254780569

254780569

phosphoribosylaminoimidazole synthetase

GeneID in NCBI database:8209566Locus tag:CLIBASIA_02280
Protein GI in NCBI database:254780569Protein Accession:YP_003064982.1
Gene range:-(713180, 714253)Protein Length:357aa
Gene description:phosphoribosylaminoimidazole synthetase
COG prediction:[F] Phosphoribosylaminoimidazole (AIR) synthetase
KEGG prediction:purM; phosphoribosylaminoimidazole synthetase (EC:6.3.3.1); K01933 phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
SEED prediction:Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Subsystem involved in SEED:De Novo Purine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------
MNHERKRGLTYGQAGVNIEAGNRTVTQIKSAVKSTKRAGTIGEIGGFGGLFDLKKAGFVDPILVSSSDGVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQATSIIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAGDLILGLPSSGLHSNGFALVRKIISLSQLSWKDPSPISSEHSLGETLLTPTRIYVSPLLKILRKTGKIKALAHITGGGLTENIPRAIPAHLTASINLNSVEVPQIISWLSKKAHVKPAEVLRTFNCGIGMVIIVHPDNKDCIIKKFQENNENIILIGEVTQRSEKSPPILYQGSLIL
ccccccccccHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccEEccccccccccEEEEEcccccHHHHHHHHcccccHHHHHHHHHcHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccEEEcccccccccccccccEEEEEEEEEEEcHHHcccHHHcccccEEEEEcccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHccccEEEEEHHHccccHHHHHHHHHccccHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHccccEEEEEEEEEcccccEEEEEEccEEc
ccccccccccccccccccHHHHHHHHHHHHHHHccccccEEcccccccEEHHcHHcccccEEEEEEEEEcccHHHHHHHccccccHHHHHHHHHHHHHHHHccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHccEEEEEEEEEcccccccccEEEEEEEEEEEEccccccccccccccEEEEEEccccccccHHHHHHHHHHccccccccccccccccHHHHHcccccEEEHHHHHHHHHHccccEEEEccccHHHHHcccccccccEEEEcHHHccccHHHHHHHHHHcccHHHHcccccccEEEEEEEcHHHHHHHHHHHHcccccEEEEEEEEEccccccEEEEEccccc
mnherkrgltygqagvnieagnrTVTQIKSAVKStkragtigeiggfgglfdlkkagfvdpilvsssdgvgTKLKIAIETGKNDTIGIDLVAMCVNDIlthgaeplfFLDYLatsqlnpdqaTSIIKGIAAGCCQAgcaliggetaempglyhdrdydlagFAVGAVErkellspenvcagdlilglpssglhsnGFALVRKIISLSqlswkdpspissehslgetlltptriyVSPLLKILRKTGKIKALAHitgggltenipraipAHLTASINLNSVEVPQIISWLSkkahvkpaevLRTFNCGIGMViivhpdnkdCIIKKFQENNENIILIGevtqrseksppilyqgslil
mnherkrgltygqagvnieagnrtvTQIKSavkstkragtigeIGGFGGLFDLKKAGFVDPILvsssdgvgTKLKIAIetgkndtiGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQATSIIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAGDLILGLPSSGLHSNGFALVRKIISLSQLSWKDPSPissehslgetlltptrIYVSPLLKILRKTGKIKALAHITGGGLTENIPRAIPAHLTASINLNSVEVPQIISWLSKKAHVKPAEVLRTFNCGIGMVIIVHPDNKDCIIKKFQENNENIILigevtqrseksppilyqgslil
MNHERKRGLTYGQAGVNIEAGNRTVTQIKSAVKSTKRAgtigeiggfggLFDLKKAGFVDPILVSSSDGVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQATSiikgiaagccqagcaliggETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAGDLILGLPSSGLHSNGFALVRKIISLSQLSWKDPSPISSEHSLGETLLTPTRIYVSPLLKILRKTGKIKALAHITGGGLTENIPRAIPAHLTASINLNSVEVPQIISWLSKKAHVKPAEVLRTFNCGIGMVIIVHPDNKDCIIKKFQENNENIILIGEVTQRSEKSPPILYQGSLIL
************QAGVNIEAGNRTVTQIKSAVKSTKRAGTIGEIGGFGGLFDLKKAGFVDPILVSSSDGVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQATSIIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAGDLILGLPSSGLHSNGFALVRKIISLSQLSWKDPSPISSEHSLGETLLTPTRIYVSPLLKILRKTGKIKALAHITGGGLTENIPRAIPAHLTASINLNSVEVPQIISWLSKKAHVKPAEVLRTFNCGIGMVIIVHPDNKDCIIKKFQENNENIILIGEVTQRSEKSPPILYQGSLIL
********LTYGQAGVNIEAGNRTVTQI*********AGTIGEIGGFGGLFDLKKAGFVDPILVSSSDGVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQATSIIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAGDLILGLPSSGLHSNGFALVRKIISLSQLSWKDPSPISSEHSLGETLLTPTRIYVSPLLKILRKTGKIKALAHITGGGLTENIPRAIPAHLTASINLNSVEVPQIISWLSKKAHVKPAEVLRTFNCGIGMVIIVHPDNKDCIIKKFQENNENIILIGEVTQRSEKSPPILYQGSLIL
******RGLTYGQAGVNIEAGNRTVTQIKSAVKSTKRAGTIGEIGGFGGLFDLKKAGFVDPILVSSSDGVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQATSIIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAGDLILGLPSSGLHSNGFALVRKIISLSQLSWKDPSPISSEHSLGETLLTPTRIYVSPLLKILRKTGKIKALAHITGGGLTENIPRAIPAHLTASINLNSVEVPQIISWLSKKAHVKPAEVLRTFNCGIGMVIIVHPDNKDCIIKKFQENNENIILIGEVTQRSEKSPPILYQGSL**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNHERKRGLTYGQAGVNIEAGNRTVTQIKSAVKSTKRAGTIGEIGGFGGLFDLKKAGFVDPILVSSSDGVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQATSIIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAGDLILGLPSSGLHSNGFALVRKIISLSQLSWKDPSPISSEHSLGETLLTPTRIYVSPLLKILRKTGKIKALAHITGGGLTENIPRAIPAHLTASINLNSVEVPQIISWLSKKAHVKPAEVLRTFNCGIGMVIIVHPDNKDCIIKKFQENNENIILIGEVTQRSEKSPPILYQGSLIL
MNHERKRGLTYGQAGVNIEAGNRTVTQIKSAVKSTKRAGTIGEIGGFGGLFDLKKAGFVDPILVSSSDGVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQATSIIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAGDLILGLPSSGLHSNGFALVRKIISLSQLSWKDPSPISSEHSLGETLLTPTRIYVSPLLKILRKTGKIKALAHITGGGLTENIPRAIPAHLTASINLNSVEVPQIISWLSKKAHVKPAEVLRTFNCGIGMVIIVHPDNKDCIIKKFQENNENIILIGEVTQRSEKSPPILYQGSLIL
MNHERKRGLTYGQAGVNIEAGNRTVTQIKSAVKSTKRAGTIGEIGGFGGLFDLKKAGFVDPILVSSSDGVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQATSIIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAGDLILGLPSSGLHSNGFALVRKIISLSQLSWKDPSPISSEHSLGETLLTPTRIYVSPLLKILRKTGKIKALAHITGGGLTENIPRAIPAHLTASINLNSVEVPQIISWLSKKAHVKPAEVLRTFNCGIGMVIIVHPDNKDCIIKKFQENNENIILIGEVTQRSEKSPPILYQGSLIL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target357 phosphoribosylaminoimidazole synthetase [Candidatus Lib
315121762357 phosphoribosylaminoimidazole synthetase [Candidatus Lib 1 1e-164
222085483357 5'-phosphoribosyl-5-aminoimidazole synthetase protein [ 1 1e-127
327192208357 phosphoribosylformylglycinamidine cyclo-ligase protein 1 1e-126
190891170357 phosphoribosylformylglycinamidine cyclo-ligase [Rhizobi 1 1e-126
325292515357 5'-phosphoribosyl-5-aminoimidazole synthetase [Agrobact 1 1e-126
209548698357 phosphoribosylaminoimidazole synthetase [Rhizobium legu 1 1e-126
159184635357 phosphoribosylaminoimidazole synthetase [Agrobacterium 1 1e-125
116251362357 phosphoribosylaminoimidazole synthetase [Rhizobium legu 1 1e-125
241203976357 phosphoribosylaminoimidazole synthetase [Rhizobium legu 1 1e-125
86357126357 phosphoribosylaminoimidazole synthetase [Rhizobium etli 1 1e-124
>gi|315121762|ref|YP_004062251.1| phosphoribosylaminoimidazole synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 357 Back     alignment and organism information
 Score =  583 bits (1503), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 281/357 (78%), Positives = 319/357 (89%)

