254780577

254780577

phosphatidylserine decarboxylase

GeneID in NCBI database:8209574Locus tag:CLIBASIA_02320
Protein GI in NCBI database:254780577Protein Accession:YP_003064990.1
Gene range:-(703996, 704694)Protein Length:232aa
Gene description:phosphatidylserine decarboxylase
COG prediction:[I] Phosphatidylserine decarboxylase
KEGG prediction:psd; phosphatidylserine decarboxylase (EC:4.1.1.65); K01613 phosphatidylserine decarboxylase [EC:4.1.1.65]
SEED prediction:Phosphatidylserine decarboxylase (EC 4.1.1.65)
Pathway involved in KEGG:Glycerophospholipid metabolism [PATH:las00564]
Subsystem involved in SEED:Glycerolipid and Glycerophospholipid Metabolism in Bacteria
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MNLIQAIRKILVPIHFHGWPFIVSFAAFTIIIGMWSYGLLWFGAILTVWCAYFFRDPERVTPIDPNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIKSVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIGIVQIAGFVARRIVCWVKPTMKVEAGMRFGIIRFGSRVDLFLPKDANIRVEIGQKTVAGETVIAEFNSTKPPLLVCRT
ccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEccccEEEEEEEcccHHHcccccccEEEEEEEEcccccccEEcccccEEEEEEEccccccccccccHHHcccEEEEEEEcccccEEEEEEEEEEccEEEEccccccEEccccEEEEEEcccEEEEEEccccEEEEccccEEEEEEEEEEEccccccccEEEcc
ccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEccccEEEEEEEccccHHcccccccEEEEEEEEccccEEEEcccccEEEEEEEEccccEEccccccccHHccccEEEEEcccccEEEEEHHHHHHHEHHEccccccEEEcccEEEEEEEcccEEEEcccccEEEEEcccEEEEEEEEEEEccccccccEEEcc
MNLIQAIRKILVpihfhgwpfiVSFAAFTIIIGMWSYGLLWFGAILTVWCAYffrdpervtpidpnllispadgLVSAicemspppelelENEVMLRLSIFMNIFdchvnrmpiggeVIKSVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIGIVQIAGFVARRIVCWVKPTMKVEAGMRFGiirfgsrvdlflpkdanirveigqktvAGETVIaefnstkppllvcrt
MNLIQAIRKILVPIHFHGWPFIVSFAAFTIIIGMWSYGLLWFGAILTVWCAYFFRDPERVTPIDPNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIKSVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIGIVQIAGFVARRIVCWVKPTMKVEAGMRFGIIRFGSRVDLFLPKDANIRVEigqktvagetviaefnstkppllvcrt
MNLIQAIRKILVPIHFHGWPFIVSFAAFTIIIGMWSYGLLWFGAILTVWCAYFFRDPERVTPIDPNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIKSVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIGIVQIAGFVARRIVCWVKPTMKVEAGMRFGIIRFGSRVDLFLPKDANIRVEIGQKTVAGETVIAEFNSTKPPLLVCRT
********KILVPIHFHGWPFIVSFAAFTIIIGMWSYGLLWFGAILTVWCAYFFRDPERVTPIDPNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIKSVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIGIVQIAGFVARRIVCWVKPTMKVEAGMRFGIIRFGSRVDLFLPKDANIRVEIGQKTVAGETVIAEF************
MNLIQAIRKILVPIHFHGWPFIVSFAAFTIIIGMWSYGLLWFGAILTVWCAYFFRDPERVTPIDPNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIKSVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIGIVQIAGFVARRIVCWVKPTMKVEAGMRFGIIRFGSRVDLFLPKDANIRVEIGQKTVAGETVIAEFNSTKPPLLVCRT
*NLIQAIRKILVPIHFHGWPFIVSFAAFTIIIGMWSYGLLWFGAILTVWCAYFFRDPERVTPIDPNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIKSVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIGIVQIAGFVARRIVCWVKPTMKVEAGMRFGIIRFGSRVDLFLPKDANIRVEIGQKTVAGETVIAEFNSTKPPL*****
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLIQAIRKILVPIHFHGWPFIVSFAAFTIIIGMWSYGLLWFGAILTVWCAYFFRDPERVTPIDPNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIKSVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIGIVQIAGFVARRIVCWVKPTMKVEAGMRFGIIRFGSRVDLFLPKDANIRVEIGQKTVAGETVIAEFNSTKPPLLVCRT
MNLIQAIRKILVPIHFHGWPFIVSFAAFTIIIGMWSYGLLWFGAILTVWCAYFFRDPERVTPIDPNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIKSVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIGIVQIAGFVARRIVCWVKPTMKVEAGMRFGIIRFGSRVDLFLPKDANIRVEIGQKTVAGETVIAEFNSTKPPLLVCRT
MNLIQAIRKILVPIHFHGWPFIVSFAAFTIIIGMWSYGLLWFGAILTVWCAYFFRDPERVTPIDPNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIKSVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIGIVQIAGFVARRIVCWVKPTMKVEAGMRFGIIRFGSRVDLFLPKDANIRVEIGQKTVAGETVIAEFNSTKPPLLVCRT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target232 phosphatidylserine decarboxylase [Candidatus Liberibact
315121770232 phosphatidylserine decarboxylase [Candidatus Liberibact 1 1e-111
227821446232 phosphatidylserine decarboxylase [Sinorhizobium fredii 1 4e-76
209548625232 phosphatidylserine decarboxylase [Rhizobium leguminosar 1 2e-75
241203912232 phosphatidylserine decarboxylase [Rhizobium leguminosar 1 2e-74
159184599232 phosphatidylserine decarboxylase [Agrobacterium tumefac 1 3e-74
116251299232 phosphatidylserine decarboxylase [Rhizobium leguminosar 1 4e-74
327191292232 phosphatidylserine decarboxylase protein [Rhizobium etl 1 4e-74
325292442232 Phosphatidylserine decarboxylase [Agrobacterium sp. H13 1 5e-74
15964874232 phosphatidylserine decarboxylase [Sinorhizobium melilot 1 8e-74
150395947232 phosphatidylserine decarboxylase [Sinorhizobium medicae 1 3e-73
>gi|315121770|ref|YP_004062259.1| phosphatidylserine decarboxylase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 232 Back     alignment and organism information
 Score =  404 bits (1039), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/232 (81%), Positives = 212/232 (91%)

