254780573

254780573

cysteinyl-tRNA synthetase

GeneID in NCBI database:8209570Locus tag:CLIBASIA_02300
Protein GI in NCBI database:254780573Protein Accession:YP_003064986.1
Gene range:-(709420, 710805)Protein Length:461aa
Gene description:cysteinyl-tRNA synthetase
COG prediction:[J] Cysteinyl-tRNA synthetase
KEGG prediction:cysS; cysteinyl-tRNA synthetase (EC:6.1.1.16); K01883 cysteinyl-tRNA synthetase [EC:6.1.1.16]
SEED prediction:Cysteinyl-tRNA synthetase (EC 6.1.1.16)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Cys
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-
MKKKIKIYNTLERKITEFQAIDPSNIRMYVCGPTVYDFAHIGNARPMIVFDVLYRLLRYYYGEKCVTYVRNITDIDDKIIERARQEHPSIPINDAISIITSKNTQQFVKDTTRLACLAPTHQPRATNHIPQMIYLIQNIILHGHAYEANNEIIFDTSSIPNYGSFSRRKIDEQKMGTRVPEKYHKKNPADFILWKRSTPMEPGWESPWGRGRPGWHIECSAMSSHYLGKVFDIHGGGLDLIFPHHENEIAQSCCADRIEKTANIWIHNGFLNLEGRKMSKSNGNFITINELLETKKFGGRSWPAPVIRLAMLMTHYREPIDFTVQRLTEAEILLSKWPQTSTSKGIIDPAVLSALYNDLNTVSAIQALHKLARESTKNHDLLPIFNASAHILGIEVCKEHLNKNISIAIEKLVQERLILLKMKKFSSADYIRKQLESKGFILEDYKNPDNGQRMTRWKQKP
cccEEEEEEcccccEEEEEccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccEEEEcccEEEEEcccHHHHHHHcccHHHHHcccccccccccccccHHHccccccccccccccccccccccHHHHHHHHHHHHccccccEEcccccccccccHHHHHHHHHcccccccccEEEEccEEEEccEEEccccccEEcHHHHHHHcccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccEEEEcccccccccccEEEEcc
ccHHHHHHHccccccccccccccccEEEEEcccEEEEEEEcccccHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccccccccHccHHHHHHHHHHHHHcccEEEEcccEEEEEcccccccccccccHHHHHcccEEEccccccccHHHHHHHccccccccccccccccccccEEEEHHHHHHHccccccEcccccccccccccHHHHHHHHccccccccEEEEcccEEEEccccccccccccEEHHHHHHHcccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccEEEccccccccccccEEEEcc
MKKKIKIYNTLERKItefqaidpsnirmyvcgptvydfahignarpMIVFDVLYRLLRYYYGEKCVTYVRNITDIDDKIIERArqehpsipindAISIITSKNTQQFVKDTtrlaclapthqpratnhiPQMIYLIQNIILHghayeanneiifdtssipnygsfsrrkideqkmgtrvpekyhkknpadfilwkrstpmepgwespwgrgrpgwhiecSAMSSHYLGKVfdihgggldlifphheneiaQSCCADRIEKTANIWIHNgflnlegrkmsksngnFITINELLetkkfggrswpaPVIRLAMLMTHYREPIDFTVQRLTEAEILlskwpqtstskgiidpAVLSALYNDLNTVSAIQALHKLARestknhdllpifnasAHILGIEVCKEHLNKNISIAIEKLVQERLILLKMKKFSSADYIRKQLESKGfiledyknpdngqrmtrwkqkp
mkkkikiyNTLErkitefqaidpsnirMYVCGPTVYDFAHIGNARPMIVFDVLYRLLRYYYGEKCVTYVRNITDIDDKIIERArqehpsipinDAISIITSKNTQQFVKDTTRLACLAPthqpratnhIPQMIYLIQNIILHGHAYEANNEIIFDTSSIPNYGSFsrrkideqkmgtrvpekyhkknpadfilwKRSTPMEPGWESPWGRGRPGWHIECSAMSSHYLGKVFDIHGGGLDLIFPHHENEIAQSCCADRIEKTANIWIHNGFLNLEGRKMSKSNGNFITINELletkkfggrswPAPVIRLAMLMTHYREPIDFTVQRLTEAEILlskwpqtstskGIIDPAVLSALYNDLNTVSAIQALHKLARESTKNHDLLPIFNASAHILGIEVCKEHLNKNISIAIEKLVQERLILLKMKKFSSADYIRKQLEskgfiledyknpdngqrmtrwkqkp
MKKKIKIYNTLERKITEFQAIDPSNIRMYVCGPTVYDFAHIGNARPMIVFDVLYRLLRYYYGEKCVTYVRNITDIDDKIIERARQEHPSIPINDAISIITSKNTQQFVKDTTRLACLAPTHQPRATNHIPQMIYLIQNIILHGHAYEANNEIIFDTSSIPNYGSFSRRKIDEQKMGTRVPEKYHKKNPADFILWKRSTPMEPGWESPWGRGRPGWHIECSAMSSHYLGKVFDIHGGGLDLIFPHHENEIAQSCCADRIEKTANIWIHNGFLNLEGRKMSKSNGNFITINELLETKKFGGRSWPAPVIRLAMLMTHYREPIDFTVQRLTEAEILLSKWPQTSTSKGIIDPAVLSALYNDLNTVSAIQALHKLARESTKNHDLLPIFNASAHILGIEVCKEHLNKNISIAIEKLVQERLILLKMKKFSSADYIRKQLESKGFILEDYKNPDNGQRMTRWKQKP
