254780572

254780572

hypothetical protein CLIBASIA_02295

GeneID in NCBI database:8209569Locus tag:CLIBASIA_02295
Protein GI in NCBI database:254780572Protein Accession:YP_003064985.1
Gene range:+(711143, 711721)Protein Length:192aa
Gene description:hypothetical protein
COG prediction:[U] Flp pilus assembly protein TadG
KEGG prediction:hypothetical protein
SEED prediction:Similar to TadZ/CpaE, associated with Flp pilus assembly
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Widespread colonization island
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MRKKLLQGIRRSILIREGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVARKIRTGEISSKNTHSLTEFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLQEITETVPRKDKSDSSSEIDDRNFSFHPGGPSTYNVLRAYYHWPLFTDLMRQYISSVKHPGKKGDFLLSSIVVFKNEPF
ccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEEHHccccccHHHHHHHHcccccccccEEEEEHHHHHcccc
cccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHccccccHHHHHHHHHHHHcccccccccccccccccEEEEEEEccccccccccccccccccccccccccccEccccccccEEEEEEEEccccccccccccccccccccccccEEEEEEHHHccccc
MRKKLLQGIRRSILIREGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVARKIRtgeissknthSLTEFRRVFCNDLRVlfncseneigrpydlyLDVKQIKSLQEITetvprkdksdssseiddrnfsfhpggpstYNVLRAYYHWPLFTDLMRQYISSvkhpgkkgdFLLSSIVVFKNEPF
MRKKLLQGIRRSILIREGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVARKIRtgeissknthslteFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLqeitetvprkdksdssseiddrnfsfhpggpsTYNVLRAYYHWPLFTDLMRQYISSVKHPGKKGDFLLSSivvfknepf
MRKKLLQGIRRSILIREGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVARKIRTGEISSKNTHSLTEFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLQEITETVPRkdksdssseiddRNFSFHPGGPSTYNVLRAYYHWPLFTDLMRQYISSVKHPGKKGDFLLSSIVVFKNEPF
***************REGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVARKIRTGE**********EFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLQEITETVPRKDKSDSSSEIDDRNFSFHPGGPSTYNVLRAYYHWPLFTDLMRQYISSVKHPGKKGDFLLSSIVVFKNEPF
MRKKLLQGIRRSILIREGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVARKIRTGEISSKNTHSLTEFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLQEI****************DDRNFSFHPGGPSTYNVLRAYYHWPLFTDLMRQYISSVKHPGKKGDFLLSSIVVFKNEPF
**KKLLQGIRRSILIREGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVARKIRTGEISSKNTHSLTEFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLQEITETVPRKDKSDSSSEIDDRNFSFHPGGPSTYNVLRAYYHWPLFTDLMRQYISSVKHPGKKGDFLLSSIVVFKNEPF
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKKLLQGIRRSILIREGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVARKIRTGEISSKNTHSLTEFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLQEITETVPRKDKSDSSSEIDDRNFSFHPGGPSTYNVLRAYYHWPLFTDLMRQYISSVKHPGKKGDFLLSSIVVFKNEPF
MRKKLLQGIRRSILIREGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVARKIRTGEISSKNTHSLTEFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLQEITETVPRKDKSDSSSEIDDRNFSFHPGGPSTYNVLRAYYHWPLFTDLMRQYISSVKHPGKKGDFLLSSIVVFKNEPF
MRKKLLQGIRRSILIREGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVARKIRTGEISSKNTHSLTEFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLQEITETVPRKDKSDSSSEIDDRNFSFHPGGPSTYNVLRAYYHWPLFTDLMRQYISSVKHPGKKGDFLLSSIVVFKNEPF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target192 hypothetical protein CLIBASIA_02295 [Candidatus Liberib
255764496 616 excinuclease ABC subunit C [Candidatus Liberibacte 0.006
>gi|255764496|ref|YP_003065012.2| excinuclease ABC subunit C [Candidatus Liberibacter asiaticus str. psy62] Length = 616 Back     alignment
 Score = 32.3 bits (72), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 49/99 (49%), Gaps = 12/99 (12%)

Query: 29  MPYFMLVFAILEISLSFTAGQ-LFESAAYDVARKIRTGEISSKNTHSLTEFRRVFCNDLR 87
           MP    V+ +L+I     AG+ L+   AY++ ++I++   S+ +TH +T       N++R
Sbjct: 6   MPECPGVYQMLDI-----AGRVLYVGKAYNLQKRIKSYMHSNNHTHRITHMISQI-NNIR 59

Query: 88  VLFNCSENEIGRPYDLYLDVKQIKSLQEITETVPRKDKS 126
               C+E E      L L+   IK L+     + R DKS
Sbjct: 60  FTVTCTEVEA-----LLLEANMIKRLKPRFNILLRDDKS 93

