254780570

254780570

phosphoribosylglycinamide formyltransferase

GeneID in NCBI database:8209567Locus tag:CLIBASIA_02285
Protein GI in NCBI database:254780570Protein Accession:YP_003064983.1
Gene range:-(712566, 713183)Protein Length:205aa
Gene description:phosphoribosylglycinamide formyltransferase
COG prediction:[F] Folate-dependent phosphoribosylglycinamide formyltransferase PurN
KEGG prediction:purN; phosphoribosylglycinamide formyltransferase (EC:2.1.2.2); K11175 phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
SEED prediction:Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
One carbon pool by folate [PATH:las00670]
Subsystem involved in SEED:De Novo Purine Biosynthesis;
Glutathione-regulated potassium-efflux system and associated functions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MIRKNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYKDYISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESSLSQKVLSAEHLLYPLALKYTILGKTSNSNDHHHLIGIG
ccccEEEEEEccccccHHHHHHHHHccccccEEEEEEEccccHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHccccEEEEccccccccccccHHHHHHHccccEEEEEEEEEccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccEEEEEEcc
ccccEEEEEEccccHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHcccEEEEccHHHcccHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHcHHHEEEEEcccccccccccHHHHHHHccccEEEEEEEEcccccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEcccEEEEcccc
MIRKNIVIFISGEGTNMLSLIQAtkkndypaeivgvfsdnsnaQGLVKARkekvptfpipykdyisRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILnihpsllplfpglhTHRRVLQSGIKITGCTVHMVTanmdegpiiaqaavpvssqdtesslSQKVLSAEHLLYPLALKYTilgktsnsndhhhligig
MIRKNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGlvkarkekvptfpipykdyiSRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESSLSQKVLSAEHLLYPLALKYTILgktsnsndHHHLIGIG
MIRKNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYKDYISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESSLSQKVLSAEHLLYPLALKYTILGKTSNSNDHHHLIGIG
**RKNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYKDYISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESSLSQKVLSAEHLLYPLALKYTILGKTSNSNDHHHLIGI*
MIRKNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYKDYISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAV*************KVLSAEHLLYPLALKYTILGKTSNSNDHHHLIGIG
**RKNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYKDYISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESSLSQKVLSAEHLLYPLALKYTILGKTSNSNDHHHLIGI*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRKNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYKDYISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESSLSQKVLSAEHLLYPLALKYTILGKTSNSNDHHHLIGIG
MIRKNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYKDYISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESSLSQKVLSAEHLLYPLALKYTILGKTSNSNDHHHLIGIG
MIRKNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYKDYISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESSLSQKVLSAEHLLYPLALKYTILGKTSNSNDHHHLIGIG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target205 phosphoribosylglycinamide formyltransferase [Candidatus
254780911288 formyltetrahydrofolate deformylase [Candidatus Lib 5e-15
255764462 310 methionyl-tRNA formyltransferase [Candidatus Liber 8e-07
>gi|254780911|ref|YP_003065324.1| formyltetrahydrofolate deformylase [Candidatus Liberibacter asiaticus str. psy62] Length = 288 Back     alignment
 Score = 72.4 bits (176), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 72/132 (54%), Gaps = 3/132 (2%)

Query: 33  IVGVFSDNSNAQGLVKARKEKVPTFPIPYKDYISRREHEKAILMQLSSIQPDLICLAGYM 92
           IVGV S+++  + LV+    ++P + +P  +  ++ E E+ ++  +     +L+ LA YM
Sbjct: 113 IVGVVSNHTTHKKLVE--NYQLPFYYLPMTEQ-NKIESEQKLINIIEKNNVELMILARYM 169

Query: 93  RLLSRDFVESYKNKILNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPII 152
           ++LS         +I+NIH S LP F G + +++  + G+KI G T H     +D GPII
Sbjct: 170 QILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPII 229

Query: 153 AQAAVPVSSQDT 164
            Q  V V+   T
Sbjct: 230 EQDVVRVTHAQT 241

>gi|255764462|ref|YP_003064709.2| methionyl-tRNA formyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 310 Back     alignment
 Score = 45.4 bits (106), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 48  KARKEKVPTFPIPYKDYISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKI 107
           KA++  +P   +P K  + + E+E     Q  S   D+  +  Y  ++ +  + + K   
Sbjct: 54  KAQEFSLPAL-VPTK--LGQEEYE-----QFLSFNADVAVVVAYGLVIPQRILNATKLGF 105

Query: 108 LNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESS 167
            N H SLLP + G    +R + +G   TG  +  +  ++D GP+     VP+SS    + 
Sbjct: 106 YNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAG 165

Query: 168 LSQKV 172
           L Q++
Sbjct: 166 LQQEL 170

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target205 phosphoribosylglycinamide formyltransferase [Candidatus
315121763205 phosphoribosylglycinamide formyltransferase [Candidatus 1 1e-88
222085482225 phosphoribosylglycinamide formyltransferase [Agrobacter 1 1e-62
218672935223 phosphoribosylglycinamide formyltransferase [Rhizobium 1 1e-62
239831544207 phosphoribosylglycinamide formyltransferase [Ochrobactr 1 3e-62
222148176229 phosphoribosylglycinamide formyltransferase [Agrobacter 1 2e-61
325292514224 phosphoribosylglycinamide formyltransferase [Agrobacter 1 3e-61
256113245205 phosphoribosylglycinamide formyltransferase [Brucella m 1 2e-60
161486698205 phosphoribosylglycinamide formyltransferase [Brucella s 1 2e-60
241203975223 phosphoribosylglycinamide formyltransferase [Rhizobium 1 2e-60
254718846205 phosphoribosylglycinamide formyltransferase [Brucella s 1 2e-60
>gi|315121763|ref|YP_004062252.1| phosphoribosylglycinamide formyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 205 Back     alignment and organism information
 Score =  329 bits (844), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 159/205 (77%), Positives = 181/205 (88%)

Query: 1   MIRKNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIP 60
           M  KN+VIFISGEGTNMLSLI ATKK  YPA+IVGVFSDN NA+GL+KA+KEK+PT+ IP
Sbjct: 1   MTCKNVVIFISGEGTNMLSLIHATKKTYYPAQIVGVFSDNPNARGLIKAQKEKIPTYLIP 60

Query: 61  YKDYISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPG 120
           YKDY SR EHE+ IL QLSSI+PDLICLAGYMRLLS++FV+SYK++ILNIHPSLLPLFPG
Sbjct: 61  YKDYSSRAEHEEKILSQLSSIKPDLICLAGYMRLLSKNFVQSYKDRILNIHPSLLPLFPG 120