Query: 1   MNHERKRGLTYGQAGVNIEAGNRTVTQIKSAVKSTKRAGTIGEIGGFGGLFDLKKAGFVD 60
           MNH ++  LTY  +GVNIEAGNRTVTQIKS +KST RAGTIGEIGGFG LFDLKKAGFVD
Sbjct: 1   MNHGKENRLTYSDSGVNIEAGNRTVTQIKSTLKSTDRAGTIGEIGGFGALFDLKKAGFVD 60

Query: 61  PILVSSSDGVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPD 120
           PILVSSSDG+GTK+KIA E GKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATS+LNPD
Sbjct: 61  PILVSSSDGIGTKVKIAAEMGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSKLNPD 120

Query: 121 QATSIIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCA 180
           +A+ IIKGIA GC QAGCALIGGETAEMPGLYH +DYDLAGFAVGA ER ELLSPENVC 
Sbjct: 121 EASDIIKGIAEGCRQAGCALIGGETAEMPGLYHGKDYDLAGFAVGAAERNELLSPENVCK 180

Query: 181 GDLILGLPSSGLHSNGFALVRKIISLSQLSWKDPSPISSEHSLGETLLTPTRIYVSPLLK 240
           GDLILGLPSSGLHSNGF+LVRKIISLS+LSW+DPSPISS+HSLGETLL PTRIYV PLL+
Sbjct: 181 GDLILGLPSSGLHSNGFSLVRKIISLSRLSWQDPSPISSQHSLGETLLNPTRIYVKPLLE 240

Query: 241 ILRKTGKIKALAHITGGGLTENIPRAIPAHLTASINLNSVEVPQIISWLSKKAHVKPAEV 300
           +++KT KIKALAHITGGGLTENIPR IP HL A+I L+S++VP+IISWLSKKA+++  E+
Sbjct: 241 VIKKTKKIKALAHITGGGLTENIPRVIPHHLMANIYLDSIKVPEIISWLSKKANIESTEI 300

Query: 301 LRTFNCGIGMVIIVHPDNKDCIIKKFQENNENIILIGEVTQRSEKSPPILYQGSLIL 357
           LRT NCGIGM++I+  DN+D IIK F+E+ E+II  GEV +R+ K  PILY+GSL+L
Sbjct: 301 LRTLNCGIGMIVIISQDNRDSIIKIFKEHGEDIIHCGEVIERNNKISPILYKGSLML 357