***KIKIYNTLERKITEFQAIDPSNIRMYVCGPTVYDFAHIGNARPMIVFDVLYRLLRYYYGEKCVTYVRNITDIDDKIIERARQEHPSIPINDAISIITSKNTQQFVKDTTRLACLAPTHQPRATNHIPQMIYLIQNIILHGHAYEANNEIIFDTSSIPNYGSFSRRKIDEQKMGTRVPEKYHKKNPADFILWKRSTPMEPGWESPWGRGRPGWHIECSAMSSHYLGKVFDIHGGGLDLIFPHHENEIAQSCCADRIEKTANIWIHNGFLNLEGRKMSKSNGNFITINELLETKKFGGRSWPAPVIRLAMLMTHYREPIDFTVQRLTEAEILLSKWPQTSTSKGIIDPAVLSALYNDLNTVSAIQALHKLARESTKNHDLLPIFNASAHILGIEVCKEHLNKNISIAIEKLVQERLILLKMKKFSSADYIRKQLESKGFILEDYKNPDNGQRMTRWK***
MKKKIKIYNTLERKITEFQAIDPSNIRMYVCGPTVYDFAHIGNARPMIVFDVLYRLLRYYYGEKCVTYVRNITDIDDKIIERARQEHPSIPINDAISIITSKNTQQFVKDTTRLACLAPTHQPRATNHIPQMIYLIQNIILHGHAYEANNEIIFDTSSIPNYGSFSRRKIDEQKMGTRVPEKYHKKNPADFILWKRSTPMEPGWESPWGRGRPGWHIECSAMSSHYLGKVFDIHGGGLDLIFPHHENEIAQSCCADRIEKTANIWIHNGFLNLEGRKMSKSNGNFITINELLETKKFGGRSWPAPVIRLAMLMTHYREPIDFTVQRLTEAEILLSKWPQTSTSKGIIDPAVLSALYNDLNTVSAIQALHKLARESTKNHDLLPIFNASAHILGIEVCKEHLNKNISIAIEKLVQERLILLKMKKFSSADYIRKQLESKGFILEDYKNPDN***********
*KKKIKIYNTLERKITEFQAIDPSNIRMYVCGPTVYDFAHIGNARPMIVFDVLYRLLRYYYGEKCVTYVRNITDIDDKIIERARQEHPSIPINDAISIITSKNTQQFVKDTTRLACLAPTHQPRATNHIPQMIYLIQNIILHGHAYEANNEIIFDTSSIPNYGSFSRRKIDEQKMGTRVPEKYHKKNPADFILWKRSTPMEPGWESPWGRGRPGWHIECSAMSSHYLGKVFDIHGGGLDLIFPHHENEIAQSCCADRIEKTANIWIHNGFLNLEGRKMSKSNGNFITINELLETKKFGGRSWPAPVIRLAMLMTHYREPIDFTVQRLTEAEILLSKWPQTSTSKGIIDPAVLSALYNDLNTVSAIQALHKLARESTKNHDLLPIFNASAHILGIEVCKEHLNKNISIAIEKLVQERLILLKMKKFSSADYIRKQLESKGFILEDYKNPDNGQRMTRW****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKKIKIYNTLERKITEFQAIDPSNIRMYVCGPTVYDFAHIGNARPMIVFDVLYRLLRYYYGEKCVTYVRNITDIDDKIIERARQEHPSIPINDAISIITSKNTQQFVKDTTRLACLAPTHQPRATNHIPQMIYLIQNIILHGHAYEANNEIIFDTSSIPNYGSFSRRKIDEQKMGTRVPEKYHKKNPADFILWKRSTPMEPGWESPWGRGRPGWHIECSAMSSHYLGKVFDIHGGGLDLIFPHHENEIAQSCCADRIEKTANIWIHNGFLNLEGRKMSKSNGNFITINELLETKKFGGRSWPAPVIRLAMLMTHYREPIDFTVQRLTEAEILLSKWPQTSTSKGIIDPAVLSALYNDLNTVSAIQALHKLARESTKNHDLLPIFNASAHILGIEVCKEHLNKNISIAIEKLVQERLILLKMKKFSSADYIRKQLESKGFILEDYKNPDNGQRMTRWKQKP
MKKKIKIYNTLERKITEFQAIDPSNIRMYVCGPTVYDFAHIGNARPMIVFDVLYRLLRYYYGEKCVTYVRNITDIDDKIIERARQEHPSIPINDAISIITSKNTQQFVKDTTRLACLAPTHQPRATNHIPQMIYLIQNIILHGHAYEANNEIIFDTSSIPNYGSFSRRKIDEQKMGTRVPEKYHKKNPADFILWKRSTPMEPGWESPWGRGRPGWHIECSAMSSHYLGKVFDIHGGGLDLIFPHHENEIAQSCCADRIEKTANIWIHNGFLNLEGRKMSKSNGNFITINELLETKKFGGRSWPAPVIRLAMLMTHYREPIDFTVQRLTEAEILLSKWPQTSTSKGIIDPAVLSALYNDLNTVSAIQALHKLARESTKNHDLLPIFNASAHILGIEVCKEHLNKNISIAIEKLVQERLILLKMKKFSSADYIRKQLESKGFILEDYKNPDNGQRMTRWKQKP
MKKKIKIYNTLERKITEFQAIDPSNIRMYVCGPTVYDFAHIGNARPMIVFDVLYRLLRYYYGEKCVTYVRNITDIDDKIIERARQEHPSIPINDAISIITSKNTQQFVKDTTRLACLAPTHQPRATNHIPQMIYLIQNIILHGHAYEANNEIIFDTSSIPNYGSFSRRKIDEQKMGTRVPEKYHKKNPADFILWKRSTPMEPGWESPWGRGRPGWHIECSAMSSHYLGKVFDIHGGGLDLIFPHHENEIAQSCCADRIEKTANIWIHNGFLNLEGRKMSKSNGNFITINELLETKKFGGRSWPAPVIRLAMLMTHYREPIDFTVQRLTEAEILLSKWPQTSTSKGIIDPAVLSALYNDLNTVSAIQALHKLARESTKNHDLLPIFNASAHILGIEVCKEHLNKNISIAIEKLVQERLILLKMKKFSSADYIRKQLESKGFILEDYKNPDNGQRMTRWKQKP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target461 cysteinyl-tRNA synthetase [Candidatus Liberibacter asia
315121767461 cysteinyl-tRNA synthetase [Candidatus Liberibacter sola 1 0.0
150395937466 cysteinyl-tRNA synthetase [Sinorhizobium medicae WSM419 1 1e-169
15964864466 cysteinyl-tRNA synthetase [Sinorhizobium meliloti 1021] 1 1e-168
307300935466 cysteinyl-tRNA synthetase [Sinorhizobium meliloti BL225 1 1e-168
307946682477 cysteinyl-tRNA synthetase [Roseibium sp. TrichSKD4] Len 1 1e-166
15888416461 cysteinyl-tRNA synthetase [Agrobacterium tumefaciens st 1 1e-165
325292453461 Cysteinyl-tRNA synthetase [Agrobacterium sp. H13-3] Len 1 1e-164
86357063458 cysteinyl-tRNA synthetase [Rhizobium etli CFN 42] Lengt 1 1e-163
254504528475 cysteinyl-tRNA synthetase [Labrenzia alexandrii DFL-11] 1 1e-162
116251309463 cysteinyl-tRNA synthetase [Rhizobium leguminosarum bv. 1 1e-162
>gi|315121767|ref|YP_004062256.1| cysteinyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 461 Back     alignment and organism information
 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/460 (81%), Positives = 418/460 (90%)