Query: 121 LHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESSLSQKVLSAEHLLY 180
           +HTHRRVLQSG+KITGCTVH+VT N+D GPIIAQA+VPV   DTE SLSQKVLS EHLLY
Sbjct: 121 IHTHRRVLQSGLKITGCTVHIVTENLDAGPIIAQASVPVFLNDTEESLSQKVLSIEHLLY 180

Query: 181 PLALKYTILGKTSNSNDHHHLIGIG 205
           PLAL+Y ILGKTS   D ++ IGIG
Sbjct: 181 PLALEYIILGKTSKLKDGNYTIGIG 205


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085482|ref|YP_002544012.1| phosphoribosylglycinamide formyltransferase [Agrobacterium radiobacter K84] Length = 225 Back     alignment and organism information
>gi|218672935|ref|ZP_03522604.1| phosphoribosylglycinamide formyltransferase [Rhizobium etli GR56] Length = 223 Back     alignment and organism information
>gi|239831544|ref|ZP_04679873.1| phosphoribosylglycinamide formyltransferase [Ochrobactrum intermedium LMG 3301] Length = 207 Back     alignment and organism information
>gi|222148176|ref|YP_002549133.1| phosphoribosylglycinamide formyltransferase [Agrobacterium vitis S4] Length = 229 Back     alignment and organism information
>gi|325292514|ref|YP_004278378.1| phosphoribosylglycinamide formyltransferase [Agrobacterium sp. H13-3] Length = 224 Back     alignment and organism information
>gi|256113245|ref|ZP_05454113.1| phosphoribosylglycinamide formyltransferase [Brucella melitensis bv. 3 str. Ether] Length = 205 Back     alignment and organism information
>gi|161486698|ref|NP_697723.2| phosphoribosylglycinamide formyltransferase [Brucella suis 1330] Length = 205 Back     alignment and organism information
>gi|241203975|ref|YP_002975071.1| phosphoribosylglycinamide formyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 223 Back     alignment and organism information
>gi|254718846|ref|ZP_05180657.1| phosphoribosylglycinamide formyltransferase [Brucella sp. 83/13] Length = 205 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target205 phosphoribosylglycinamide formyltransferase [Candidatus
PRK05647200 PRK05647, purN, phosphoribosylglycinamide formyltransfe 3e-77
TIGR00639190 TIGR00639, PurN, phosphoribosylglycinamide formyltransf 1e-57
pfam00551181 pfam00551, Formyl_trans_N, Formyl transferase 2e-50
KOG3076206 KOG3076, KOG3076, KOG3076, 5'-phosphoribosylglycinamide 9e-49
COG0788287 COG0788, PurU, Formyltetrahydrofolate hydrolase [Nucleo 5e-34
PLN02331207 PLN02331, PLN02331, phosphoribosylglycinamide formyltra 5e-33
TIGR00655280 TIGR00655, PurU, formyltetrahydrofolate deformylase 7e-32
PRK06027286 PRK06027, purU, formyltetrahydrofolate deformylase; Rev 5e-28
PRK13010289 PRK13010, purU, formyltetrahydrofolate deformylase; Rev 5e-20
TIGR00460 313 TIGR00460, fmt, methionyl-tRNA formyltransferase 9e-18
COG0223 307 COG0223, Fmt, Methionyl-tRNA formyltransferase [Transla 3e-16
KOG2452 881 KOG2452, KOG2452, KOG2452, Formyltetrahydrofolate dehyd 6e-06
COG0299200 COG0299, PurN, Folate-dependent phosphoribosylglycinami 1e-66
PLN02828268 PLN02828, PLN02828, formyltetrahydrofolate deformylase 7e-19
PLN02285 334 PLN02285, PLN02285, methionyl-tRNA formyltransferase 3e-16
PRK08125 660 PRK08125, PRK08125, bifunctional UDP-glucuronic acid de 2e-11
KOG3082 338 KOG3082, KOG3082, KOG3082, Methionyl-tRNA formyltransfe 2e-10
PRK00005 309 PRK00005, fmt, methionyl-tRNA formyltransferase; Review 4e-10
PRK06988 312 PRK06988, PRK06988, putative formyltransferase; Provisi 5e-07
PRK13011286 PRK13011, PRK13011, formyltetrahydrofolate deformylase; 1e-18
PRK07579245 PRK07579, PRK07579, hypothetical protein; Provisional 1e-05
>gnl|CDD|180182 PRK05647, purN, phosphoribosylglycinamide formyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|161973 TIGR00639, PurN, phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent Back     alignment and domain information
>gnl|CDD|144222 pfam00551, Formyl_trans_N, Formyl transferase Back     alignment and domain information
>gnl|CDD|38286 KOG3076, KOG3076, KOG3076, 5'-phosphoribosylglycinamide formyltransferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|31131 COG0788, PurU, Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|177965 PLN02331, PLN02331, phosphoribosylglycinamide formyltransferase Back     alignment and domain information
>gnl|CDD|161980 TIGR00655, PurU, formyltetrahydrofolate deformylase Back     alignment and domain information
>gnl|CDD|180354 PRK06027, purU, formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>gnl|CDD|139334 PRK13010, purU, formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>gnl|CDD|161888 TIGR00460, fmt, methionyl-tRNA formyltransferase Back     alignment and domain information
>gnl|CDD|30572 COG0223, Fmt, Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|37663 KOG2452, KOG2452, KOG2452, Formyltetrahydrofolate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|30647 COG0299, PurN, Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178422 PLN02828, PLN02828, formyltetrahydrofolate deformylase Back     alignment and domain information
>gnl|CDD|177923 PLN02285, PLN02285, methionyl-tRNA formyltransferase Back     alignment and domain information
>gnl|CDD|181239 PRK08125, PRK08125, bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>gnl|CDD|38292 KOG3082, KOG3082, KOG3082, Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178787 PRK00005, fmt, methionyl-tRNA formyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|180785 PRK06988, PRK06988, putative formyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183839 PRK13011, PRK13011, formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>gnl|CDD|181046 PRK07579, PRK07579, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 205 phosphoribosylglycinamide formyltransferase [Candidatus
TIGR00639215 PurN phosphoribosylglycinamide formyltransferase; Inter 100.0
PRK05647200 purN phosphoribosylglycinamide formyltransferase; Revie 100.0
COG0299200 PurN Folate-dependent phosphoribosylglycinamide formylt 100.0
pfam00551181 Formyl_trans_N Formyl transferase. This family includes 100.0
KOG3076206 consensus 100.0
PRK06027285 purU formyltetrahydrofolate deformylase; Reviewed 100.0
PRK13010289 purU formyltetrahydrofolate deformylase; Reviewed 100.0
PRK13011287 formyltetrahydrofolate deformylase; Reviewed 100.0
TIGR00655294 PurU formyltetrahydrofolate deformylase; InterPro: IPR0 100.0
COG0788287 PurU Formyltetrahydrofolate hydrolase [Nucleotide trans 100.0
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 100.0
PRK06988 313 putative formyltransferase; Provisional 100.0
PRK00005 309 fmt methionyl-tRNA formyltransferase; Reviewed 100.0
COG0223 307 Fmt Methionyl-tRNA formyltransferase [Translation, ribo 100.0
TIGR00460 385 fmt methionyl-tRNA formyltransferase; InterPro: IPR0057 99.97
KOG2452 881 consensus 99.81
PRK07579245 hypothetical protein; Provisional 99.94
KOG3082 338 consensus 99.85
PRK08300 298 acetaldehyde dehydrogenase; Validated 97.14
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating). 96.9
COG0482 356 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate 95.34
pfam00185155 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Or 91.24
cd03807 365 GT1_WbnK_like This family is most closely related to th 90.41
PRK05447 379 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provis 94.5
PRK12767 325 carbamoyl phosphate synthase-like protein; Provisional 93.1
TIGR02075236 pyrH_bact uridylate kinase; InterPro: IPR015963 Uridyla 92.88
TIGR00289227 TIGR00289 conserved hypothetical protein TIGR00289; Int 93.27
TIGR01227328 hutG formimidoylglutamase; InterPro: IPR005923 Formimin 92.8
PRK00143 355 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methylt 92.99
PRK13820 395 argininosuccinate synthase; Provisional 91.06
>TIGR00639 PurN phosphoribosylglycinamide formyltransferase; InterPro: IPR004607 This family describes phosphoribosylglycinamide formyltransferase (GAR transformylase), one of several proteins found in formyltransferase Back     alignment and domain information
>PRK05647 purN phosphoribosylglycinamide formyltransferase; Reviewed Back     alignment and domain information
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam00551 Formyl_trans_N Formyl transferase Back     alignment and domain information
>KOG3076 consensus Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase; InterPro: IPR004810 An Escherichia coli gene designated purU has been identified and characterised Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK06988 putative formyltransferase; Provisional Back     alignment and domain information
>PRK00005 fmt methionyl-tRNA formyltransferase; Reviewed Back     alignment and domain information
>COG0223 Fmt Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00460 fmt methionyl-tRNA formyltransferase; InterPro: IPR005794 Methionyl-tRNA formyltransferase (2 Back     alignment and domain information
>KOG2452 consensus Back     alignment and domain information
>PRK07579 hypothetical protein; Provisional Back     alignment and domain information
>KOG3082 consensus Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>TIGR02075 pyrH_bact uridylate kinase; InterPro: IPR015963 Uridylate kinases (also known as UMP kinases) are key enzymes in the synthesis of nucleoside triphosphates Back     alignment and domain information
>TIGR00289 TIGR00289 conserved hypothetical protein TIGR00289; InterPro: IPR005237 This family of conserved hypothetical proteins has no known function Back     alignment and domain information
>TIGR01227 hutG formimidoylglutamase; InterPro: IPR005923 Formiminoglutamase (3 Back     alignment and domain information
>PRK00143 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; Reviewed Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target205 phosphoribosylglycinamide formyltransferase [Candidatus
2ywr_A216 Crystal Structure Of Gar Transformylase From Aquife 8e-37
1grc_A212 Crystal Structure Of Glycinamide Ribonucleotide Tra 9e-37
1cdd_A212 Structures Of Apo And Complexed Escherichia Coli Gl 9e-37
2gar_A212 A Ph-Dependent Stablization Of An Active Site Loop 9e-37
1c3e_A209 New Insights Into Inhibitor Design From The Crystal 1e-36
3p9x_A211 Crystal Structure Of Phosphoribosylglycinamide Form 3e-31
1zly_A203 The Structure Of Human Glycinamide Ribonucleotide T 1e-30
1meo_A209 Human Glycinamide Ribonucleotide Transformylase At 1e-30
3kcq_A215 Crystal Structure Of Phosphoribosylglycinamide Form 1e-30
1zlx_A203 The Apo Structure Of Human Glycinamide Ribonucleoti 4e-30
1mej_B223 Human Glycinamide Ribonucleotide Transformylase Dom 4e-30
3n0v_A286 Crystal Structure Of A Formyltetrahydrofolate Defor 1e-27
3nrb_A287 Crystal Structure Of A Formyltetrahydrofolate Defor 2e-27
3obi_A288 Crystal Structure Of A Formyltetrahydrofolate Defor 9e-27
3o1l_A302 Crystal Structure Of A Formyltetrahydrofolate Defor 5e-26
3lou_A292 Crystal Structure Of Formyltetrahydrofolate Deformy 2e-24
3da8_A215 Crystal Structure Of Purn From Mycobacterium Tuberc 1e-18
1s3i_A 310 Crystal Structure Of The N Terminal Hydrolase Domai 8e-09
2bw0_A 329 Crystal Structure Of The Hydrolase Domain Of Human 1e-08
3rfo_A 317 Crystal Structure Of Methyionyl-Trna Formyltransfer 5e-07
1yrw_A 302 Crystal Structure Of E.Coli Arna Transformylase Dom 3e-06
2bln_A 305 N-Terminal Formyltransferase Domain Of Arna In Comp 3e-06
1z7e_A 660 Crystal Structure Of Full Length Arna Length = 660 5e-06
3r8x_A 318 Crystal Structure Of Methionyl-Trna Formyltransfera 4e-05
1fmt_A 314 Methionyl-Trnafmet Formyltransferase From Escherich 7e-05
3q0i_A 318 Methionyl-Trna Formyltransferase From Vibrio Choler 0.001
>gi|159795629|pdb|2YWR|A Chain A, Crystal Structure Of Gar Transformylase From Aquifex Aeolicus Length = 216 Back     alignment and structure
 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 67/197 (34%), Positives = 117/197 (59%)

Query: 5   NIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYKDY 64
            I + +SG G+N+ ++I A +     A I  V SDN  A  + + +K  V    I  K++
Sbjct: 3   KIGVLVSGRGSNLQAIIDAIESGKVNASIELVISDNPKAYAIERCKKHNVECKVIQRKEF 62

Query: 65  ISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTH 124
            S++E E+   ++L     +L+ LAG+ R+LS +F++ + NK++NIHPSL+P F GLH  
Sbjct: 63  PSKKEFEERXALELKKKGVELVVLAGFXRILSHNFLKYFPNKVINIHPSLIPAFQGLHAQ 122

Query: 125 RRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESSLSQKVLSAEHLLYPLAL 184
           ++ ++ G+K +GCTVH+V  ++D GP+I QA VPV  +D E++L+ ++L  EH + P  +
Sbjct: 123 KQAVEFGVKFSGCTVHIVDESVDAGPVIVQAVVPVLPEDDENTLADRILKWEHKILPQTV 182

Query: 185 KYTILGKTSNSNDHHHL 201
           ++    +         +
Sbjct: 183 QWFAQDRIIIDGRKVIV 199


gi|442965|pdb|1GRC|A Chain A, Crystal Structure Of Glycinamide Ribonucleotide Transformylase From Escherichia Coli At 3.0 Angstroms Resolution: A Target Enzyme For Chemotherapy Length = 212 Back     alignment and structure
>gi|809280|pdb|1CDD|A Chain A, Structures Of Apo And Complexed Escherichia Coli Glycinamide Ribonucleotide Transformylase Length = 212 Back     alignment and structure
>gi|157835027|pdb|2GAR|A Chain A, A Ph-Dependent Stablization Of An Active Site Loop Observed From Low And High Ph Crystal Structures Of Mutant Monomeric Glycinamide Ribonucleotide Transformylase Length = 212 Back     alignment and structure
>gi|6730124|pdb|1C3E|A Chain A, New Insights Into Inhibitor Design From The Crystal Structure And Nmr Studies Of E. Coli Gar Transformylate In Complex With Beta-Gar And 10-Formyl-5,8,10-Trideazafolic Acid. Length = 209 Back     alignment and structure
>gi|319443711|pdb|3P9X|A Chain A, Crystal Structure Of Phosphoribosylglycinamide Formyltransferase From Bacillus Halodurans Length = 211 Back     alignment and structure
>gi|75765818|pdb|1ZLY|A Chain A, The Structure Of Human Glycinamide Ribonucleotide Transformylase In Complex With Alpha,Beta-N- (Hydroxyacetyl)-D-Ribofuranosylamine And 10-Formyl-5,8, Dideazafolate Length = 203 Back     alignment and structure
>gi|27573895|pdb|1MEO|A Chain A, Human Glycinamide Ribonucleotide Transformylase At Ph 4.2 Length = 209 Back     alignment and structure
>gi|281307158|pdb|3KCQ|A Chain A, Crystal Structure Of Phosphoribosylglycinamide Formyltransferase From Anaplasma Phagocytophilum Length = 215 Back     alignment and structure
>gi|75765817|pdb|1ZLX|A Chain A, The Apo Structure Of Human Glycinamide Ribonucleotide Transformylase Length = 203 Back     alignment and structure
>gi|27573889|pdb|1MEJ|B Chain B, Human Glycinamide Ribonucleotide Transformylase Domain At Ph 8.5 Length = 223 Back     alignment and structure
>gi|298508708|pdb|3N0V|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (P From Pseudomonas Putida Kt2440 At 2.25 A Resolution Length = 286 Back     alignment and structure
>gi|301598784|pdb|3NRB|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (Puru, Pp_1943) From Pseudomonas Putida Kt2440 At 2.05 A Resolution Length = 287 Back     alignment and structure
>gi|303325207|pdb|3OBI|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (Np_949368) From Rhodopseudomonas Palustris Cga009 At 1.95 A Resolution Length = 288 Back     alignment and structure
>gi|306991895|pdb|3O1L|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (Pspto_4314) From Pseudomonas Syringae Pv. Tomato Str. Dc3000 At 2.20 A Resolution Length = 302 Back     alignment and structure
>gi|289526942|pdb|3LOU|A Chain A, Crystal Structure Of Formyltetrahydrofolate Deformylase (Yp_105254.1) From Burkholderia Mallei Atcc 23344 At 1.90 A Resolution Length = 292 Back     alignment and structure
>gi|237640472|pdb|3DA8|A Chain A, Crystal Structure Of Purn From Mycobacterium Tuberculosis Length = 215 Back     alignment and structure
>gi|42543697|pdb|1S3I|A Chain A, Crystal Structure Of The N Terminal Hydrolase Domain Of 10- Formyltetrahydrofolate Dehydrogenase Length = 310 Back     alignment and structure
>gi|73536304|pdb|2BW0|A Chain A, Crystal Structure Of The Hydrolase Domain Of Human 10- Formyltetrahydrofolate 2 Dehydrogenase Length = 329 Back     alignment and structure
>gi|329666301|pdb|3RFO|A Chain A, Crystal Structure Of Methyionyl-Trna Formyltransferase From Bacillus Anthracis Length = 317 Back     alignment and structure
>gi|66361188|pdb|1YRW|A Chain A, Crystal Structure Of E.Coli Arna Transformylase Domain Length = 302 Back     alignment and structure
>gi|66361563|pdb|2BLN|A Chain A, N-Terminal Formyltransferase Domain Of Arna In Complex With N-5-Formyltetrahydrofolate And Ump Length = 305 Back     alignment and structure
gi|71042200|pdb|1Z7E|A Chain A, Crystal Structure Of Full Length Arna Length = 660 Back     alignment and structure
>gi|328877395|pdb|3R8X|A Chain A, Crystal Structure Of Methionyl-Trna Formyltransferase From Yersinia Pestis Complexed With L-Methionine Length = 318 Back     alignment and structure
>gi|2914332|pdb|1FMT|A Chain A, Methionyl-Trnafmet Formyltransferase From Escherichia Coli Length = 314 Back     alignment and structure
>gi|315583678|pdb|3Q0I|A Chain A, Methionyl-Trna Formyltransferase From Vibrio Cholerae Length = 318 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target205 phosphoribosylglycinamide formyltransferase [Candidatus
3lou_A292 Formyltetrahydrofolate deformylase; structural genomics 4e-50
1jkx_A212 GART;, phosphoribosylglycinamide formyltransferase; pur 6e-49
1meo_A209 Phosophoribosylglycinamide formyltransferase; purine bi 1e-45
3kcq_A215 Phosphoribosylglycinamide formyltransferase; structural 2e-45
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transferase, 8e-42
3o1l_A302 Formyltetrahydrofolate deformylase; structural genomics 4e-41
3nrb_A287 Formyltetrahydrofolate deformylase; N-terminal ACT doma 1e-39
3obi_A288 Formyltetrahydrofolate deformylase; structural genomics 8e-39
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossmann f 1e-34
1fmt_A 314 Methionyl-tRNA FMet formyltransferase; initiator tRNA, 1e-32
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrolase; H 1e-25
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransferase 1e-24
1zgh_A260 Methionyl-tRNA formyltransferase; southeast collaborato 3e-09
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia mallei} Length = 292 Back     alignment and structure
 Score =  192 bits (490), Expect = 4e-50
 Identities = 51/189 (26%), Positives = 80/189 (42%), Gaps = 3/189 (1%)

Query: 3   RKNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYK 62
           R  ++I +S     +  L+   K  +   +IVG+ S++ +   L          FPI   
Sbjct: 95  RPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIVSNHPDFAPLAAQHGLPFRHFPITAD 154

Query: 63  DYISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLH 122
                 + E   L    +   +L+ LA YM++LS +      N+ +NIH S LP F G  
Sbjct: 155 TK---AQQEAQWLDVFETSGAELVILARYMQVLSPEASARLANRAINIHHSFLPGFKGAK 211

Query: 123 THRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESSLSQKVLSAEHLLYPL 182
            + +    G+K+ G T H VT ++DEGPII Q    V        L       E +    
Sbjct: 212 PYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDHSYRPEQLLAVGRDVECITLAR 271

Query: 183 ALKYTILGK 191
           A+K  I  +
Sbjct: 272 AVKAFIERR 280


>1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* Length = 212 Back     alignment and structure
>1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* Length = 209 Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural genomics center for infectious disease; 2.20A {Anaplasma phagocytophilum HZ} Length = 215 Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Length = 286 Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 2.20A {Pseudomonas syringae PV} Length = 302 Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Length = 287 Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.95A {Rhodopseudomonas palustris} Length = 288 Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Length = 216 Back     alignment and structure
>1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A* Length = 314 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660 Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Length = 215 Back     alignment and structure
>1zgh_A Methionyl-tRNA formyltransferase; southeast collaboratory for structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum atcc 27405} SCOP: b.46.1.1 c.65.1.1 Length = 260 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target205 phosphoribosylglycinamide formyltransferase [Candidatus
3lou_A292 Formyltetrahydrofolate deformylase; structural genomics 100.0
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transferase, 100.0
3o1l_A302 Formyltetrahydrofolate deformylase; structural genomics 100.0
1jkx_A212 GART;, phosphoribosylglycinamide formyltransferase; pur 100.0
3nrb_A287 Formyltetrahydrofolate deformylase; N-terminal ACT doma 100.0
3obi_A288 Formyltetrahydrofolate deformylase; structural genomics 100.0
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossmann f 100.0
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransferase 100.0
3kcq_A215 Phosphoribosylglycinamide formyltransferase; structural 100.0
1meo_A209 Phosophoribosylglycinamide formyltransferase; purine bi 100.0
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrolase; H 100.0
2bw0_A 329 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nuc 100.0
2bln_A 305 Protein YFBG; transferase, formyltransferase, L-ARA4N b 100.0
1fmt_A 314 Methionyl-tRNA FMet formyltransferase; initiator tRNA, 100.0
1zgh_A260 Methionyl-tRNA formyltransferase; southeast collaborato 99.92
3a06_A 376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pa 96.38
2c82_A 413 1-deoxy-D-xylulose 5-phosphate reductoisomerase; RV2870 95.45
1q0q_A 406 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidor 93.53
2d13_A227 Hypothetical protein PH1257; structural genomics, NPPSF 91.27
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH 95.37
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxo 95.22
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI- 92.53
3ezy_A 344 Dehydrogenase; structural genomics, unknown function, P 91.66
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO- 91.62
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural genomics 91.46
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 91.41
3euw_A 344 MYO-inositol dehydrogenase; protein structure initiativ 91.41
3k32_A203 Uncharacterized protein MJ0690; predicted subunit of tR 90.97
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 90.7
3ot5_A 403 UDP-N-acetylglucosamine 2-epimerase; structural genomic 92.0
3beo_A 375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allost 91.43
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
Probab=100.00  E-value=0  Score=385.43  Aligned_cols=196  Identities=27%  Similarity=0.371  Sum_probs=188.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHCCCCC
Q ss_conf             66599997698501899999997399984799999768888788899860895046301323322101243210001234
Q gi|254780570|r    3 RKNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYKDYISRREHEKAILMQLSSIQ   82 (205)
Q Consensus         3 k~riavl~SG~Gsnl~~Il~~~~~~~~~~eI~~Visn~~da~~l~~a~~~~Ip~~~i~~~~~~~~~~~~~~l~~~l~~~~   82 (205)
                      |+|+|||+||+||||++|++++++++++++|++|+||+++++++  ++.+++|++.++.. ..+++++|+++.+.+++++
T Consensus        95 ~~riavlvSg~g~~L~~Ll~~~~~g~L~~eI~~ViSN~~~~~~l--~~a~~ip~~~~~~~-~~~~~~~e~~~~~~l~~~~  171 (292)
T 3lou_A           95 RPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIVSNHPDFAPL--AAQHGLPFRHFPIT-ADTKAQQEAQWLDVFETSG  171 (292)
T ss_dssp             CCEEEEEECSCCHHHHHHHHHHHHTSSCCEEEEEEESSSTTHHH--HHHTTCCEEECCCC-SSCHHHHHHHHHHHHHHHT
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHCCCCCEEEEEEECCCCCHHHH--HHHHCCCEEEEECC-CCCHHHHHHHHHHHHHHCC
T ss_conf             83699996799826999999997699981799997489427999--99754984786158-7627889999999986249


Q ss_pred             CEEEEEEEEEEECCCHHHHCCCCCEEECCCCCCCCCCCCCCCCCHHCCCCCCCCCCEEEECCCCCCCCEEEEEEEECCCC
Q ss_conf             30364311222057213210665423135322333244421210000246534453033123218662677899871899
Q gi|254780570|r   83 PDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQ  162 (205)
Q Consensus        83 ~Dliv~~g~~~il~~~~l~~~~~~~iN~HpslLP~yrG~~~~~~ai~~g~~~~G~TiH~v~~~~D~G~Ii~q~~~~i~~~  162 (205)
                      |||+|++|||+|||++|++.|++++||+||||||+|||++|++||+.+|++++|+|+|+|++++|+||||.|++++|.++
T Consensus       172 ~Dlivlagym~Il~~~~l~~~~~~iiNiHpSlLP~~~G~~~~~~ai~~g~k~~G~TvH~v~~~lD~GpII~Q~~~~I~~~  251 (292)
T 3lou_A          172 AELVILARYMQVLSPEASARLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDHS  251 (292)
T ss_dssp             CSEEEESSCCSCCCHHHHHHTTTSEEEEEEECSSCCCSSCHHHHHHHHTCSEEEEEEEECCSSTTCSCEEEEEEEECCTT
T ss_pred             CEEEEHHHHCCCCCCHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECCCC
T ss_conf             80998478134177063321678559965686623378881889997799579999999948983798069999874999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCEEEE
Q ss_conf             899999999999999999999999986956998986999
Q gi|254780570|r  163 DTESSLSQKVLSAEHLLYPLALKYTILGKTSNSNDHHHL  201 (205)
Q Consensus       163 d~~~~l~~rv~~~E~~l~~~~i~~~~~g~i~~~~~~~~~  201 (205)
                      ||+++|.+|++++|+++|+++|++++++|+.+.++++.+
T Consensus       252 dt~~~L~~~~~~~E~~~l~~ai~~~~e~rv~~~~~ktvv  290 (292)
T 3lou_A          252 YRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVV  290 (292)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEETTEEEE
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHCCEEECCCEEEE
T ss_conf             999999999999999999999999981998990998899



>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural genomics center for infectious disease; 2.20A {Anaplasma phagocytophilum HZ} Back     alignment and structure
>1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A Back     alignment and structure
>2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A Back     alignment and structure
>1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A* Back     alignment and structure
>1zgh_A Methionyl-tRNA formyltransferase; southeast collaboratory for structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum atcc 27405} SCOP: b.46.1.1 c.65.1.1 Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>2c82_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; RV2870C, DOXP/MEP pathway, oxidoreductase, isoprene biosynthesis, metal-binding; 1.9A {Mycobacterium tuberculosis} PDB: 2jd1_A* 2jcv_A* 2jcz_A* 2jd2_A 2jcx_A* 2jcy_A 2jd0_A* Back     alignment and structure
>1q0q_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1q0l_A* 1q0h_A* 1k5h_A 1onn_A 1ono_A 1onp_A* 1jvs_A* 1t1r_A* 1t1s_A* 2egh_A* 3iie_A Back     alignment and structure
>2d13_A Hypothetical protein PH1257; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Pyrococcus horikoshii} SCOP: c.26.2.1 PDB: 3h7e_A* 1ru8_A Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling, bifunctional enzyme; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium LT2} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 205 phosphoribosylglycinamide formyltransferase [Candidatus
d1jkxa_209 c.65.1.1 (A:) Glycinamide ribonucleotide transformylase 6e-33
d1meoa_205 c.65.1.1 (A:) Glycinamide ribonucleotide transformylase 2e-29
d1fmta2206 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase 6e-12
d2blna2203 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N 6e-06
d1zgha2164 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransferase 6e-13
>d1jkxa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]} Length = 209 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Formyltransferase
superfamily: Formyltransferase
family: Formyltransferase
domain: Glycinamide ribonucleotide transformylase, GART
species: Escherichia coli [TaxId: 562]
 Score =  134 bits (337), Expect = 6e-33
 Identities = 76/187 (40%), Positives = 121/187 (64%)

Query: 5   NIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYKDY 64
           NIV+ ISG G+N+ ++I A K N     +  VFS+ ++A GL +AR+  + T  +    +
Sbjct: 2   NIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAF 61

Query: 65  ISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTH 124
            SR  +++ ++ ++    PD++ LAG+MR+LS  FV  Y  ++LNIHPSLLP +PGLHTH
Sbjct: 62  DSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTH 121

Query: 125 RRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESSLSQKVLSAEHLLYPLAL 184
           R+ L++G +  G +VH VT  +D GP+I QA VPV + D+E  ++ +V + EH +YPL +
Sbjct: 122 RQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVI 181

Query: 185 KYTILGK 191
            +   G+
Sbjct: 182 SWFADGR 188


>d1meoa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 203 Back     information, alignment and structure
>d1zgha2 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransferase {Clostridium thermocellum [TaxId: 1515]} Length = 164 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target205 phosphoribosylglycinamide formyltransferase [Candidatus
d1jkxa_209 Glycinamide ribonucleotide transformylase, GART {Escher 100.0
d1meoa_205 Glycinamide ribonucleotide transformylase, GART {Human 100.0
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 {Human 100.0
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia coli 100.0
d2blna2203 Polymyxin resistance protein ArnA, N-terminal domain {E 100.0
d1zgha2164 Methionyl-tRNAfmet formyltransferase {Clostridium therm 99.91
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. 95.89
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [TaxId 91.19
d2d13a1226 Hypothetical protein PH1257 {Archaeon Pyrococcus horiko 90.08
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomo 93.39
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escher 92.41
>d1jkxa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Formyltransferase
superfamily: Formyltransferase
family: Formyltransferase
domain: Glycinamide ribonucleotide transformylase, GART
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=376.63  Aligned_cols=200  Identities=39%  Similarity=0.704  Sum_probs=194.9

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHCCCCCC
Q ss_conf             65999976985018999999973999847999997688887888998608950463013233221012432100012343
Q gi|254780570|r    4 KNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYKDYISRREHEKAILMQLSSIQP   83 (205)
Q Consensus         4 ~riavl~SG~Gsnl~~Il~~~~~~~~~~eI~~Visn~~da~~l~~a~~~~Ip~~~i~~~~~~~~~~~~~~l~~~l~~~~~   83 (205)
                      +|||||+||+||||++|+++++.++++++|++|+||++++.+++++++.+++.+....+.+..+..++..+.+.++++++
T Consensus         1 MkIaVl~SG~GSnL~aLl~a~~~~~l~~~I~~Visn~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~   80 (209)
T d1jkxa_           1 MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAP   80 (209)
T ss_dssp             CEEEEEESSCCHHHHHHHHHHHTTSSSSEEEEEEESCTTCHHHHHHHHTTCEEEECCGGGCSSHHHHHHHHHHHHGGGCC
T ss_pred             CEEEEEEECCCHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             98999981682779999999871899978999995798753120120134320232001234433348999999986099


Q ss_pred             EEEEEEEEEEECCCHHHHCCCCCEEECCCCCCCCCCCCCCCCCHHCCCCCCCCCCEEEECCCCCCCCEEEEEEEECCCCC
Q ss_conf             03643112220572132106654231353223332444212100002465344530331232186626778998718998
Q gi|254780570|r   84 DLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQD  163 (205)
Q Consensus        84 Dliv~~g~~~il~~~~l~~~~~~~iN~HpslLP~yrG~~~~~~ai~~g~~~~G~TiH~v~~~~D~G~Ii~q~~~~i~~~d  163 (205)
                      |++|++|||+|+|+++++.|++++||+||||||+|||++|++|++.||++++|+|+|+|++++|+||||.|++++|.++|
T Consensus        81 Dliv~~g~~~il~~~~l~~~~~~~iN~HpslLP~~rG~~p~~~~i~~g~~~~G~t~h~~~~~~D~G~Ii~q~~~~i~~~d  160 (209)
T d1jkxa_          81 DVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGD  160 (209)
T ss_dssp             SEEEESSCCSCCCHHHHHHTTTSEEEEESSCTTSCCSSCHHHHHHHTTCSEEEEEEEECCSSTTCSCEEEEEEEECCTTC
T ss_pred             CEEEEEEEEEECCHHHHCCCCCCEEEECCCHHCCCCCCCCHHHHHHCCCEEECCEEEEECCCCCCCCEEEEEEECCCCCC
T ss_conf             88998305686170553023367797077311036776754679987981103338984577886337567897379997


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCEEEEEC
Q ss_conf             9999999999999999999999998695699898699950
Q gi|254780570|r  164 TESSLSQKVLSAEHLLYPLALKYTILGKTSNSNDHHHLIG  203 (205)
Q Consensus       164 ~~~~l~~rv~~~E~~l~~~~i~~~~~g~i~~~~~~~~~~~  203 (205)
                      |+++|++|++.+|+++|+++|+++++|++.+.++++.+.|
T Consensus       161 ~~~~l~~k~~~~e~~l~~~~i~~i~~~~i~~~~~~~~~~~  200 (209)
T d1jkxa_         161 SEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDG  200 (209)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEETTEEEETT
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCCEEECCCEEEECC
T ss_conf             9999999999999999999999998099688599889999



>d1meoa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zgha2 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransferase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 205 phosphoribosylglycinamide formyltransferase [Candi
1meo_A_209 (A:) Phosophoribosylglycinamide formyltransferase; 5e-40
1jkx_A_212 (A:) GART;, phosphoribosylglycinamide formyltransf 8e-40
3da8_A_215 (A:) Probable 5'-phosphoribosylglycinamide formylt 2e-39
2ywr_A_216 (A:) Phosphoribosylglycinamide formyltransferase; 8e-39
3lou_A_94-292199 (A:94-292) Formyltetrahydrofolate deformylase; str 1e-36
3kcq_A_215 (A:) Phosphoribosylglycinamide formyltransferase; 2e-36
2bw0_A_1-232232 (A:1-232) 10-FTHFDH, 10-formyltetrahydrofolate deh 3e-36
2bln_A_1-207207 (A:1-207) Protein YFBG; transferase, formyltransfe 6e-35
1z7e_A_1-207207 (A:1-207) Protein aRNA; rossmann fold, OB-like fol 6e-35
1fmt_A_1-204204 (A:1-204) Methionyl-tRNA FMet formyltransferase; i 1e-33
1zgh_A_1-201201 (A:1-201) Methionyl-tRNA formyltransferase; southe 2e-30
>1meo_A (A:) Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens}Length = 209 Back     alignment and structure
 Score =  158 bits (401), Expect = 5e-40
 Identities = 80/186 (43%), Positives = 120/186 (64%)

Query: 6   IVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYKDYI 65
           + + ISG G+N+ +LI +T++ +  A+I  V S+ +   GL KA +  +PT  I +K Y 
Sbjct: 3   VAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYK 62

Query: 66  SRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTHR 125
           +R E + AI + L     D++CLAG+MR+LS  FV+ +  K+LNIHPSLLP F G + H 
Sbjct: 63  NRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHE 122

Query: 126 RVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESSLSQKVLSAEHLLYPLALK 185
           + L++G+ +TGCTVH V  ++D G II Q AVPV   DT ++LS++V  AEH ++P AL+
Sbjct: 123 QALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQ 182

Query: 186 YTILGK 191
               G 
Sbjct: 183 LVASGT 188


>1jkx_A (A:) GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli}Length = 212 Back     alignment and structure
>3da8_A (A:) Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A*Length = 215 Back     alignment and structure
>2ywr_A (A:) Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus}Length = 216 Back     alignment and structure
>3lou_A (A:94-292) Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia mallei}Length = 199 Back     alignment and structure
>3kcq_A (A:) Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural genomics center for infectious disease; 2.20A {Anaplasma phagocytophilum HZ}Length = 215 Back     alignment and structure
>2bw0_A (A:1-232) 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens}Length = 232 Back     alignment and structure
>2bln_A (A:1-207) Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli}Length = 207 Back     alignment and structure
>1z7e_A (A:1-207) Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli}Length = 207 Back     alignment and structure
>1fmt_A (A:1-204) Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli}Length = 204 Back     alignment and structure
>1zgh_A (A:1-201) Methionyl-tRNA formyltransferase; southeast collaboratory for structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum atcc 27405}Length = 201 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target205 phosphoribosylglycinamide formyltransferase [Candidatus
3lou_A_94-292199 Formyltetrahydrofolate deformylase; structural gen 100.0
1jkx_A_212 GART;, phosphoribosylglycinamide formyltransferase 100.0
2ywr_A_216 Phosphoribosylglycinamide formyltransferase; rossm 100.0
3kcq_A_215 Phosphoribosylglycinamide formyltransferase; struc 100.0
1meo_A_209 Phosophoribosylglycinamide formyltransferase; puri 100.0
3da8_A_215 Probable 5'-phosphoribosylglycinamide formyltransf 100.0
1fmt_A_1-204204 Methionyl-tRNA FMet formyltransferase; initiator t 100.0
2bw0_A_1-232232 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase 100.0
1z7e_A_1-207207 Protein aRNA; rossmann fold, OB-like fold, hydrola 100.0
2bln_A_1-207207 Protein YFBG; transferase, formyltransferase, L-AR 100.0
1zgh_A_1-201201 Methionyl-tRNA formyltransferase; southeast collab 99.98
1f0k_A_1-171_340-364196 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 94.87
3dzc_A_1-196_382-396211 UDP-N-acetylglucosamine 2-epimerase; structural ge 91.64
3e9m_A_1-127_277-330181 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 94.06
3evn_A_1-128_277-329181 Oxidoreductase, GFO/IDH/MOCA family; structural ge 92.27
3db2_A_1-127_299-354183 Putative NADPH-dependent oxidoreductase; ZP_013706 92.09
2o4u_X_1-127_278-334184 Dimeric dihydrodiol dehydrogenase; NADP-binding ro 92.02
2pn1_A_1-104104 Carbamoylphosphate synthase large subunit; ZP_0053 91.78
3ezy_A_1-125_255-302173 Dehydrogenase; structural genomics, unknown functi 90.1
1q0q_A_1-133133 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 91.01
>3lou_A (A:94-292) Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
Probab=100.00  E-value=2.5e-41  Score=305.24  Aligned_cols=198  Identities=25%  Similarity=0.351  Sum_probs=183.1

Q ss_pred             CCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHCCCC
Q ss_conf             86659999769850189999999739998479999976888878889986089504630132332210124321000123
Q gi|254780570|r    2 IRKNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIPYKDYISRREHEKAILMQLSSI   81 (205)
Q Consensus         2 ~k~riavl~SG~Gsnl~~Il~~~~~~~~~~eI~~Visn~~da~~l~~a~~~~Ip~~~i~~~~~~~~~~~~~~l~~~l~~~   81 (205)
                      .|+|||||+||.|+||++|+++.+.+..+++|++|+|++++...  ++...++|....... ...+..++.++.+.++++
T Consensus         1 ~~~ki~~~gs~~~~~l~~ll~~~~~~~~~~~i~~vvt~~~~~~~--~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~l~~~   77 (199)
T 3lou_A            1 ARPKVLIXVSKLEHCLADLLFRWKXGELKXDIVGIVSNHPDFAP--LAAQHGLPFRHFPIT-ADTKAQQEAQWLDVFETS   77 (199)
T ss_dssp             SCCEEEEEECSCCHHHHHHHHHHHHTSSCCEEEEEEESSSTTHH--HHHHTTCCEEECCCC-SSCHHHHHHHHHHHHHHH
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHCCCCCEEEEEEECCCCCHHH--HHHHHCCCEEEEECC-CCCHHHHHHHHHHHHHHC
T ss_conf             78459999769983699999998779987489999548957599--998626998999568-885678999999999754


Q ss_pred             CCEEEEEEEEEEECCCHHHHCCCCCEEECCCCCCCCCCCCCCCCCHHCCCCCCCCCCEEEECCCCCCCCEEEEEEEECCC
Q ss_conf             43036431122205721321066542313532233324442121000024653445303312321866267789987189
Q gi|254780570|r   82 QPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSS  161 (205)
Q Consensus        82 ~~Dliv~~g~~~il~~~~l~~~~~~~iN~HpslLP~yrG~~~~~~ai~~g~~~~G~TiH~v~~~~D~G~Ii~q~~~~i~~  161 (205)
                      +||++|++||++++|+++++.++.++||+|||+||.|||.+|++||+.||++++|+|+|+|++++|+|+|+.|+.+||.+
T Consensus        78 ~~D~iv~~~~~~ilp~~il~~~~~~~iN~HpslLP~yRG~~p~~wai~~g~~~~GvTih~i~~~~D~G~Ii~q~~~~i~~  157 (199)
T 3lou_A           78 GAELVILARYXQVLSPEASARLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH  157 (199)
T ss_dssp             TCSEEEESSCCSCCCHHHHHHTTTSEEEEEEECSSCCCSSCHHHHHHHHTCSEEEEEEEECCSSTTCSCEEEEEEEECCT
T ss_pred             CCCEEEEECCCCCCCHHHHHHHCCCCEEECCCCCCCCCCCHHHHHHHHCCCCEEEEEEEEECCCCCCCCEEEEEEEECCC
T ss_conf             98199980126707899997314781896555376788930999999839987778899996888788806899986599


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCEEEEE
Q ss_conf             98999999999999999999999999869569989869995
Q gi|254780570|r  162 QDTESSLSQKVLSAEHLLYPLALKYTILGKTSNSNDHHHLI  202 (205)
Q Consensus       162 ~d~~~~l~~rv~~~E~~l~~~~i~~~~~g~i~~~~~~~~~~  202 (205)
                      +||+++|+.|+..++.++++++++.+++|++....+++.+.
T Consensus       158 ~dt~~~l~~~~~~~~~~l~~~~i~~l~~g~~~~~pQ~~~~~  198 (199)
T 3lou_A          158 SYRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF  198 (199)
T ss_dssp             TCCHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEETTEEEEC
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCEEEEE
T ss_conf             99999999999999999999999999809989849988996



>1jkx_A (A:) GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} Back     alignment and structure
>2ywr_A (A:) Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Back     alignment and structure
>3kcq_A (A:) Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural genomics center for infectious disease; 2.20A {Anaplasma phagocytophilum HZ} Back     alignment and structure
>1meo_A (A:) Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} Back     alignment and structure
>3da8_A (A:) Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>1fmt_A (A:1-204) Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} Back     alignment and structure
>2bw0_A (A:1-232) 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} Back     alignment and structure
>1z7e_A (A:1-207) Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} Back     alignment and structure
>2bln_A (A:1-207) Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} Back     alignment and structure
>1zgh_A (A:1-201) Methionyl-tRNA formyltransferase; southeast collaboratory for structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1f0k_A (A:1-171,A:340-364) MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} Back     alignment and structure
>3dzc_A (A:1-196,A:382-396) UDP-N-acetylglucosamine 2-epimerase; structural genomics, infectious diseases, isomerase; 2.35A {Vibrio cholerae} Back     alignment and structure
>3e9m_A (A:1-127,A:277-330) Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3evn_A (A:1-128,A:277-329) Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3db2_A (A:1-127,A:299-354) Putative NADPH-dependent oxidoreductase; ZP_01370612.1, structural genomics, joint center for structural genomics, JCSG; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>2o4u_X (X:1-127,X:278-334) Dimeric dihydrodiol dehydrogenase; NADP-binding rossmann-fold domain, predominantly anti- parallel beta sheet, oxidoreductase; 2.00A {Macaca fascicularis} PDB: 2o48_X 2poq_X* Back     alignment and structure
>2pn1_A (A:1-104) Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, structural genomics; 2.00A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3ezy_A (A:1-125,A:255-302) Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>1q0q_A (A:1-133) 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} Back     alignment and structure