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085483|ref|YP_002544013.1| 5'-phosphoribosyl-5-aminoimidazole synthetase protein [Agrobacterium radiobacter K84] Length = 357 Back     alignment and organism information
>gi|327192208|gb|EGE59177.1| phosphoribosylformylglycinamidine cyclo-ligase protein [Rhizobium etli CNPAF512] Length = 357 Back     alignment and organism information
>gi|190891170|ref|YP_001977712.1| phosphoribosylformylglycinamidine cyclo-ligase [Rhizobium etli CIAT 652] Length = 357 Back     alignment and organism information
>gi|325292515|ref|YP_004278379.1| 5'-phosphoribosyl-5-aminoimidazole synthetase [Agrobacterium sp. H13-3] Length = 357 Back     alignment and organism information
>gi|209548698|ref|YP_002280615.1| phosphoribosylaminoimidazole synthetase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 357 Back     alignment and organism information
>gi|159184635|ref|NP_354159.2| phosphoribosylaminoimidazole synthetase [Agrobacterium tumefaciens str. C58] Length = 357 Back     alignment and organism information
>gi|116251362|ref|YP_767200.1| phosphoribosylaminoimidazole synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 357 Back     alignment and organism information
>gi|241203976|ref|YP_002975072.1| phosphoribosylaminoimidazole synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 357 Back     alignment and organism information
>gi|86357126|ref|YP_469018.1| phosphoribosylaminoimidazole synthetase [Rhizobium etli CFN 42] Length = 357 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target357 phosphoribosylaminoimidazole synthetase [Candidatus Lib
PRK05385327 PRK05385, PRK05385, phosphoribosylaminoimidazole synthe 1e-149
COG0150345 COG0150, PurM, Phosphoribosylaminoimidazole (AIR) synth 1e-126
KOG0237788 KOG0237, KOG0237, KOG0237, Glycinamide ribonucleotide s 1e-125
TIGR00878332 TIGR00878, purM, phosphoribosylaminoimidazole synthetas 1e-121
PLN02557379 PLN02557, PLN02557, phosphoribosylformylglycinamidine c 1e-105
pfam02769150 pfam02769, AIRS_C, AIR synthase related protein, C-term 4e-23
cd00396222 cd00396, PurM-like, AIR (aminoimidazole ribonucleotide) 1e-21
COG0309339 COG0309, HypE, Hydrogenase maturation factor [Posttrans 4e-07
COG0611317 COG0611, ThiL, Thiamine monophosphate kinase [Coenzyme 5e-07
COG2144324 COG2144, COG2144, Selenophosphate synthetase-related pr 1e-05
TIGR03267323 TIGR03267, methan_mark_2, putative methanogenesis marke 0.002
cd02196297 cd02196, PurM, PurM (Aminoimidazole Ribonucleotide [AIR 1e-133
pfam0058695 pfam00586, AIRS, AIR synthase related protein, N-termin 4e-21
cd02194291 cd02194, ThiL, ThiL (Thiamine-monophosphate kinase) pla 2e-06
TIGR01379317 TIGR01379, thiL, thiamine-monophosphate kinase 2e-06
cd06061298 cd06061, PurM-like1, AIR synthase (PurM) related protei 1e-04
PRK05731318 PRK05731, PRK05731, thiamine monophosphate kinase; Prov 5e-04
cd02195287 cd02195, SelD, Selenophosphate synthetase (SelD) cataly 0.001
COG0046 743 COG0046, PurL, Phosphoribosylformylglycinamidine (FGAM) 5e-05
>gnl|CDD|180049 PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional Back     alignment and domain information
>gnl|CDD|30499 COG0150, PurM, Phosphoribosylaminoimidazole (AIR) synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|35458 KOG0237, KOG0237, KOG0237, Glycinamide ribonucleotide synthetase (GARS)/Aminoimidazole ribonucleotide synthetase (AIRS) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|162083 TIGR00878, purM, phosphoribosylaminoimidazole synthetase Back     alignment and domain information
>gnl|CDD|178172 PLN02557, PLN02557, phosphoribosylformylglycinamidine cyclo-ligase Back     alignment and domain information
>gnl|CDD|145754 pfam02769, AIRS_C, AIR synthase related protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|100027 cd00396, PurM-like, AIR (aminoimidazole ribonucleotide) synthase related protein Back     alignment and domain information
>gnl|CDD|30657 COG0309, HypE, Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30956 COG0611, ThiL, Thiamine monophosphate kinase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|32327 COG2144, COG2144, Selenophosphate synthetase-related proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|132311 TIGR03267, methan_mark_2, putative methanogenesis marker protein 2 Back     alignment and domain information
>gnl|CDD|100032 cd02196, PurM, PurM (Aminoimidazole Ribonucleotide [AIR] synthetase), one of eleven enzymes required for purine biosynthesis, catalyzes the conversion of formylglycinamide ribonucleotide (FGAM) and ATP to AIR, ADP, and Pi, the fifth step in de novo purine biosynthesis Back     alignment and domain information
>gnl|CDD|144251 pfam00586, AIRS, AIR synthase related protein, N-terminal domain Back     alignment and domain information
>gnl|CDD|100030 cd02194, ThiL, ThiL (Thiamine-monophosphate kinase) plays a dual role in de novo biosynthesis and in salvage of exogenous thiamine Back     alignment and domain information
>gnl|CDD|162329 TIGR01379, thiL, thiamine-monophosphate kinase Back     alignment and domain information
>gnl|CDD|100037 cd06061, PurM-like1, AIR synthase (PurM) related protein, subgroup 1 of unknown function Back     alignment and domain information
>gnl|CDD|180226 PRK05731, PRK05731, thiamine monophosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|100031 cd02195, SelD, Selenophosphate synthetase (SelD) catalyzes the conversion of selenium to selenophosphate which is required by a number of bacterial, archaeal and eukaryotic organisms for synthesis of Secys-tRNA, the precursor of selenocysteine in selenoenzymes Back     alignment and domain information
>gnl|CDD|30395 COG0046, PurL, Phosphoribosylformylglycinamidine (FGAM) synthase, synthetase domain [Nucleotide transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 357 phosphoribosylaminoimidazole synthetase [Candidatus Lib
TIGR00878338 purM phosphoribosylformylglycinamidine cyclo-ligase; In 100.0
PRK05385338 phosphoribosylaminoimidazole synthetase; Provisional 100.0
COG0150345 PurM Phosphoribosylaminoimidazole (AIR) synthetase [Nuc 100.0
KOG0237788 consensus 100.0
cd02197293 HypE HypE (Hydrogenase expression/formation protein). H 100.0
TIGR03267323 methan_mark_2 putative methanogenesis marker protein 2. 100.0
TIGR02124345 hypE hydrogenase expression/formation protein HypE; Int 100.0
PRK05731320 thiamine monophosphate kinase; Provisional 100.0
PRK00943347 selenophosphate synthetase; Provisional 100.0
cd02195287 SelD Selenophosphate synthetase (SelD) catalyzes the co 99.97
COG0309339 HypE Hydrogenase maturation factor [Posttranslational m 99.97
cd02194291 ThiL ThiL (Thiamine-monophosphate kinase) plays a dual 99.97
cd02691346 PurM-like2 AIR synthase (PurM) related protein, archaea 99.97
TIGR01379336 thiL thiamine-monophosphate kinase; InterPro: IPR006283 99.95
COG0611317 ThiL Thiamine monophosphate kinase [Coenzyme metabolism 99.93
COG1973449 HypE Hydrogenase maturation factor [Posttranslational m 99.63
TIGR01857 1279 FGAM-synthase phosphoribosylformylglycinamidine synthas 91.82
cd02196297 PurM PurM (Aminoimidazole Ribonucleotide [AIR] syntheta 100.0
cd00396222 PurM-like AIR (aminoimidazole ribonucleotide) synthase 100.0
cd06061298 PurM-like1 AIR synthase (PurM) related protein, subgrou 100.0
cd02192283 PurM-like3 AIR synthase (PurM) related protein, subgrou 100.0
TIGR01736 763 FGAM_synth_II phosphoribosylformylglycinamidine synthas 99.95
COG2144324 Selenophosphate synthetase-related proteins [General fu 99.94
COG0046 743 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, 99.87
PRK01213 736 phosphoribosylformylglycinamidine synthase II; Provisio 99.79
COG0709346 SelD Selenophosphate synthase [Amino acid transport and 99.66
TIGR01736763 FGAM_synth_II phosphoribosylformylglycinamidine synthas 99.65
TIGR00476372 selD selenide, water dikinase; InterPro: IPR004536 In p 99.65
cd02204264 PurL_repeat2 PurL subunit of the formylglycinamide ribo 99.59
PRK01213736 phosphoribosylformylglycinamidine synthase II; Provisio 99.56
COG0046743 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, 99.2
KOG3939312 consensus 99.02
KOG1907 1320 consensus 94.24
pfam02769150 AIRS_C AIR synthase related protein, C-terminal domain. 99.88
cd02203313 PurL_repeat1 PurL subunit of the formylglycinamide ribo 99.86
cd02193272 PurL Formylglycinamide ribonucleotide amidotransferase 99.65
PRK05297 1294 phosphoribosylformylglycinamidine synthase; Provisional 99.22
PRK05297 1294 phosphoribosylformylglycinamidine synthase; Provisional 98.72
TIGR01739 1313 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synt 98.15
TIGR01857 1279 FGAM-synthase phosphoribosylformylglycinamidine synthas 97.81
TIGR01735 1401 FGAM_synt phosphoribosylformylglycinamidine synthase; I 97.39
TIGR01735 1401 FGAM_synt phosphoribosylformylglycinamidine synthase; I 96.84
pfam0058695 AIRS AIR synthase related protein, N-terminal domain. T 99.51
KOG1907 1320 consensus 97.81
>TIGR00878 purM phosphoribosylformylglycinamidine cyclo-ligase; InterPro: IPR004733 The purine biosynthetic pathway in procaryotes enlists eleven enzymes, six of which use ATP Back     alignment and domain information
>PRK05385 phosphoribosylaminoimidazole synthetase; Provisional Back     alignment and domain information
>COG0150 PurM Phosphoribosylaminoimidazole (AIR) synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0237 consensus Back     alignment and domain information
>cd02197 HypE HypE (Hydrogenase expression/formation protein) Back     alignment and domain information
>TIGR03267 methan_mark_2 putative methanogenesis marker protein 2 Back     alignment and domain information
>TIGR02124 hypE hydrogenase expression/formation protein HypE; InterPro: IPR011854 This family contains HypE (or HupE), a protein required for expression of catalytically active hydrogenase in many systems Back     alignment and domain information
>PRK05731 thiamine monophosphate kinase; Provisional Back     alignment and domain information
>PRK00943 selenophosphate synthetase; Provisional Back     alignment and domain information
>cd02195 SelD Selenophosphate synthetase (SelD) catalyzes the conversion of selenium to selenophosphate which is required by a number of bacterial, archaeal and eukaryotic organisms for synthesis of Secys-tRNA, the precursor of selenocysteine in selenoenzymes Back     alignment and domain information
>COG0309 HypE Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02194 ThiL ThiL (Thiamine-monophosphate kinase) plays a dual role in de novo biosynthesis and in salvage of exogenous thiamine Back     alignment and domain information
>cd02691 PurM-like2 AIR synthase (PurM) related protein, archaeal subgroup 2 of unknown function Back     alignment and domain information
>TIGR01379 thiL thiamine-monophosphate kinase; InterPro: IPR006283 This family represents thiamine-monophosphate kinase, an enzyme that converts thiamine monophosphate into thiamine pyrophosphate (TPP, coenzyme B1), an enzyme cofactor Back     alignment and domain information
>COG0611 ThiL Thiamine monophosphate kinase [Coenzyme metabolism] Back     alignment and domain information
>COG1973 HypE Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase; InterPro: IPR010141 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis, which represent a second clade of the enzymes found in Clostridia, Bifidobacteria and Streptococcus species Back     alignment and domain information
>cd02196 PurM PurM (Aminoimidazole Ribonucleotide [AIR] synthetase), one of eleven enzymes required for purine biosynthesis, catalyzes the conversion of formylglycinamide ribonucleotide (FGAM) and ATP to AIR, ADP, and Pi, the fifth step in de novo purine biosynthesis Back     alignment and domain information
>cd00396 PurM-like AIR (aminoimidazole ribonucleotide) synthase related protein Back     alignment and domain information
>cd06061 PurM-like1 AIR synthase (PurM) related protein, subgroup 1 of unknown function Back     alignment and domain information
>cd02192 PurM-like3 AIR synthase (PurM) related protein, subgroup 3 of unknown function Back     alignment and domain information
>TIGR01736 FGAM_synth_II phosphoribosylformylglycinamidine synthase II; InterPro: IPR010074 Phosphoribosylformylglycinamidine synthase is a single, long polypeptide in most bacteria Back     alignment and domain information
>COG2144 Selenophosphate synthetase-related proteins [General function prediction only] Back     alignment and domain information
>COG0046 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, synthetase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01213 phosphoribosylformylglycinamidine synthase II; Provisional Back     alignment and domain information
>COG0709 SelD Selenophosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01736 FGAM_synth_II phosphoribosylformylglycinamidine synthase II; InterPro: IPR010074 Phosphoribosylformylglycinamidine synthase is a single, long polypeptide in most bacteria Back     alignment and domain information
>TIGR00476 selD selenide, water dikinase; InterPro: IPR004536 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>cd02204 PurL_repeat2 PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), second repeat Back     alignment and domain information
>PRK01213 phosphoribosylformylglycinamidine synthase II; Provisional Back     alignment and domain information
>COG0046 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, synthetase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3939 consensus Back     alignment and domain information
>KOG1907 consensus Back     alignment and domain information
>pfam02769 AIRS_C AIR synthase related protein, C-terminal domain Back     alignment and domain information
>cd02203 PurL_repeat1 PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), first repeat Back     alignment and domain information
>cd02193 PurL Formylglycinamide ribonucleotide amidotransferase (FGAR-AT) catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to formylglycinamidine ribonucleotide (FGAM), ADP, phosphate, and glutamate in the fourth step of the purine biosynthetic pathway Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase; InterPro: IPR010077 This entry describes a family of large proteins of herpes virus Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase; InterPro: IPR010141 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis, which represent a second clade of the enzymes found in Clostridia, Bifidobacteria and Streptococcus species Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase; InterPro: IPR010073 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase; InterPro: IPR010073 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis Back     alignment and domain information
>pfam00586 AIRS AIR synthase related protein, N-terminal domain Back     alignment and domain information
>KOG1907 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target357 phosphoribosylaminoimidazole synthetase [Candidatus Lib
1cli_A345 X-Ray Crystal Structure Of Aminoimidazole Ribonucle 9e-91
3p4e_A349 Phosphoribosylformylglycinamidine Cyclo-Ligase From 1e-90
2z01_A348 Crystal Structure Of Phosphoribosylaminoimidazole S 3e-79
2btu_A346 Crystal Structure Of Phosphoribosylformylglycinamid 2e-76
3m84_A350 Crystal Structure Of Phosphoribosylaminoimidazole S 4e-67
3mdo_A389 Crystal Structure Of A Putative Phosphoribosylformy 1e-24
3kiz_A394 Crystal Structure Of Putative Phosphoribosylformylg 2e-23
2z1e_A338 Crystal Structure Of Hype From Thermococcus Kodakar 1e-08
2v9y_A334 Human Aminoimidazole Ribonucleotide Synthetase Leng 3e-71
3fd5_A394 Crystal Structure Of Human Selenophosphate Syntheta 2e-04
2i6r_A334 Crystal Structure Of E. Coli Hype, A Hydrogenase Ma 3e-05
>gi|6137337|pdb|1CLI|A Chain A, X-Ray Crystal Structure Of Aminoimidazole Ribonucleotide Synthetase (Purm), From The E. Coli Purine Biosynthetic Pathway, At 2.5 A Resolution Length = 345 Back     alignment and structure
 Score =  338 bits (866), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 162/348 (46%), Positives = 232/348 (66%), Gaps = 5/348 (1%)