Query: 1   MKKKIKIYNTLERKITEFQAIDPSNIRMYVCGPTVYDFAHIGNARPMIVFDVLYRLLRYY 60
           M+K IK+YNTL+R+  EFQAIDPSN+RMYVCGPTVYDFAHIGNARPMIVFDVLYRLLR++
Sbjct: 1   MQKNIKLYNTLKRETIEFQAIDPSNVRMYVCGPTVYDFAHIGNARPMIVFDVLYRLLRHH 60

Query: 61  YGEKCVTYVRNITDIDDKIIERARQEHPSIPINDAISIITSKNTQQFVKDTTRLACLAPT 120
           YGE+CVTYVRNITDIDDKIIERAR++HPSI I++AI +IT KN +QF+ DTT+L CL PT
Sbjct: 61  YGEQCVTYVRNITDIDDKIIERARRDHPSIAIDNAICMITEKNIKQFILDTTKLGCLIPT 120

Query: 121 HQPRATNHIPQMIYLIQNIILHGHAYEANNEIIFDTSSIPNYGSFSRRKIDEQKMGTRVP 180
           HQPRAT +IPQMI LI+ II HGHAYE+NNEI+FDT+S PNYGS S+RKIDEQK G RVP
Sbjct: 121 HQPRATEYIPQMINLIEKIISHGHAYESNNEILFDTNSAPNYGSLSQRKIDEQKTGARVP 180

Query: 181 EKYHKKNPADFILWKRSTPMEPGWESPWGRGRPGWHIECSAMSSHYLGKVFDIHGGGLDL 240
           EKYHKKNPADF+LWK S+  EPGWESPWG GRPGWHIECSAMSS++LGK+FDIHGGGLDL
Sbjct: 181 EKYHKKNPADFVLWKTSSEEEPGWESPWGIGRPGWHIECSAMSSYHLGKLFDIHGGGLDL 240

Query: 241 IFPHHENEIAQSCCADRIEKTANIWIHNGFLNLEGRKMSKSNGNFITINELLETKKFGGR 300
           IFPHHENEIAQSCCA R +K AN+WIHNGFLNLEG KMSKSNGNFITINELLETKKFGG+
Sbjct: 241 IFPHHENEIAQSCCAYRTDKIANVWIHNGFLNLEGHKMSKSNGNFITINELLETKKFGGQ 300

Query: 301 SWPAPVIRLAMLMTHYREPIDFTVQRLTEAEILLSKWPQTSTSKGIIDPAVLSALYNDLN 360
           +WPAPVIRLAMLMT YREPIDFTVQRL EAEILLSKWP T+ S+G  DPAVLSAL+NDLN
Sbjct: 301 AWPAPVIRLAMLMTSYREPIDFTVQRLQEAEILLSKWPPTTESRGKPDPAVLSALFNDLN 360

Query: 361 TVSAIQALHKLARESTKNHDLLPIFNASAHILGIEVCKEHLNKNISIAIEKLVQERLILL 420
           TVSAIQALHKLARES KN DLLP FNASA+ILGIEV +E L+KN+SIAIEKLVQERL+LL
Sbjct: 361 TVSAIQALHKLARESIKNPDLLPTFNASANILGIEVREEPLSKNLSIAIEKLVQERLLLL 420

Query: 421 KMKKFSSADYIRKQLESKGFILEDYKNPDNGQRMTRWKQK 460
           K+K FS+AD IR+QLE KGF+LEDYK+P + QRMTRWKQK
Sbjct: 421 KIKNFSAADSIREQLECKGFVLEDYKDPKSKQRMTRWKQK 460


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150395937|ref|YP_001326404.1| cysteinyl-tRNA synthetase [Sinorhizobium medicae WSM419] Length = 466 Back     alignment and organism information
>gi|15964864|ref|NP_385217.1| cysteinyl-tRNA synthetase [Sinorhizobium meliloti 1021] Length = 466 Back     alignment and organism information
>gi|307300935|ref|ZP_07580704.1| cysteinyl-tRNA synthetase [Sinorhizobium meliloti BL225C] Length = 466 Back     alignment and organism information
>gi|307946682|ref|ZP_07662017.1| cysteinyl-tRNA synthetase [Roseibium sp. TrichSKD4] Length = 477 Back     alignment and organism information
>gi|15888416|ref|NP_354097.1| cysteinyl-tRNA synthetase [Agrobacterium tumefaciens str. C58] Length = 461 Back     alignment and organism information
>gi|325292453|ref|YP_004278317.1| Cysteinyl-tRNA synthetase [Agrobacterium sp. H13-3] Length = 461 Back     alignment and organism information
>gi|86357063|ref|YP_468955.1| cysteinyl-tRNA synthetase [Rhizobium etli CFN 42] Length = 458 Back     alignment and organism information
>gi|254504528|ref|ZP_05116679.1| cysteinyl-tRNA synthetase [Labrenzia alexandrii DFL-11] Length = 475 Back     alignment and organism information
>gi|116251309|ref|YP_767147.1| cysteinyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 463 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target461 cysteinyl-tRNA synthetase [Candidatus Liberibacter asia
PRK00260463 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated 1e-171
TIGR00435465 TIGR00435, cysS, cysteinyl-tRNA synthetase 1e-121
KOG2007586 KOG2007, KOG2007, KOG2007, Cysteinyl-tRNA synthetase [T 1e-104
PLN02946557 PLN02946, PLN02946, cysteine-tRNA ligase 1e-100
PRK14535699 PRK14535, cysS, cysteinyl-tRNA synthetase; Provisional 3e-88
PRK14536490 PRK14536, cysS, cysteinyl-tRNA synthetase; Provisional 5e-83
PRK14534481 PRK14534, cysS, cysteinyl-tRNA synthetase; Provisional 2e-57
COG0215464 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, 1e-149
pfam01406301 pfam01406, tRNA-synt_1e, tRNA synthetases class I (C) c 1e-103
PTZ00399 651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisio 3e-90
PRK12418384 PRK12418, PRK12418, cysteinyl-tRNA synthetase; Provisio 4e-69
TIGR03447411 TIGR03447, mycothiol_MshC, cysteine--1-D-myo-inosityl 2 6e-69
cd00672213 cd00672, CysRS_core, catalytic core domain of cysteinyl 5e-44
cd00672213 cd00672, CysRS_core, catalytic core domain of cysteinyl 3e-37
cd07963156 cd07963, Anticodon_Ia_Cys, Anticodon-binding domain of 1e-08
cd00802143 cd00802, class_I_aaRS_core, catalytic core domain of cl 4e-07
cd00802143 cd00802, class_I_aaRS_core, catalytic core domain of cl 7e-06
PRK00133 673 PRK00133, metG, methionyl-tRNA synthetase; Reviewed 9e-06
cd00812314 cd00812, LeuRS_core, catalytic core domain of leucyl-tR 3e-05
pfam09334388 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) 3e-05
PRK12300 897 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed 6e-05
cd00814319 cd00814, MetRS_core, catalytic core domain of methionin 1e-04
PRK11893511 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed 2e-04
TIGR00395 938 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal 3e-04
PRK13208800 PRK13208, valS, valyl-tRNA synthetase; Reviewed 0.002
COG0060 933 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, 1e-05
PRK12268556 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed 8e-05
COG0143558 COG0143, MetG, Methionyl-tRNA synthetase [Translation, 2e-04
PLN02959 1084 PLN02959, PLN02959, aminoacyl-tRNA ligase 0.003
cd00668312 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain 6e-04
>gnl|CDD|178951 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|161877 TIGR00435, cysS, cysteinyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|37218 KOG2007, KOG2007, KOG2007, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178532 PLN02946, PLN02946, cysteine-tRNA ligase Back     alignment and domain information
>gnl|CDD|173001 PRK14535, cysS, cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|184731 PRK14536, cysS, cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|173000 PRK14534, cysS, cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|30564 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|110410 pfam01406, tRNA-synt_1e, tRNA synthetases class I (C) catalytic domain Back     alignment and domain information
>gnl|CDD|185597 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|183518 PRK12418, PRK12418, cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|132488 TIGR03447, mycothiol_MshC, cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase Back     alignment and domain information
>gnl|CDD|173899 cd00672, CysRS_core, catalytic core domain of cysteinyl tRNA synthetase Back     alignment and domain information
>gnl|CDD|173899 cd00672, CysRS_core, catalytic core domain of cysteinyl tRNA synthetase Back     alignment and domain information
>gnl|CDD|153417 cd07963, Anticodon_Ia_Cys, Anticodon-binding domain of cysteinyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|173901 cd00802, class_I_aaRS_core, catalytic core domain of class I amino acyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173901 cd00802, class_I_aaRS_core, catalytic core domain of class I amino acyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|178889 PRK00133, metG, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|117876 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) Back     alignment and domain information
>gnl|CDD|183418 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|183364 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|161856 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>gnl|CDD|183895 PRK13208, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|30409 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183390 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|30492 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178544 PLN02959, PLN02959, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 461 cysteinyl-tRNA synthetase [Candidatus Liberibacter asia
PRK00260460 cysS cysteinyl-tRNA synthetase; Validated 100.0
COG0215464 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal 100.0
TIGR00435660 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308 The 100.0
KOG2007586 consensus 100.0
TIGR03447411 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deo 100.0
PRK12418384 cysteinyl-tRNA synthetase; Provisional 100.0
pfam01406301 tRNA-synt_1e tRNA synthetases class I (C) catalytic dom 100.0
cd00672213 CysRS_core This is the catalytic core domain of cystein 100.0
cd00814319 MetRS_core This is the catalytic core domain of methion 100.0
cd00668334 Ile_Leu_Val_MetRS_core This is the catalytic core domai 100.0
pfam09334388 tRNA-synt_1g tRNA synthetases class I (M). This family 100.0