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target192 hypothetical protein CLIBASIA_02295 [Candidatus Liberib
315121766192 hypothetical protein CKC_00080 [Candidatus Liberibacter 1 8e-72
227823966201 Flp pilus assembly protein TadG [Sinorhizobium fredii N 1 8e-38
222084463237 hypothetical protein Arad_0356 [Agrobacterium radiobact 1 1e-36
222147188207 hypothetical protein Avi_0226 [Agrobacterium vitis S4] 1 8e-36
86355859211 hypothetical protein RHE_CH00200 [Rhizobium etli CFN 42 1 2e-34
116249976211 transmembrane protein [Rhizobium leguminosarum bv. vici 1 1e-33
150398536204 TadE family protein [Sinorhizobium medicae WSM419] Leng 1 1e-33
15963888204 hypothetical protein SMc04117 [Sinorhizobium meliloti 1 1 4e-33
241207152210 TadE family protein [Rhizobium leguminosarum bv. trifol 1 1e-32
209551754211 TadE family protein [Rhizobium leguminosarum bv. trifol 1 2e-32
>gi|315121766|ref|YP_004062255.1| hypothetical protein CKC_00080 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 192 Back     alignment and organism information
 Score =  273 bits (698), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 154/192 (80%), Gaps = 1/192 (0%)

Query: 1   MRKKLLQGIRRSILIREGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVAR 60
           M+K  LQG++R+I IREG+VAIEFA+L+MPY MLVFAILEI+LSFTA Q+FE+  Y++AR
Sbjct: 1   MKKNFLQGLKRTIFIREGSVAIEFALLIMPYLMLVFAILEIALSFTAEQIFENTTYEIAR 60

Query: 61  KIRTGEISSKNTHSLTEFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLQEITETV 120
           KIRTG+I+     SL +FR + C DL+V F+CS  EI  PYD YLDV+QIKSL +I   +
Sbjct: 61  KIRTGQINKSQVPSLKDFRNLVCKDLKVFFDCSPGEINNPYDFYLDVRQIKSLYDIPMKI 120

Query: 121 PRKDKSDSSSEIDDRNFSFHPGGPSTYNVLRAYYHWPLFTDLMRQYISSVKHPGKKGDFL 180
           PRK   +  SEIDD++F F PGG  TYNVLRA+YHWPL+TD MRQYISSV+HPGKKGDFL
Sbjct: 121 PRKG-VEFDSEIDDKDFDFAPGGARTYNVLRAFYHWPLYTDFMRQYISSVRHPGKKGDFL 179

Query: 181 LSSIVVFKNEPF 192
           + S+V FKNEPF
Sbjct: 180 IMSVVAFKNEPF 191


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227823966|ref|YP_002827939.1| Flp pilus assembly protein TadG [Sinorhizobium fredii NGR234] Length = 201 Back     alignment and organism information
>gi|222084463|ref|YP_002542992.1| hypothetical protein Arad_0356 [Agrobacterium radiobacter K84] Length = 237 Back     alignment and organism information
>gi|222147188|ref|YP_002548145.1| hypothetical protein Avi_0226 [Agrobacterium vitis S4] Length = 207 Back     alignment and organism information
>gi|86355859|ref|YP_467751.1| hypothetical protein RHE_CH00200 [Rhizobium etli CFN 42] Length = 211 Back     alignment and organism information
>gi|116249976|ref|YP_765814.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 211 Back     alignment and organism information
>gi|150398536|ref|YP_001329003.1| TadE family protein [Sinorhizobium medicae WSM419] Length = 204 Back     alignment and organism information
>gi|15963888|ref|NP_384241.1| hypothetical protein SMc04117 [Sinorhizobium meliloti 1021] Length = 204 Back     alignment and organism information
>gi|241207152|ref|YP_002978248.1| TadE family protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 210 Back     alignment and organism information
>gi|209551754|ref|YP_002283671.1| TadE family protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 211 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target192 hypothetical protein CLIBASIA_02295 [Candidatus Liberib
pfam0781143 pfam07811, TadE, TadE-like protein 9e-08
COG4961185 COG4961, TadG, Flp pilus assembly protein TadG [Intrace 2e-13
>gnl|CDD|149078 pfam07811, TadE, TadE-like protein Back     alignment and domain information
>gnl|CDD|34568 COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 192 hypothetical protein CLIBASIA_02295 [Candidatus Liberib
COG4961185 TadG Flp pilus assembly protein TadG [Intracellular tra 99.88
pfam0781143 TadE TadE-like protein. The members of this family are 99.26
COG384758 Flp Flp pilus assembly protein, pilin Flp [Intracellula 97.76
pfam0496447 Flp_Fap Flp/Fap pilin component. 96.63
COG4655 565 Predicted membrane protein [Function unknown] 95.35
pfam04917 356 Shufflon_N Bacterial shufflon protein, N-terminal const 94.17
pfam0530797 Bundlin Bundlin. This family consists of several bundli 93.5
>COG4961 TadG Flp pilus assembly protein TadG [Intracellular trafficking and secretion] Back     alignment and domain information
>pfam07811 TadE TadE-like protein Back     alignment and domain information
>COG3847 Flp Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion] Back     alignment and domain information
>pfam04964 Flp_Fap Flp/Fap pilin component Back     alignment and domain information
>COG4655 Predicted membrane protein [Function unknown] Back     alignment and domain information
>pfam04917 Shufflon_N Bacterial shufflon protein, N-terminal constant region Back     alignment and domain information
>pfam05307 Bundlin Bundlin Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00