Query: 5   RKRGLTYGQAGVNIEAGNRTVTQIKSAVKSTKRAGTIGEIGGFGGLFDLKKAGFVDPILV 64
            K  L+Y  AGV+I+AGN  V +IK  VK T+R   +G +GGFG L  L +  + +P+LV
Sbjct: 3   DKTSLSYKDAGVDIDAGNALVGRIKGVVKKTRRPEVMGGLGGFGALCALPQ-KYREPVLV 61

Query: 65  SSSDGVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQATS 124
           S +DGVGTKL++A++  ++DTIGIDLVAMCVND++  GAEPLFFLDY AT +L+ D A++
Sbjct: 62  SGTDGVGTKLRLAMDLKRHDTIGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTASA 121

Query: 125 IIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAGDLI 184
           +I GIA GC Q+GC+L+GGETAEMPG+YH  DYD+AGF VG VE+ E++    V  GD++
Sbjct: 122 VISGIAEGCLQSGCSLVGGETAEMPGMYHGEDYDVAGFCVGVVEKSEIIDGSKVSDGDVL 181

Query: 185 LGLPSSGLHSNGFALVRKIISLSQLSWKDPSPISSEHSLGETLLTPTRIYVSPLLKILRK 244
           + L SSG HSNG++LVRKI+ +S    +          L + LL PTRIYV  +L+++ K
Sbjct: 182 IALGSSGPHSNGYSLVRKILEVSGCDPQTTE--LDGKPLADHLLAPTRIYVKSVLELIEK 239

Query: 245 TGKIKALAHITGGGLTENIPRAIPAHLTASINLNSVEVPQIISWLSKKAHVKPAEVLRTF 304
              + A+AH+TGGG  ENIPR +P +  A I+ +S + P++ +WL    +V+  E+ RTF
Sbjct: 240 V-DVHAIAHLTGGGFWENIPRVLPDNTQAVIDESSWQWPEVFNWLQTAGNVEHHEMYRTF 298

Query: 305 NCGIGMVIIVHPDNKDCIIKKFQENNENIILIGEVTQRSEKSPPILYQ 352
           NCG+GM+I +     D  +     N EN   IG + + S+    ++ +
Sbjct: 299 NCGVGMIIALPAPEVDKALALLNANGENAWKIG-IIKASDSEQRVVIE 345


>gi|309320749|pdb|3P4E|A Chain A, Phosphoribosylformylglycinamidine Cyclo-Ligase From Vibrio Cholerae Length = 349 Back     alignment and structure
gi|114793560|pdb|2BTU|A Chain A, Crystal Structure Of Phosphoribosylformylglycinamidine Cyclo-Ligase From Bacillus Anthracis At 2.3a Resolution. Length = 346 Back     alignment and structure
>gi|300508520|pdb|3M84|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole Synthetase From Francisella Tularensis Length = 350 Back     alignment and structure
>gi|297343094|pdb|3MDO|A Chain A, Crystal Structure Of A Putative Phosphoribosylformylglycinam Cyclo-Ligase (Bdi_2101) From Parabacteroides Distasonis Atc 1.91 A Resolution Length = 389 Back     alignment and structure
>gi|268612468|pdb|3KIZ|A Chain A, Crystal Structure Of Putative Phosphoribosylformylglycinamidine Cyclo-Ligase (Yp_676759.1) From Cytophaga Hutchinsonii Atcc 33406 At 1.50 A Resolution Length = 394 Back     alignment and structure
gi|152149567|pdb|2Z1E|A Chain A, Crystal Structure Of Hype From Thermococcus Kodakaraensis (Outward Form) Length = 338 Back     alignment and structure
>gi|158431152|pdb|2V9Y|A Chain A, Human Aminoimidazole Ribonucleotide Synthetase Length = 334 Back     alignment and structure
>gi|259090155|pdb|3FD5|A Chain A, Crystal Structure Of Human Selenophosphate Synthetase 1 Complex With Ampcp Length = 394 Back     alignment and structure
>gi|159794815|pdb|2I6R|A Chain A, Crystal Structure Of E. Coli Hype, A Hydrogenase Maturation Protein Length = 334 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target357 phosphoribosylaminoimidazole synthetase [Candidatus Lib
3m84_A350 Phosphoribosylformylglycinamidine cyclo-ligase; alpha-b 1e-100
3p4e_A349 Phosphoribosylformylglycinamidine cyclo-ligase; structu 3e-95
1cli_A345 Protein (phosphoribosyl-aminoimidazole synthetase); AIR 9e-78
3mdo_A389 Putative phosphoribosylformylglycinamidine cyclo-; stru 2e-77
2z01_A348 Phosphoribosylformylglycinamidine cyclo-ligase; alpha a 7e-76
2btu_A346 Phosphoribosyl-aminoimidazole synthetase; synthase, PUR 2e-73
3kiz_A394 Phosphoribosylformylglycinamidine cyclo-ligase; structu 9e-70
2z1e_A338 Hydrogenase expression/formation protein HYPE; [NIFE] h 9e-18
2yxz_A311 Thiamin-monophosphate kinase; alpha/beta structure, tra 3e-07
2v9y_A334 Phosphoribosylformylglycinamidine cyclo-ligase; multifu 5e-74
2rb9_A334 HYPE protein; hydrogenase maturation, dimer, enzyme, X- 3e-26
2z1u_A343 Hydrogenase expression/formation protein HYPE; alpha-be 4e-23
3fd5_A394 Selenide, water dikinase 1; selenophosphate synthetase, 1e-17
3mcq_A319 Thiamine-monophosphate kinase; structural genomics, joi 1e-14
1vk3_A 615 Phosphoribosylformylglycinamidine synthase II; TM1246, 9e-07
2yyd_A345 Selenide, water dikinase; FULL-length selenophosphate s 4e-06
>3m84_A Phosphoribosylformylglycinamidine cyclo-ligase; alpha-beta fold, csgid, ATP-binding, nucleotide-BIND purine biosynthesis; HET: MSE AMP TRS; 1.70A {Francisella tularensis subsp} Length = 350 Back     alignment and structure
 Score =  361 bits (928), Expect = e-100
 Identities = 135/346 (39%), Positives = 200/346 (57%), Gaps = 4/346 (1%)

Query: 4   ERKRGLTYGQAGVNIEAGNRTVTQIKSAVKSTKRAGTIGEIGGFGGLFDLKKA--GFVDP 61
               GL Y  AGVNIEAGN+ V ++K  VK T     +  +G FG L+ LK     + DP
Sbjct: 2   NAMAGLKYEDAGVNIEAGNQAVERMKQHVKKTFTQDVLTGLGSFGSLYSLKNIINNYDDP 61

Query: 62  ILVSSSDGVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQ 121
           +LV S DGVGTK K+A+  GK + +G DL +   NDI+  GA+P+ FLDY+A  +L+P  
Sbjct: 62  VLVQSIDGVGTKTKVAVMCGKFENLGYDLFSAATNDIVVMGAKPITFLDYVAHDKLDPAI 121

Query: 122 ATSIIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAG 181
              ++KG++  C + G +L+GGETAEMPG+Y   + D+ G   G V+RK +++ EN+  G
Sbjct: 122 MEELVKGMSKACAECGVSLVGGETAEMPGVYQAGEIDMVGVITGIVDRKRIINGENIKEG 181

Query: 182 DLILGLPSSGLHSNGFALVRKIIS-LSQLSWKDPSPISSEHSLGETLLTPTRIYVSPLLK 240
           D++ GL SSGLH+NG++  RK+   ++     D  P     ++G+ LL P   Y + +  
Sbjct: 182 DIVFGLSSSGLHTNGYSFARKLFFDVAGNKHTDTYPELEGKTIGDVLLEPHINYTNIIHD 241

Query: 241 ILRKTGKIKALAHITGGGLTENIPRAIPAHLTASINLNSVEVPQIISWLSKKAHVKPAEV 300
            L     IK +AHITGGG  ENIPR +P  L A I+ +S   P I   + +   +   E+
Sbjct: 242 FLDNGVDIKGMAHITGGGFIENIPRVLPQGLGAQIDKDSFATPAIFKLMQRIGDISEFEM 301

