catalytic (head) domain 96.0
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like group. K 95.95
pfam06309127 Torsin Torsin. This family consists of several eukaryot 95.94
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup 95.9
PRK12289351 ribosome-associated GTPase; Reviewed 95.89
PRK13764 605 ATPase; Provisional 95.81
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily. Me 95.81
PRK13833323 conjugal transfer protein TrbB; Provisional 95.8
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup 95.78
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subg 95.75
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup 95.69
pfam00225321 Kinesin Kinesin motor domain. 95.61
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 95.57
cd01374321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subg 95.54
KOG0242 675 consensus 95.51
PRK00098298 ribosome-associated GTPase; Reviewed 95.5
PRK10789569 putative multidrug transporter membrane\ATP-binding com 95.5
PRK01889353 ribosome-associated GTPase; Reviewed 95.47
pfam03193161 DUF258 Protein of unknown function, DUF258. 95.45
PRK10436461 hypothetical protein; Provisional 95.44
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 95.38
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain 95.37
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) r 95.35
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle po 95.34
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 95.24
COG1341 398 Predicted GTPase or GTP-binding protein [General functi 95.22
KOG4280 574 consensus 95.21
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 95.2
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Microtubu 95.17
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_lik 95.14
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-l 95.06
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 94.81
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 94.72
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 96.68
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 95.78
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08903 hypothetical protein; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>pfam00308 Bac_DnaA Bacterial dnaA protein Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA; InterPro: IPR001957 The bacterial dnaA protein , , plays an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR004605 All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763 This entry represents the well-conserved first N-terminal domain of DnaX, approx Back     alignment and domain information
>KOG2028 consensus Back     alignment and domain information
>KOG0989 consensus Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07270 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK06674 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK08853 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06872 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05648 DNA polymerase III subunits gamma and tau; Reviewed Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB; InterPro: IPR014251 This entry represents LonB, a paralog of the ATP-dependent protease La (LonA, IPR004815 from INTERPRO) Back     alignment and domain information
>PRK08770 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252 This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria Back     alignment and domain information
>KOG1969 consensus Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated