254780565

254780565

hypothetical protein CLIBASIA_02260

GeneID in NCBI database:8209562Locus tag:CLIBASIA_02260
Protein GI in NCBI database:254780565Protein Accession:YP_003064978.1
Gene range:+(716042, 716251)Protein Length:69aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------7
MSQTRLSIPKSRMNLAVEDKETRLYRRYWEGEYKTSGRVSSFKKSSFGFYIVMLLSFFAGVLVSFFGLI
cccccccccHHHHcEEHHHHHHHHHHHHHccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHcc
ccccEEccccccccEEEcccccHEEHEHHcccEcccccEcccccccHHHHHHHHHHHHHHHHHHHHccc
msqtrlsipksrmnlavedkETRLYRRYwegeyktsgrvssfkksSFGFYIVMLLSFFAGVLVSFFGLI
msqtrlsipksrmnlavedketrlyrrywegeyktsgrvssfKKSSFGFYIVMLLSFFAGVLVSFFGLI
MSQTRLSIPKSRMNLAVEDKETRLYRRYWEGEYKTSGRVSSFKKSSFGFYIVMLLSFFAGVLVSFFGLI
***********RMNLAVEDKETRLYRRYWEG**************SFGFYIVMLLSFFAGVLVSFFGLI
MSQTRLSIPKSRMNLAVEDKETRLYRRYWEGEYKTSGRVSSFKKSSFGFYIVMLLSFFAGVLVSFFGLI
*****LSIPKSRMNLAVEDKETRLYRRYWEGEYKTSGRVSSFKKSSFGFYIVMLLSFFAGVLVSFFGLI
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQTRLSIPKSRMNLAVEDKETRLYRRYWEGEYKTSGRVSSFKKSSFGFYIVMLLSFFAGVLVSFFGLI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target69 hypothetical protein CLIBASIA_02260 [Candidatus Liberib
31512175969 hypothetical protein CKC_00045 [Candidatus Liberibacter 1 1e-21
>gi|315121759|ref|YP_004062248.1| hypothetical protein CKC_00045 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 69 Back     alignment and organism information
 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (82%)

Query: 1  MSQTRLSIPKSRMNLAVEDKETRLYRRYWEGEYKTSGRVSSFKKSSFGFYIVMLLSFFAG 60
          M QTRLS+PKSR+NLA EDKE RLYRRYWEGEYK+S      KKSS GFYI++++SFFAG
Sbjct: 1  MDQTRLSVPKSRINLAAEDKEMRLYRRYWEGEYKSSCHAPDSKKSSLGFYILIVVSFFAG 60

Query: 61 VLVSFFGLI 69
          VL SFFG +
Sbjct: 61 VLFSFFGFL 69


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00