Query: 301 LRTFNCGIGMVIIVHPDNKDCIIKKFQEN-NENIILIGEVTQRSEK 345
            R+FN GIGM II   D  D + +  +++ N  +  IG++T   + 
Sbjct: 302 YRSFNMGIGMTIIASQDQFDKMQELAKKHTNTKLYQIGKITNSGKV 347


>3p4e_A Phosphoribosylformylglycinamidine cyclo-ligase; structural genomics, center for structural genomics of infec diseases, csgid; HET: AMP CIT; 1.77A {Vibrio cholerae} PDB: 1cli_A Length = 349 Back     alignment and structure
>1cli_A Protein (phosphoribosyl-aminoimidazole synthetase); AIR synthetase, PURM, purine biosynthesis, trifunctional enzyme, PURL; 2.50A {Escherichia coli} SCOP: d.79.4.1 d.139.1.1 Length = 345 Back     alignment and structure
>3mdo_A Putative phosphoribosylformylglycinamidine cyclo-; structural genomics, joint center for structural genomics; HET: MSE PGE P6G PG4; 1.91A {Parabacteroides distasonis} Length = 389 Back     alignment and structure
>2z01_A Phosphoribosylformylglycinamidine cyclo-ligase; alpha and beta proteins, cytoplasm, purine biosynthesis, structural genomics, NPPSFA; 2.20A {Geobacillus kaustophilus} Length = 348 Back     alignment and structure
>2btu_A Phosphoribosyl-aminoimidazole synthetase; synthase, PURM, de novo purine biosynthesis, AIR synthase family, spine, FGAR amidotransferase; 2.31A {Bacillus anthracis} Length = 346 Back     alignment and structure
>3kiz_A Phosphoribosylformylglycinamidine cyclo-ligase; structural genomics, joint center for structural genomics, JCSG; 1.50A {Cytophaga hutchinsonii atcc 33406} Length = 394 Back     alignment and structure
>2z1e_A Hydrogenase expression/formation protein HYPE; [NIFE] hydrogenase maturation, ATPase, transferase; 1.55A {Thermococcus kodakarensis KOD1} SCOP: d.79.4.1 d.139.1.1 PDB: 2z1f_A Length = 338 Back     alignment and structure
>2yxz_A Thiamin-monophosphate kinase; alpha/beta structure, transferase; 1.90A {Thermus thermophilus HB8} Length = 311 Back     alignment and structure
>2v9y_A Phosphoribosylformylglycinamidine cyclo-ligase; multifunctional enzyme, structural genomics consortium, nucleotide-binding, purine biosynthesis; 2.10A {Homo sapiens} Length = 334 Back     alignment and structure
>2rb9_A HYPE protein; hydrogenase maturation, dimer, enzyme, X- RAY crystallography, structural genomics, BSGI; 2.00A {Escherichia coli O157} PDB: 2i6r_A Length = 334 Back     alignment and structure
>2z1u_A Hydrogenase expression/formation protein HYPE; alpha-beta fold, beta barrel, lyase; HET: ATP; 2.00A {Desulfovibrio vulgaris subsp} PDB: 2z1t_A* Length = 343 Back     alignment and structure
>3fd5_A Selenide, water dikinase 1; selenophosphate synthetase, SELD, ATP-binding, nucleotide-binding, selenium, transferase; HET: AP2; 1.90A {Homo sapiens} PDB: 3fd6_A* Length = 394 Back     alignment and structure
>3mcq_A Thiamine-monophosphate kinase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PGE PG4 1PE; 1.91A {Methylobacillus flagellatus} Length = 319 Back     alignment and structure
>1vk3_A Phosphoribosylformylglycinamidine synthase II; TM1246, structural genomics, JCSG, PSI, protein structure initiative; 2.15A {Thermotoga maritima} SCOP: d.79.4.1 d.79.4.1 d.139.1.1 d.139.1.1 PDB: 3d54_A* 2hs3_A* 2hs0_A* 2hs4_A* 2hru_A* 2hry_A* Length = 615 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target357 phosphoribosylaminoimidazole synthetase [Candidatus Lib
3p4e_A349 Phosphoribosylformylglycinamidine cyclo-ligase; structu 100.0
3m84_A350 Phosphoribosylformylglycinamidine cyclo-ligase; alpha-b 100.0
3kiz_A394 Phosphoribosylformylglycinamidine cyclo-ligase; structu 100.0
3mdo_A389 Putative phosphoribosylformylglycinamidine cyclo-; stru 100.0
2z01_A348 Phosphoribosylformylglycinamidine cyclo-ligase; alpha a 100.0
2btu_A346 Phosphoribosyl-aminoimidazole synthetase; synthase, PUR 100.0
2z1u_A343 Hydrogenase expression/formation protein HYPE; alpha-be 100.0
3c9u_A342 Thiamine monophosphate kinase; beta barrel, alpha-beta 99.97
2v9y_A334 Phosphoribosylformylglycinamidine cyclo-ligase; multifu 100.0
2rb9_A334 HYPE protein; hydrogenase maturation, dimer, enzyme, X- 100.0
2z1e_A338 Hydrogenase expression/formation protein HYPE; [NIFE] h 100.0
3fd5_A394 Selenide, water dikinase 1; selenophosphate synthetase, 100.0
2yxz_A311 Thiamin-monophosphate kinase; alpha/beta structure, tra 100.0
3mcq_A319 Thiamine-monophosphate kinase; structural genomics, joi 100.0
2yyd_A345 Selenide, water dikinase; FULL-length selenophosphate s 100.0
1vk3_A 615 Phosphoribosylformylglycinamidine synthase II; TM1246, 99.91
1t3t_A 1303 Phosphoribosylformylglycinamidine synthase; PURL, FGAM 99.49
1t3t_A 1303 Phosphoribosylformylglycinamidine synthase; PURL, FGAM 98.73
1vk3_A615 Phosphoribosylformylglycinamidine synthase II; TM1246, 97.72
>3p4e_A Phosphoribosylformylglycinamidine cyclo-ligase; structural genomics, center for structural genomics of infec diseases, csgid; HET: AMP CIT; 1.77A {Vibrio cholerae} PDB: 1cli_A Back     alignment and structure
Probab=100.00  E-value=0  Score=841.09  Aligned_cols=346  Identities=48%  Similarity=0.852  Sum_probs=330.7

Q ss_pred             CCCCCCCCCCHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCCCCCCEEEEEECCCCCHHHHHHHHH
Q ss_conf             98876678888890889899999999999998862673543667773157565544688718999568887899999982
Q gi|254780569|r    1 MNHERKRGLTYGQAGVNIEAGNRTVTQIKSAVKSTKRAGTIGEIGGFGGLFDLKKAGFVDPILVSSSDGVGTKLKIAIET   80 (357)
Q Consensus         1 m~~~~~~~~tY~~aGVdi~~~~~~v~~i~~~~~~t~~~~v~~~ig~f~~~~~l~~~~~~~p~Lv~~tDGVGTK~~ia~~~   80 (357)
                      |+ ++++++||++|||||+++|+++++||+++++|++++|++++|+|||+|+++. +|++|+||++|||||||+++|+++
T Consensus         4 m~-~~~~~~tY~~aGVdi~~~~~~~~~ik~~~~~t~~~~v~~~iG~f~~~~~~~~-~~~~p~Lv~~tDGvGTK~~~a~~~   81 (349)
T 3p4e_A            4 MS-GNNPSLSYKDAGVDIDAGNALVERIKGAVKRTRRPEVMGGLGGFGALCELPT-KYKHPVLVSGTDGVGTKLRLALDM   81 (349)
T ss_dssp             ------------------CHHHHHHHHHHHHHHHTCCTTEEC------CEECCCT-TCSSEEEEEEEECCTHHHHHHHHT
T ss_pred             CC-CCCCCCCHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCC-CCCCCEEEEECCCCCHHHHHHHHH
T ss_conf             68-8999997889686999999999999999985079765567788536777522-479846998578764889999984


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCEECCCCHHHCCCCCCCCCCCEE
Q ss_conf             88550168888854346788541122110000033203789999999999999860952214301000001365566336
Q gi|254780569|r   81 GKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQATSIIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLA  160 (357)
Q Consensus        81 ~~~~~ig~Dlvam~vNDi~~~GA~Pl~fldyia~~~l~~~~~~~ii~gi~~~c~~~g~~liGGETAemP~vy~~~~~Dla  160 (357)
                      ++|++|||||||||||||+||||+|+|||||+++++++++.+++|++||+++|+++||+|+||||||||++|++++|||+
T Consensus        82 ~~~~~iG~D~Vam~vNDi~~~GA~Pl~fldy~a~~~l~~~~~~~iv~Gi~~~c~~~g~~liGGETaemp~~~~~~~~dla  161 (349)
T 3p4e_A           82 KKHDTIGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDTAAEVISGIADGCLQAGCALIGGETAEMPGMYEGEDYDVA  161 (349)
T ss_dssp             TCCSSHHHHHHHHHHHHHHTTTCEEEEEEEEEEESSCCHHHHHHHHHHHHHHHHHHTCEEEEEEEEECBTTBCTTCEEEE
T ss_pred             CCCCCHHHHHHHHHCCCHHHCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCEECCCCCCCCCCCCCCCCEEEE
T ss_conf             67644888899874330665587986643553268873588999999999999983975246775423565446732033


Q ss_pred             EEEEEEECCCCCCCCCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCHHHHHCCCCCHHHHHHHH
Q ss_conf             89999741542113334555248999538655432320344445531155456676666630668753972012268888
Q gi|254780569|r  161 GFAVGAVERKELLSPENVCAGDLILGLPSSGLHSNGFALVRKIISLSQLSWKDPSPISSEHSLGETLLTPTRIYVSPLLK  240 (357)
Q Consensus       161 g~~vG~v~k~~ii~~~~i~~GD~IIgl~SsG~HsNGySLvRkil~~~~~~~~~~~~~~~~~tl~e~LL~PtriY~~~i~~  240 (357)
                      |||||+|+|++++++++++|||+|||++|+|+|||||||+||+++.......++   ..+++++|+||+|||+|++.+++
T Consensus       162 g~~vGivek~~ii~~~~ik~GD~IIgl~SsG~HsNG~sL~Rkil~~~~~~~~~~---~~~~~lge~ll~Pt~iY~~~i~~  238 (349)
T 3p4e_A          162 GFCVGVVEKEEIIDGSKVQVGDALIAVGSSGPHSNGYSLVRKILEVSKADKNER---LAGKTIGEHLLAPTKIYIKSGLK  238 (349)
T ss_dssp             EEEEEEEEGGGCCCSTTCCTTCEEEEEECSSSTTSSHHHHHHHHHHHTCCTTCE---ETTEEHHHHHHCCCCCCHHHHHH
T ss_pred             EEEEEEEEHHHCCCCCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHCCCCCCC---CCCCCHHHHHCCCCHHHHHHHHH
T ss_conf             069999985565883336778479993578767776136677776514553434---57877778515762466889998


Q ss_pred             HHHCCCCCCCCCCCCCCHHHHCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHCCCCHHHHHHHHCCCCCEEEEECHHHHH
Q ss_conf             76304632222345420122012002544304787100489867999999966989889876524671169998689899
Q gi|254780569|r  241 ILRKTGKIKALAHITGGGLTENIPRAIPAHLTASINLNSVEVPQIISWLSKKAHVKPAEVLRTFNCGIGMVIIVHPDNKD  320 (357)
Q Consensus       241 ll~~~~~i~~~ahITGGGl~~nL~RiLp~gl~a~Id~~~~p~p~iF~~I~~~g~I~~~EM~rtFNmGiGmvlvV~~e~a~  320 (357)
                      +++. ..||+|+|||||||++|++|++|+++.+.|+.++||+||+|+|||+.|+++++|||||||||+||+++|+|++++
T Consensus       239 l~~~-~~i~g~ahITGGGl~~nl~ril~~~~~~~I~~~~~~~p~if~~i~~~g~i~~~Em~~tFN~GiGmvliV~~~~~~  317 (349)
T 3p4e_A          239 LIAE-HDIHAISHITGGGFWENIPRVLPEGTKAVIDGKSWEWPVIFQWLQEKGNVTTHEMYRTFNCGVGLIIALPKDQAN  317 (349)
T ss_dssp             HHHH-SCCCEEEECCTTHHHHHGGGGCCTTEEEEECTTSCCCCHHHHHHHHHHTCCHHHHHTTSCTTEEEEEEECHHHHH
T ss_pred             HHHC-CCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHCCCCHHHHHHHCCCCCEEEEEECHHHHH
T ss_conf             7540-455520003665412366310467860353100268748999999968989999998617873399998889999


Q ss_pred             HHHHHHHHCCCCEEEEEEEEECCCCCCEEEEE
Q ss_conf             99999997799808999999778872008996
Q gi|254780569|r  321 CIIKKFQENNENIILIGEVTQRSEKSPPILYQ  352 (357)
Q Consensus       321 ~v~~~l~~~g~~a~iIG~V~~~~~~~~~V~~~  352 (357)
                      ++++.+++++++||+||+|+++++++++|.++
T Consensus       318 ~vl~~l~~~g~~a~iIG~V~~~~~~~~~V~in  349 (349)
T 3p4e_A          318 AAVALLQAEGETAWVIGEIAAANSNEAQVEIN  349 (349)
T ss_dssp             HHHHHHHHTTCCEEEEEEEEECCSSSCSEEEC
T ss_pred             HHHHHHHHCCCCCEEEEEEEECCCCCCEEEEC
T ss_conf             99999986799878989999789997669849



>3m84_A Phosphoribosylformylglycinamidine cyclo-ligase; alpha-beta fold, csgid, ATP-binding, nucleotide-BIND purine biosynthesis; HET: MSE AMP TRS; 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3kiz_A Phosphoribosylformylglycinamidine cyclo-ligase; structural genomics, joint center for structural genomics, JCSG; 1.50A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3mdo_A Putative phosphoribosylformylglycinamidine cyclo-; structural genomics, joint center for structural genomics; HET: MSE PGE P6G PG4; 1.91A {Parabacteroides distasonis} Back     alignment and structure
>2btu_A Phosphoribosyl-aminoimidazole synthetase; synthase, PURM, de novo purine biosynthesis, AIR synthase family, spine, FGAR amidotransferase; 2.31A {Bacillus anthracis} Back     alignment and structure
>2z1u_A Hydrogenase expression/formation protein HYPE; alpha-beta fold, beta barrel, lyase; HET: ATP; 2.00A {Desulfovibrio vulgaris subsp} PDB: 2z1t_A* Back     alignment and structure
>3c9u_A Thiamine monophosphate kinase; beta barrel, alpha-beta structure, transferase; HET: TPP ADP; 1.48A {Aquifex aeolicus} SCOP: d.79.4.1 d.139.1.1 PDB: 3c9r_A* 3c9t_A* 3c9s_A* 1vqv_A Back     alignment and structure
>2v9y_A Phosphoribosylformylglycinamidine cyclo-ligase; multifunctional enzyme, structural genomics consortium, nucleotide-binding, purine biosynthesis; 2.10A {Homo sapiens} Back     alignment and structure
>2rb9_A HYPE protein; hydrogenase maturation, dimer, enzyme, X- RAY crystallography, structural genomics, BSGI; 2.00A {Escherichia coli O157} PDB: 2i6r_A Back     alignment and structure
>2z1e_A Hydrogenase expression/formation protein HYPE; [NIFE] hydrogenase maturation, ATPase, transferase; 1.55A {Thermococcus kodakarensis KOD1} SCOP: d.79.4.1 d.139.1.1 PDB: 2z1f_A Back     alignment and structure
>3fd5_A Selenide, water dikinase 1; selenophosphate synthetase, SELD, ATP-binding, nucleotide-binding, selenium, transferase; HET: AP2; 1.90A {Homo sapiens} PDB: 3fd6_A* Back     alignment and structure
>2yxz_A Thiamin-monophosphate kinase; alpha/beta structure, transferase; 1.90A {Thermus thermophilus HB8} Back     alignment and structure
>3mcq_A Thiamine-monophosphate kinase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PGE PG4 1PE; 1.91A {Methylobacillus flagellatus} Back     alignment and structure
>1vk3_A Phosphoribosylformylglycinamidine synthase II; TM1246, structural genomics, JCSG, PSI, protein structure initiative; 2.15A {Thermotoga maritima} SCOP: d.79.4.1 d.79.4.1 d.139.1.1 d.139.1.1 PDB: 3d54_A* 2hs3_A* 2hs0_A* 2hs4_A* 2hru_A* 2hry_A* Back     alignment and structure
>1t3t_A Phosphoribosylformylglycinamidine synthase; PURL, FGAM synthetase, PURS, PURQ, formyl glycinamide, ligase; HET: CYG ADP; 1.90A {Salmonella typhimurium} SCOP: a.5.10.1 c.23.16.1 d.284.1.2 d.79.4.1 d.79.4.1 d.139.1.1 d.139.1.1 Back     alignment and structure
>1t3t_A Phosphoribosylformylglycinamidine synthase; PURL, FGAM synthetase, PURS, PURQ, formyl glycinamide, ligase; HET: CYG ADP; 1.90A {Salmonella typhimurium} SCOP: a.5.10.1 c.23.16.1 d.284.1.2 d.79.4.1 d.79.4.1 d.139.1.1 d.139.1.1 Back     alignment and structure
>1vk3_A Phosphoribosylformylglycinamidine synthase II; TM1246, structural genomics, JCSG, PSI, protein structure initiative; 2.15A {Thermotoga maritima} SCOP: d.79.4.1 d.79.4.1 d.139.1.1 d.139.1.1 PDB: 3d54_A* 2hs3_A* 2hs0_A* 2hs4_A* 2hru_A* 2hry_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 357 phosphoribosylaminoimidazole synthetase [Candidatus Lib
d1clia1166 d.79.4.1 (A:5-170) Aminoimidazole ribonucleotide synthe 6e-49
d1clia2175 d.139.1.1 (A:171-345) Aminoimidazole ribonucleotide syn 3e-34
d2z1ea2179 d.139.1.1 (A:156-334) Hydrogenase expression/formation 1e-05
d2z1ea1113 d.79.4.1 (A:43-155) Hydrogenase expression/formation pr 1e-12
d3c9ua1137 d.79.4.1 (A:1-137) Thiamine monophosphate kinase (ThiL) 1e-06
d2zoda1152 d.79.4.1 (A:3-154) Selenide, water dikinase SelD {Aquif 8e-06
>d1clia1 d.79.4.1 (A:5-170) Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: PurM N-terminal domain-like
family: PurM N-terminal domain-like
domain: Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain
species: Escherichia coli [TaxId: 562]
 Score =  188 bits (479), Expect = 6e-49
 Identities = 96/165 (58%), Positives = 129/165 (78%), Gaps = 1/165 (0%)