cd00812376 LeuRS_core This is the catalytic core domain of leucyl 100.0
cd00817363 ValRS_core This is the catalytic core domain of valine 99.95
cd00818339 IleRS_core This is the catalytic core domain of isoleuc 99.93
cd00674354 LysRS_core_class_I This is the catalytic core domain of 99.89
pfam01921355 tRNA-synt_1f tRNA synthetases class I (K). This family 99.82
COG0525 877 ValS Valyl-tRNA synthetase [Translation, ribosomal stru 99.7
PRK12451562 arginyl-tRNA synthetase; Reviewed 99.64
PRK01611570 argS arginyl-tRNA synthetase; Reviewed 99.64
pfam00750345 tRNA-synt_1d tRNA synthetases class I (R). Other tRNA s 99.56
COG0018577 ArgS Arginyl-tRNA synthetase [Translation, ribosomal st 99.56
COG1384521 LysS Lysyl-tRNA synthetase (class I) [Translation, ribo 99.29
PRK00750513 lysK lysyl-tRNA synthetase; Reviewed 99.29
PRK04156566 gltX glutamyl-tRNA synthetase; Provisional 99.24
cd00807238 Gln_GluRS_non_core Glutaminyl-tRNA synthetase (GlnRS) a 99.21
cd00418223 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-t 99.2
TIGR00422 970 valS valyl-tRNA synthetase; InterPro: IPR002303 The ami 99.16
KOG0432 995 consensus 99.16
PRK12558461 glutamyl-tRNA synthetase; Provisional 99.08
PRK01406467 gltX glutamyl-tRNA synthetase; Reviewed 99.07
COG0008472 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Transla 99.04
pfam00749314 tRNA-synt_1c tRNA synthetases class I (E and Q), cataly 99.04
PRK05710299 glutamyl-Q tRNA(Asp) synthetase; Reviewed 99.02
PRK12410433 glutamyl-tRNA synthetase; Provisional 98.93
cd00808239 GluRS_core Descriminating Glutamyl-tRNA synthetase (Glu 98.87
PRK00574489 gltX glutamyl-tRNA synthetase; Reviewed 98.87
PRK05347556 glutaminyl-tRNA synthetase; Provisional 98.74
TIGR00463600 gltX_arch glutamyl-tRNA synthetase; InterPro: IPR004526 98.71
TIGR00456600 argS arginyl-tRNA synthetase; InterPro: IPR001278 The a 98.6
TIGR00464513 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527 98.1
cd00395274 Tyr_Trp_RS_core Tyrosinyl-tRNA synthetase (TyrRS)/Trypt 97.97
KOG1147712 consensus 97.79
TIGR00467539 lysS_arch lysyl-tRNA synthetase; InterPro: IPR002904 Th 97.78
PRK08560333 tyrosyl-tRNA synthetase; Validated 97.52
KOG1149524 consensus 96.72
cd00806282 TrpRS_core Tryptophanyl-tRNA synthetase (TrpRS) catalyt 96.5
PRK12282333 tryptophanyl-tRNA synthetase II; Reviewed 94.95
PRK12556328 tryptophanyl-tRNA synthetase; Provisional 91.94
PRK11893512 methionyl-tRNA synthetase; Reviewed 100.0
PRK12267 644 methionyl-tRNA synthetase; Reviewed 100.0
PRK00133 666 metG methionyl-tRNA synthetase; Reviewed 100.0
PRK12268558 methionyl-tRNA synthetase; Reviewed 99.97
COG0143558 MetG Methionyl-tRNA synthetase [Translation, ribosomal 99.93
TIGR00398573 metG methionyl-tRNA synthetase; InterPro: IPR002304 The 99.89
KOG0436578 consensus 99.78
KOG4426656 consensus 96.63
cd07963156 Anticodon_Ia_Cys Anticodon-binding domain of cysteinyl 99.94
PRK13208809 valS valyl-tRNA synthetase; Reviewed 99.91
PRK05729 877 valS valyl-tRNA synthetase; Reviewed 99.84
PRK13804 966 ileS isoleucyl-tRNA synthetase; Provisional 99.83
PRK12300 888 leuS leucyl-tRNA synthetase; Reviewed 99.58
COG0495814 LeuS Leucyl-tRNA synthetase [Translation, ribosomal str 99.41
COG0060 933 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal 99.33
TIGR00392938 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The 99.33
PRK06039 1042 ileS isoleucyl-tRNA synthetase; Reviewed 98.4
PRK00390 822 leuS leucyl-tRNA synthetase; Validated 99.85
PRK05743 910 ileS isoleucyl-tRNA synthetase; Reviewed 99.81
PRK06039 1042 ileS isoleucyl-tRNA synthetase; Reviewed 99.52
TIGR00396 916 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 T 99.07
COG0495 814 LeuS Leucyl-tRNA synthetase [Translation, ribosomal str 98.69
PRK12300 888 leuS leucyl-tRNA synthetase; Reviewed 98.17
KOG0435 876 consensus 98.06
COG0060 933 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal 96.97
KOG1247 567 consensus 96.64
KOG0433 937 consensus 96.41
KOG1148 764 consensus 96.1
TIGR00392 938 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The 96.06
TIGR00440 564 glnS glutaminyl-tRNA synthetase; InterPro: IPR004514 Th 95.98
PRK12285369 tryptophanyl-tRNA synthetase; Reviewed 94.07
PRK12284436 tryptophanyl-tRNA synthetase; Reviewed 93.4
KOG1195567 consensus 91.24
pfam00133606 tRNA-synt_1 tRNA synthetases class I (I, L, M and V). O 99.85
KOG0437 1080 consensus 98.87
KOG0433 937 consensus 98.55
KOG0434 1070 consensus 97.34
cd00805268 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic 96.92
cd00802142 class_I_aaRS_core Class I amino acyl-tRNA synthetase (a 99.44
cd00671267 ArgRS_core This is the catalytic core domain of Arginyl 98.44
PRK13354405 tyrosyl-tRNA synthetase; Provisional 97.44
COG0180314 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosom 96.79
cd02156147 nt_trans nt_trans (nucleotidyl transferase) This superf 96.58
PRK05912402 tyrosyl-tRNA synthetase; Validated 94.95
TIGR00395 1109 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 T 99.41
pfam0919062 DALR_2 DALR domain. This DALR domain is found in cystei 98.35
smart0084056 DALR_2 This DALR domain is found in cysteinyl-tRNA-synt 98.22
TIGR00396916 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 T 98.19
KOG0435876 consensus 98.04
cd0795581 Anticodon_Ia_Cys_like Anticodon-binding domain of cyste 97.56
cd00814319 MetRS_core This is the catalytic core domain of methion 97.41
TIGR00422970 valS valyl-tRNA synthetase; InterPro: IPR002303 The ami 96.85
KOG2007586 consensus 96.72
COG0162401 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal st 95.15
pfam00579291 tRNA-synt_1b tRNA synthetases class I (W and Y). 92.38
PRK12283398 tryptophanyl-tRNA synthetase; Reviewed 93.59
TIGR00395 1109 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 T 90.81
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00435 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2007 consensus Back     alignment and domain information
>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase Back     alignment and domain information
>PRK12418 cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>pfam01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain Back     alignment and domain information
>cd00672 CysRS_core This is the catalytic core domain of cysteinyl tRNA synthetase (CysRS) Back     alignment and domain information
>cd00814 MetRS_core This is the catalytic core domain of methionine tRNA synthetase (MetRS) Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core This is the catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>pfam09334 tRNA-synt_1g tRNA synthetases class I (M) Back     alignment and domain information
>cd00812 LeuRS_core This is the catalytic core domain of leucyl tRNA synthetase (LeuRS) Back     alignment and domain information
>cd00817 ValRS_core This is the catalytic core domain of valine amino-acyl tRNA synthetases (ValRS) Back     alignment and domain information
>cd00818 IleRS_core This is the catalytic core domain of isoleucine amino-acyl tRNA synthetases (IleRS) Back     alignment and domain information
>cd00674 LysRS_core_class_I This is the catalytic core domain of lysyl tRNA synthetase (LysRS) Back     alignment and domain information
>pfam01921 tRNA-synt_1f tRNA synthetases class I (K) Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12451 arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK01611 argS arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>pfam00750 tRNA-synt_1d tRNA synthetases class I (R) Back     alignment and domain information
>COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK04156 gltX glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00807 Gln_GluRS_non_core Glutaminyl-tRNA synthetase (GlnRS) and non-descriminating Glutamyl-tRNA synthetase (GluRS) cataytic core domain Back     alignment and domain information
>cd00418 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-tRNA synthetase (GlnRS) cataytic core domain Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase; InterPro: IPR002303 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0432 consensus Back     alignment and domain information
>PRK12558 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK01406 gltX glutamyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain Back     alignment and domain information
>PRK05710 glutamyl-Q tRNA(Asp) synthetase; Reviewed Back     alignment and domain information
>PRK12410 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00808 GluRS_core Descriminating Glutamyl-tRNA synthetase (GluRS) catalytic core domain Back     alignment and domain information
>PRK00574 gltX glutamyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK05347 glutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00463 gltX_arch glutamyl-tRNA synthetase; InterPro: IPR004526 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00456 argS arginyl-tRNA synthetase; InterPro: IPR001278 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00464 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00395 Tyr_Trp_RS_core Tyrosinyl-tRNA synthetase (TyrRS)/Tryptophanyl-tRNA synthetase (TrpRS) catalytic core domain Back     alignment and domain information
>KOG1147 consensus Back     alignment and domain information
>TIGR00467 lysS_arch lysyl-tRNA synthetase; InterPro: IPR002904 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK08560 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>KOG1149 consensus Back     alignment and domain information
>cd00806 TrpRS_core Tryptophanyl-tRNA synthetase (TrpRS) catalytic core domain Back     alignment and domain information
>PRK12282 tryptophanyl-tRNA synthetase II; Reviewed Back     alignment and domain information
>PRK12556 tryptophanyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00398 metG methionyl-tRNA synthetase; InterPro: IPR002304 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0436 consensus Back     alignment and domain information
>KOG4426 consensus Back     alignment and domain information
>cd07963 Anticodon_Ia_Cys Anticodon-binding domain of cysteinyl tRNA synthetases Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00390 leuS leucyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00396 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG0435 consensus Back     alignment and domain information
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1247 consensus Back     alignment and domain information
>KOG0433 consensus Back     alignment and domain information
>KOG1148 consensus Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00440 glnS glutaminyl-tRNA synthetase; InterPro: IPR004514 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK12285 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12284 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG1195 consensus Back     alignment and domain information
>pfam00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>KOG0437 consensus Back     alignment and domain information
>KOG0433 consensus Back     alignment and domain information
>KOG0434 consensus Back     alignment and domain information
>cd00805 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic core domain Back     alignment and domain information
>cd00802 class_I_aaRS_core Class I amino acyl-tRNA synthetase (aaRS) catalytic core domain Back     alignment and domain information
>cd00671 ArgRS_core This is the catalytic core domain of Arginyl tRNA synthetase (ArgRS) Back     alignment and domain information
>PRK13354 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02156 nt_trans nt_trans (nucleotidyl transferase) This superfamily includes the class I amino-acyl tRNA synthetases, pantothenate synthetase (PanC), ATP sulfurylase, and the cytidylyltransferases, all of which have a conserved dinucleotide-binding domain Back     alignment and domain information
>PRK05912 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>pfam09190 DALR_2 DALR domain Back     alignment and domain information
>smart00840 DALR_2 This DALR domain is found in cysteinyl-tRNA-synthetases Back     alignment and domain information
>TIGR00396 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0435 consensus Back     alignment and domain information
>cd07955 Anticodon_Ia_Cys_like Anticodon-binding domain of cysteinyl tRNA synthetases and domain found in MshC Back     alignment and domain information
>cd00814 MetRS_core This is the catalytic core domain of methionine tRNA synthetase (MetRS) Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase; InterPro: IPR002303 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2007 consensus Back     alignment and domain information
>COG0162 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam00579 tRNA-synt_1b tRNA synthetases class I (W and Y) Back     alignment and domain information
>PRK12283 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target461 cysteinyl-tRNA synthetase [Candidatus Liberibacter asia
1li5_A461 Crystal Structure Of Cysteinyl-Trna Synthetase Leng 1e-102
3c8z_A414 The 1.6 A Crystal Structure Of Mshc: The Rate Limit 5e-57
2csx_A497 Crystal Structure Of Aquifex Aeolicus Methionyl-Trn 1e-04
2x1l_A524 Crystal Structure Of Mycobacterium Smegmatis Methio 6e-04
2zue_A629 Crystal Structure Of Pyrococcus Horikoshii Arginyl- 0.004
gi|20664375|pdb|1LI5|A Chain A, Crystal Structure Of Cysteinyl-Trna Synthetase Length = 461 Back     alignment and structure
 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 175/494 (35%), Positives = 251/494 (50%), Gaps = 70/494 (14%)

Query: 4   KIKIYNTLERKITEFQAIDPSNIRMYVCGPTVYDFAHIGNARPMIVFDVLYRLLRYYYGE 63
            +KI+NTL R+  EF+ I    + MYVCG TVYD  HIG+ R  + FDV+ R LR+    
Sbjct: 1   MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGY- 59

Query: 64  KCVTYVRNITDIDDKIIERARQEHPSIPINDAISIITSKNTQQFVKDTTRLACLAPTHQP 123
             + YVRNITDIDDKII+RA +        ++   +  +   +  KD   L  L P  +P
Sbjct: 60  -KLKYVRNITDIDDKIIKRANENG------ESFVAMVDRMIAEMHKDFDALNILRPDMEP 112

Query: 124 RATNHIPQMIYLIQNIILHGHAYE-ANNEIIFDTSSIPNYGSFSRRKIDEQKMGTRVPEK 182
           RAT+HI ++I L + +I  GHAY   N +++FD  + P YG  SR+ +D+ + G RV   
Sbjct: 113 RATHHIAEIIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGVLSRQDLDQLQAGARVDVV 172

Query: 183 YHKKNPADFILWKRSTPMEPGWESPWGRGRPGWHIECSAMSSHYLGKVFDIHGGGLDLIF 242
             K+NP DF+LWK S   EP W SPWG GRPGWHIECSAM+   LG  FDIHGGG DL+F
Sbjct: 173 DDKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECSAMNCKQLGNHFDIHGGGSDLMF 232

Query: 243 PHHENEIAQSCCADRIEKTANIWIHNGFLNLEGRKMSKSNGNFITINELLETKKFGGRSW 302
           PHHENEIAQS CA   +   N W+H+G + ++  KMSKS GNF T+ ++L       + +
Sbjct: 233 PHHENEIAQSTCAHDGQ-YVNYWMHSGMVMVDREKMSKSLGNFFTVRDVL-------KYY 284

Query: 303 PAPVIRLAMLMTHYREPIDFTVQRLTEAEILLSKWPQTSTSKG---------IIDPAVLS 353
            A  +R  ++  HYR  ++++ + L +A   L +                    +   + 
Sbjct: 285 DAETVRYFLMSGHYRSQLNYSEENLKQARAALERLYTALRGTDKTVAPAGGEAFEARFIE 344

Query: 354 ALYNDLNTVSAIQALHKLAREST--KNHDLLPI------FNASAHILGIEVCKEH----- 400
           A+ +D NT  A   L  +ARE    K  D+             + +LG+   +       
Sbjct: 345 AMDDDFNTPEAYSVLFDMAREVNRLKAEDMAAANAMASHLRKLSAVLGLLEQEPEAFLQS 404

Query: 401 ---LNKNISIAIEKLVQERLILL-----------KMKKFSSADYIRKQLESKGFILEDYK 446
               + +    IE L+Q+RL              +            +L   G +LED  
Sbjct: 405 GAQADDSEVAEIEALIQQRLDARKAKDWAAADAARD-----------RLNEMGIVLED-- 451

Query: 447 NPDNGQRMTRWKQK 460
               G + T W++K
Sbjct: 452 ----GPQGTTWRRK 461


>gi|219109269|pdb|3C8Z|A Chain A, The 1.6 A Crystal Structure Of Mshc: The Rate Limiting Enzyme In The Mycothiol Biosynthetic Pathway Length = 414 Back     alignment and structure
gi|78101749|pdb|2CSX|A Chain A, Crystal Structure Of Aquifex Aeolicus Methionyl-Trna Synthetase Complexed With Trna(Met) Length = 497 Back     alignment and structure
>gi|301598374|pdb|2X1L|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Methionyl-Trna Synthetase In Complex With Methionine And Adenosine Length = 524 Back     alignment and structure
gi|256032304|pdb|2ZUE|A Chain A, Crystal Structure Of Pyrococcus Horikoshii Arginyl-Trna Synthetase Complexed With Trna(Arg) And An Atp Analog (Anp) Length = 629 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target461 cysteinyl-tRNA synthetase [Candidatus Liberibacter asia
1li5_A461 Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cys 1e-119
3c8z_A414 Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fo 1e-101
1irx_A523 Lysyl-tRNA synthetase; beta sandwitch, zinc-binding str 4e-33
2x1l_A524 Methionyl-tRNA synthetase; nucleotide-binding, protein 1e-14
1f7u_A607 Arginyl-tRNA synthetase; RNA-protein complex, aminoacyl 4e-21
2csx_A497 Methionyl-tRNA synthetase; ligase, riken structural gen 6e-15
2d5b_A500 Methionyl-tRNA synthetase; rossmann fold, class 1A AARS 5e-10
3kfl_A564 Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA syn 4e-09
1nzj_A298 Hypothetical protein YADB; Zn cluster, glutamyl T-RNA s 0.004
1wkb_A810 Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editin 3e-09
3h99_A560 Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRN 7e-05
1gax_A 862 Valrs, valyl-tRNA synthetase; protein-RNA complex, ross 9e-06
1ile_A821 Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthe 2e-05
1ffy_A 917 Isoleucyl-tRNA synthetase; protein-RNA complex, metal I 2e-05
>1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B Length = 461 Back     alignment and structure
 Score =  422 bits (1087), Expect = e-119
 Identities = 177/482 (36%), Positives = 254/482 (52%), Gaps = 48/482 (9%)

Query: 5   IKIYNTLERKITEFQAIDPSNIRMYVCGPTVYDFAHIGNARPMIVFDVLYRLLRYYYGEK 64
           +KI+NTL R+  EF+ I    + MYVCG TVYD  HIG+ R  + FDV+ R LR+   + 
Sbjct: 2   LKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGYK- 60

Query: 65  CVTYVRNITDIDDKIIERARQEHPSIPINDAISIITSKNTQQFVKDTTRLACLAPTHQPR 124
            + YVRNITDIDDKII+RA +        ++   +  +   +  KD   L  L P  +PR
Sbjct: 61  -LKYVRNITDIDDKIIKRANEN------GESFVAMVDRMIAEMHKDFDALNILRPDMEPR 113

Query: 125 ATNHIPQMIYLIQNIILHGHAYEANNEIIF-DTSSIPNYGSFSRRKIDEQKMGTRVPEKY 183
           AT+HI ++I L + +I  GHAY A+N  +  D  + P YG  SR+ +D+ + G RV    
Sbjct: 114 ATHHIAEIIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGVLSRQDLDQLQAGARVDVVD 173

Query: 184 HKKNPADFILWKRSTPMEPGWESPWGRGRPGWHIECSAMSSHYLGKVFDIHGGGLDLIFP 243
            K+NP DF+LWK S   EP W SPWG GRPGWHIECSAM+   LG  FDIHGGG DL+FP
Sbjct: 174 DKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECSAMNCKQLGNHFDIHGGGSDLMFP 233

Query: 244 HHENEIAQSCCADRIEKTANIWIHNGFLNLEGRKMSKSNGNFITINELLETKKFGGRSWP 303
           HHENEIAQS CA    +  N W+H+G + ++  KMSKS GNF T+ ++L+        + 
Sbjct: 234 HHENEIAQSTCAHD-GQYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVLKY-------YD 285

Query: 304 APVIRLAMLMTHYREPIDFTVQRLTEAEILLSKW---------PQTSTSKGIIDPAVLSA 354
           A  +R  ++  HYR  ++++ + L +A   L +                    +   + A
Sbjct: 286 AETVRYFLMSGHYRSQLNYSEENLKQARAALERLYTALRGTDKTVAPAGGEAFEARFIEA 345

Query: 355 LYNDLNTVSAIQALHKLARESTKNHD--------LLPIFNASAHILGI--------EVCK 398
           + +D NT  A   L  +ARE  +           +       + +LG+            
Sbjct: 346 MDDDFNTPEAYSVLFDMAREVNRLKAEDMAAANAMASHLRKLSAVLGLLEQEPEAFLQSG 405

Query: 399 EHLNKNISIAIEKLVQERLILLKMKKFSSADYIRKQLESKGFILEDYKNPDNGQRMTRWK 458
              + +    IE L+Q+RL   K K +++AD  R +L   G +LED          T W+
Sbjct: 406 AQADDSEVAEIEALIQQRLDARKAKDWAAADAARDRLNEMGIVLEDGPQ------GTTWR 459

Query: 459 QK 460
           +K
Sbjct: 460 RK 461


>3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} Length = 414 Back     alignment and structure
>1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1 Length = 523 Back     alignment and structure
>2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* Length = 524 Back     alignment and structure
>1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation, ligase, ligase/RNA complex; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A* Length = 607 Back     alignment and structure
>2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* Length = 497 Back     alignment and structure
>2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A Length = 500 Back     alignment and structure
>3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} Length = 564 Back     alignment and structure
>1nzj_A Hypothetical protein YADB; Zn cluster, glutamyl T-RNA synthetase, structural genomics, unknown function; 1.50A {Escherichia coli} SCOP: c.26.1.1 PDB: 2zlz_A* Length = 298 Back     alignment and structure
>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Length = 810 Back     alignment and structure
>3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, metal-binding, nucleotide-binding; HET: CIT; 1.40A {Escherichia coli k-12} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A Length = 560 Back     alignment and structure
>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A Length = 862 Back     alignment and structure
>1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus HB8} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* Length = 821 Back     alignment and structure
>1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A* Length = 917 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target461 cysteinyl-tRNA synthetase [Candidatus Liberibacter asia
1li5_A461 Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cys 100.0
3c8z_A414 Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fo 100.0
2csx_A497 Methionyl-tRNA synthetase; ligase, riken structural gen 100.0
2d5b_A500 Methionyl-tRNA synthetase; rossmann fold, class 1A AARS 100.0
2x1l_A524 Methionyl-tRNA synthetase; nucleotide-binding, protein 100.0
3kfl_A564 Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA syn 100.0
3h99_A560 Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRN 100.0
1rqg_A 722 Methionyl-tRNA synthetase; translation, dimerization, l 99.95
1gax_A 862 Valrs, valyl-tRNA synthetase; protein-RNA complex, ross 99.94
1irx_A523 Lysyl-tRNA synthetase; beta sandwitch, zinc-binding str 100.0
3fnr_A464 Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, s 99.91
1iq0_A592 Arginyl-tRNA synthetase; riken structural genomics/prot 99.73
1nzj_A298 Hypothetical protein YADB; Zn cluster, glutamyl T-RNA s 99.58
2o5r_A481 Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, glutam 99.5
1f7u_A607 Arginyl-tRNA synthetase; RNA-protein complex, aminoacyl 99.49
2cfo_A492 Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA synthe 99.47
3aii_A