Query: 9   LTYGQAGVNIEAGNRTVTQIKSAVKSTKRAGTIGEIGGFGGLFDLKKAGFVDPILVSSSD 68
           L+Y  AGV+I+AGN  V +IK  VK T+R   +G +GGFG L  L +  + +P+LVS +D
Sbjct: 3   LSYKDAGVDIDAGNALVGRIKGVVKKTRRPEVMGGLGGFGALCALPQ-KYREPVLVSGTD 61

Query: 69  GVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQATSIIKG 128
           GVGTKL++A++  ++DTIGIDLVAMCVND++  GAEPLFFLDY AT +L+ D A+++I G
Sbjct: 62  GVGTKLRLAMDLKRHDTIGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTASAVISG 121

Query: 129 IAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELL 173
           IA GC Q+GC+L+GGETAEMPG+YH  DYD+AGF VG VE+ E++
Sbjct: 122 IAEGCLQSGCSLVGGETAEMPGMYHGEDYDVAGFCVGVVEKSEII 166


>d1clia2 d.139.1.1 (A:171-345) Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain {Escherichia coli [TaxId: 562]} Length = 175 Back     information, alignment and structure
>d2z1ea2 d.139.1.1 (A:156-334) Hydrogenase expression/formation protein HypE {Thermococcus kodakaraensis [TaxId: 311400]} Length = 179 Back     information, alignment and structure
>d2z1ea1 d.79.4.1 (A:43-155) Hydrogenase expression/formation protein HypE {Thermococcus kodakaraensis [TaxId: 311400]} Length = 113 Back     information, alignment and structure
>d3c9ua1 d.79.4.1 (A:1-137) Thiamine monophosphate kinase (ThiL) N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 Back     information, alignment and structure
>d2zoda1 d.79.4.1 (A:3-154) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]} Length = 152 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target357 phosphoribosylaminoimidazole synthetase [Candidatus Lib
d1clia1166 Aminoimidazole ribonucleotide synthetase (PurM) N-termi 100.0
d3c9ua1137 Thiamine monophosphate kinase (ThiL) N-terminal domain 99.66
d1clia2175 Aminoimidazole ribonucleotide synthetase (PurM) C-termi 100.0
d2z1ea2179 Hydrogenase expression/formation protein HypE {Thermoco 99.61
d1vk3a3179 Phosphoribosylformylglycinamidine synthase II, domains 99.27
d2zoda2182 Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 98.98
d3c9ua2163 Thiamine monophosphate kinase (ThiL) C-terminal domain 98.82
d1t3ta6187 FGAM synthase PurL, PurM-like module, C1 and C2 domains 98.76
d2z1ea1113 Hydrogenase expression/formation protein HypE {Thermoco 99.67
d2zoda1152 Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 99.57
d1vk3a2162 Phosphoribosylformylglycinamidine synthase II, domains 98.67
d1vk3a1165 Phosphoribosylformylglycinamidine synthase II, domains 97.64
d1t3ta7217 FGAM synthase PurL, PurM-like module, C1 and C2 domains 98.14
d1t3ta4209 FGAM synthase PurL, PurM-like module, N1 and N2 domains 95.13
d1t3ta5200 FGAM synthase PurL, PurM-like module, N1 and N2 domains 92.69
>d1clia1 d.79.4.1 (A:5-170) Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: PurM N-terminal domain-like
family: PurM N-terminal domain-like
domain: Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=444.82  Aligned_cols=166  Identities=58%  Similarity=1.062  Sum_probs=162.5

Q ss_pred             CCCCHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHCCCCCH
Q ss_conf             78888890889899999999999998862673543667773157565544688718999568887899999982885501
Q gi|254780569|r    7 RGLTYGQAGVNIEAGNRTVTQIKSAVKSTKRAGTIGEIGGFGGLFDLKKAGFVDPILVSSSDGVGTKLKIAIETGKNDTI   86 (357)
Q Consensus         7 ~~~tY~~aGVdi~~~~~~v~~i~~~~~~t~~~~v~~~ig~f~~~~~l~~~~~~~p~Lv~~tDGVGTK~~ia~~~~~~~~i   86 (357)
                      .+|||++|||||+++|+++++|++++++|+++++++++|+|+++|+++. .|++|+||++|||||||+++|+++++|++|
T Consensus         1 ~sltY~~AGVDI~~~~~~v~~ik~~~~~T~~~~v~~~~Ggf~g~~~~~~-~~~~p~Lv~~tDGVGTK~~iA~~~~~~~~i   79 (166)
T d1clia1           1 TSLSYKDAGVDIDAGNALVGRIKGVVKKTRRPEVMGGLGGFGALCALPQ-KYREPVLVSGTDGVGTKLRLAMDLKRHDTI   79 (166)
T ss_dssp             CCTTTSSSCCCTTHHHHHHHHTHHHHHTTCCTTEESCSSSSSEEEECCT-TCSSEEEEEEEEECCTHHHHHHHTTCCSSH
T ss_pred             CCCCHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEECCC-CCCCCEEEEEECCCCHHHHHHHHHHHHCCC
T ss_conf             9876788792999999999999999985168876566678764333232-258727999615644253999876421670


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCEECCCCHHHCCCCCCCCCCCEEEEEEEE
Q ss_conf             68888854346788541122110000033203789999999999999860952214301000001365566336899997
Q gi|254780569|r   87 GIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQATSIIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGA  166 (357)
Q Consensus        87 g~Dlvam~vNDi~~~GA~Pl~fldyia~~~l~~~~~~~ii~gi~~~c~~~g~~liGGETAemP~vy~~~~~Dlag~~vG~  166 (357)
                      ||||||||||||+|+||+|+|||||+|+++++++.+++|++|++++|++++|+|+||||||||++|++++|||+|||||+
T Consensus        80 G~DlVam~vNDil~~GA~Pl~flDY~a~~~~~~~~~~~iv~Gi~~ac~~~~~~LiGGETAempgvy~~~~~DLaG~~vGi  159 (166)
T d1clia1          80 GIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTASAVISGIAEGCLQSGCSLVGGETAEMPGMYHGEDYDVAGFCVGV  159 (166)
T ss_dssp             HHHHHHHHHHHHGGGTCEEEEEEEEEEESSCCHHHHHHHHHHHHHHHHHHTCEEEEEEEEECTTTSCTTCEEEEEEEEEE
T ss_pred             CHHHHHHCCCHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEEEEEEEEE
T ss_conf             21467665651665258999988853203554689999999999999994884205532125676799987877678999


Q ss_pred             ECCCCCC
Q ss_conf             4154211
Q gi|254780569|r  167 VERKELL  173 (357)
Q Consensus       167 v~k~~ii  173 (357)
                      |+|+++|
T Consensus       160 vek~~ii  166 (166)
T d1clia1         160 VEKSEII  166 (166)
T ss_dssp             EEGGGCC
T ss_pred             EECCCCC
T ss_conf             8225449



>d3c9ua1 d.79.4.1 (A:1-137) Thiamine monophosphate kinase (ThiL) N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1clia2 d.139.1.1 (A:171-345) Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z1ea2 d.139.1.1 (A:156-334) Hydrogenase expression/formation protein HypE {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1vk3a3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2zoda2 d.139.1.1 (A:155-336) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3c9ua2 d.139.1.1 (A:138-300) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1t3ta6 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2z1ea1 d.79.4.1 (A:43-155) Hydrogenase expression/formation protein HypE {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d2zoda1 d.79.4.1 (A:3-154) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vk3a2 d.79.4.1 (A:346-507) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vk3a1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t3ta7 d.139.1.1 (A:817-1033) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1t3ta4 d.79.4.1 (A:221-429) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1t3ta5 d.79.4.1 (A:617-816) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 357 phosphoribosylaminoimidazole synthetase [Candidatu
2zod_A_345 (A:) Selenophosphate Synthetase {Aquifex Aeolicus} 1e-39
2z01_A_1-171171 (A:1-171) Phosphoribosylformylglycinamidine cyclo- 1e-37
1cli_A_1-172172 (A:1-172) Protein (phosphoribosyl-aminoimidazole s 2e-36
2btu_A_1-169169 (A:1-169) Phosphoribosyl-aminoimidazole synthetase 3e-36
2z1e_A_1-159159 (A:1-159) Hydrogenase expression/formation protein 3e-28
2rb9_A_1-158158 (A:1-158) HYPE protein; hydrogenase maturation, di 2e-27
3kiz_A_1-177177 (A:1-177) Phosphoribosylformylglycinamidine cyclo- 1e-25
2v9y_A_1-141141 (A:1-141) Phosphoribosylformylglycinamidine cyclo- 6e-34
2yxz_A_24-146123 (A:24-146) Thiamin-monophosphate kinase; alpha/bet 1e-24
3c9u_A_60-178119 (A:60-178) Thiamine monophosphate kinase; beta bar 6e-24
2z1u_A_38-158121 (A:38-158) Hydrogenase expression/formation protei 3e-23
3fd5_A_59-189131 (A:59-189) Selenide, water dikinase 1; selenophosp 2e-20
2v9y_A_142-334193 (A:142-334) Phosphoribosylformylglycinamidine cycl 2e-33
2z01_A_172-348177 (A:172-348) Phosphoribosylformylglycinamidine cycl 5e-33
2btu_A_170-346177 (A:170-346) Phosphoribosyl-aminoimidazole syntheta 8e-32
1cli_A_173-345173 (A:173-345) Protein (phosphoribosyl-aminoimidazole 8e-31
3fd5_A_190-394205 (A:190-394) Selenide, water dikinase 1; selenophos 8e-27
1vk3_A_29-45_179-359198 (A:29-45,A:179-359) Phosphoribosylformylglycinamid 3e-23
3c9u_A_179-342164 (A:179-342) Thiamine monophosphate kinase; beta ba 9e-22
2yxz_A_147-311165 (A:147-311) Thiamin-monophosphate kinase; alpha/be 2e-21
1t3t_A_212-226_436-615195 (A:212-226,A:436-615) Phosphoribosylformylglycinam 4e-21
2z1u_A_159-343185 (A:159-343) Hydrogenase expression/formation prote 2e-19
2z1e_A_160-338179 (A:160-338) Hydrogenase expression/formation prote 1e-16
2rb9_A_159-334176 (A:159-334) HYPE protein; hydrogenase maturation, 3e-16
3kiz_A_178-394217 (A:178-394) Phosphoribosylformylglycinamidine cycl 4e-28
1t3t_A_634-686_826-1022250 (A:634-686,A:826-1022) Phosphoribosylformylglycina 2e-04
>2zod_A (A:) Selenophosphate Synthetase {Aquifex Aeolicus}Length = 345 Back     alignment and structure
 Score =  158 bits (399), Expect = 1e-39
 Identities = 52/369 (14%), Positives = 106/369 (28%), Gaps = 57/369 (15%)

Query: 1   MNHERKRGLTYGQAGVNIEAGNRTVTQIKSAVKSTKRAGTIGEIGGFGGLFDLKKAGFVD 60
             H  +       +G   + G   + +I           T+  IG   G+++        
Sbjct: 7   GRHMVELLKLVRSSGCAAKVGPGDLQEILKGFNIYTDESTLVSIGDDAGVYE-----HNG 61

Query: 61  PILVSSSDGVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATS--QLN 118
            I V + D +   +            G    A  ++D+   G  P+  L     +  +L+
Sbjct: 62  IIWVYTVDIITPVVNDP------YLWGAISTANALSDVYAMGGIPVNALAISCFNNCELD 115

Query: 119 PDQATSIIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENV 178
            +    +I+G      +A   L+GG T +                 G     + ++    
Sbjct: 116 IEIFREVIRGALDKLREAKTVLLGGHTIDDKE------PKFGLSVAGICPEGKYITQSGA 169

Query: 179 CAGDLILGLPSSGLHSNGFALVRKIISLSQLSWKDPSPISSEHSLGETLLTPTRIYVSPL 238
             G L++     G       L   I+    ++                      + ++  
Sbjct: 170 QVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIE----------------NMLALNDK 213

Query: 239 LKILRKTGKIKALAHITGGGLTENIPRAIPA-HLTASINLNSVEVPQIISWLSKKAHVKP 297
            + L  +    A   +TG GL  +        ++ A I    V   Q+   L KK     
Sbjct: 214 ARNLMLSLDATACTDVTGFGLLGHAWNICKNSNIGARIFFEKVPYYQLSENLVKKKIYPK 273

Query: 298 AE---------------------VLRTFNCGIGMVIIVHPDNKDCIIKKFQENNENIILI 336
                                  +L       G++  ++ +  + I +  +E   N  +I
Sbjct: 274 GAIENLNFVKNYLKSNLDNWKLILLSDPVTSGGLLFTINKEKLEKIDETAKELEVNYWII 333

Query: 337 GEVTQRSEK 345
           GE    +  
Sbjct: 334 GETIAENVL 342


>2z01_A (A:1-171) Phosphoribosylformylglycinamidine cyclo-ligase; alpha and beta proteins, cytoplasm, purine biosynthesis, structural genomics, NPPSFA; 2.20A {Geobacillus kaustophilus}Length = 171 Back     alignment and structure
>1cli_A (A:1-172) Protein (phosphoribosyl-aminoimidazole synthetase); AIR synthetase, PURM, purine biosynthesis, trifunctional enzyme, PURL; 2.50A {Escherichia coli}Length = 172 Back     alignment and structure
>2btu_A (A:1-169) Phosphoribosyl-aminoimidazole synthetase; synthase, PURM, de novo purine biosynthesis, AIR synthase family, spine, FGAR amidotransferase; 2.31A {Bacillus anthracis}Length = 169 Back     alignment and structure
>2z1e_A (A:1-159) Hydrogenase expression/formation protein HYPE; [NIFE] hydrogenase maturation, ATPase, transferase; 1.55A {Thermococcus kodakarensis KOD1}Length = 159 Back     alignment and structure
>2rb9_A (A:1-158) HYPE protein; hydrogenase maturation, dimer, enzyme, X- RAY crystallography, structural genomics, BSGI; 2.00A {Escherichia coli O157} PDB: 2i6r_ALength = 158 Back     alignment and structure
>3kiz_A (A:1-177) Phosphoribosylformylglycinamidine cyclo-ligase; structural genomics, joint center for structural genomics, JCSG; 1.50A {Cytophaga hutchinsonii atcc 33406}Length = 177 Back     alignment and structure
>2v9y_A (A:1-141) Phosphoribosylformylglycinamidine cyclo-ligase; multifunctional enzyme, structural genomics consortium, nucleotide-binding, purine biosynthesis; 2.10A {Homo sapiens}Length = 141 Back     alignment and structure
>2yxz_A (A:24-146) Thiamin-monophosphate kinase; alpha/beta structure, transferase; 1.90A {Thermus thermophilus HB8}Length = 123 Back     alignment and structure
>3c9u_A (A:60-178) Thiamine monophosphate kinase; beta barrel, alpha-beta structure, transferase; HET: TPP ADP; 1.48A {Aquifex aeolicus}Length = 119 Back     alignment and structure
>2z1u_A (A:38-158) Hydrogenase expression/formation protein HYPE; alpha-beta fold, beta barrel, lyase; HET: ATP; 2.00A {Desulfovibrio vulgaris subsp} PDB: 2z1t_A*Length = 121 Back     alignment and structure
>3fd5_A (A:59-189) Selenide, water dikinase 1; selenophosphate synthetase, SELD, ATP-binding, nucleotide-binding, selenium, transferase; HET: AP2; 1.90A {Homo sapiens} PDB: 3fd6_A*Length = 131 Back     alignment and structure
>2v9y_A (A:142-334) Phosphoribosylformylglycinamidine cyclo-ligase; multifunctional enzyme, structural genomics consortium, nucleotide-binding, purine biosynthesis; 2.10A {Homo sapiens}Length = 193 Back     alignment and structure
>2z01_A (A:172-348) Phosphoribosylformylglycinamidine cyclo-ligase; alpha and beta proteins, cytoplasm, purine biosynthesis, structural genomics, NPPSFA; 2.20A {Geobacillus kaustophilus}Length = 177 Back     alignment and structure