Query: 1   MNLIQAIRKILVPIHFHGWPFIVSFAAFTIIIGMWSYGLLWFGAILTVWCAYFFRDPERV 60
           M L +AIRKILVPIHFHGWPF+VSF A TII+GMWS+  LW G ILT WCAYFFRDPERV
Sbjct: 1   MPLFRAIRKILVPIHFHGWPFVVSFLALTIIVGMWSHFFLWIGIILTTWCAYFFRDPERV 60

Query: 61  TPIDPNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIK 120
           TPID +LLISPADG +SA+CEM PPPELEL++E+M RLSIFMN+FDCH+NR+PI GE+IK
Sbjct: 61  TPIDRDLLISPADGHISAVCEMIPPPELELDDEIMFRLSIFMNVFDCHINRIPISGEIIK 120

Query: 121 SVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIGIVQIAGFVARRIVCWVKPTMKVEAG 180
           +VHRNGQFMNA LDKASEQNERQSLVL+T HG I ++QIAGF+ARRIVCWVKPTM+VEAG
Sbjct: 121 TVHRNGQFMNADLDKASEQNERQSLVLETAHGKIAVIQIAGFIARRIVCWVKPTMQVEAG 180

Query: 181 MRFGIIRFGSRVDLFLPKDANIRVEIGQKTVAGETVIAEFNSTKPPLLVCRT 232
           MRFGIIRFGSRVD+F+PK+ANIRVEIGQKTVAGETVIAEFNSTKPPL V RT
Sbjct: 181 MRFGIIRFGSRVDVFIPKNANIRVEIGQKTVAGETVIAEFNSTKPPLSVRRT 232


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821446|ref|YP_002825416.1| phosphatidylserine decarboxylase [Sinorhizobium fredii NGR234] Length = 232 Back     alignment and organism information
>gi|209548625|ref|YP_002280542.1| phosphatidylserine decarboxylase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 232 Back     alignment and organism information
>gi|241203912|ref|YP_002975008.1| phosphatidylserine decarboxylase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 232 Back     alignment and organism information
>gi|159184599|ref|NP_354087.2| phosphatidylserine decarboxylase [Agrobacterium tumefaciens str. C58] Length = 232 Back     alignment and organism information
>gi|116251299|ref|YP_767137.1| phosphatidylserine decarboxylase [Rhizobium leguminosarum bv. viciae 3841] Length = 232 Back     alignment and organism information
>gi|327191292|gb|EGE58332.1| phosphatidylserine decarboxylase protein [Rhizobium etli CNPAF512] Length = 232 Back     alignment and organism information
>gi|325292442|ref|YP_004278306.1| Phosphatidylserine decarboxylase [Agrobacterium sp. H13-3] Length = 232 Back     alignment and organism information
>gi|15964874|ref|NP_385227.1| phosphatidylserine decarboxylase [Sinorhizobium meliloti 1021] Length = 232 Back     alignment and organism information
>gi|150395947|ref|YP_001326414.1| phosphatidylserine decarboxylase [Sinorhizobium medicae WSM419] Length = 232 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target232 phosphatidylserine decarboxylase [Candidatus Liberibact
PRK05305206 PRK05305, PRK05305, phosphatidylserine decarboxylase; P 4e-84
TIGR00164189 TIGR00164, PS_decarb_rel, phosphatidylserine decarboxyl 8e-52
COG0688239 COG0688, Psd, Phosphatidylserine decarboxylase [Lipid m 2e-57
pfam02666201 pfam02666, PS_Dcarbxylase, Phosphatidylserine decarboxy 1e-43
PRK03934265 PRK03934, PRK03934, phosphatidylserine decarboxylase; P 4e-05
>gnl|CDD|180005 PRK05305, PRK05305, phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|129268 TIGR00164, PS_decarb_rel, phosphatidylserine decarboxylase precursor-related protein Back     alignment and domain information
>gnl|CDD|31032 COG0688, Psd, Phosphatidylserine decarboxylase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|145688 pfam02666, PS_Dcarbxylase, Phosphatidylserine decarboxylase Back     alignment and domain information
>gnl|CDD|179679 PRK03934, PRK03934, phosphatidylserine decarboxylase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 232 phosphatidylserine decarboxylase [Candidatus Liberibact
PRK05305214 phosphatidylserine decarboxylase; Provisional 100.0
COG0688239 Psd Phosphatidylserine decarboxylase [Lipid metabolism] 100.0
TIGR00164229 PS_decarb_rel phosphatidylserine decarboxylase homolog; 100.0
PRK03934267 phosphatidylserine decarboxylase; Provisional 99.97
pfam02666201 PS_Dcarbxylase Phosphatidylserine decarboxylase. This i 100.0
PRK00044291 psd phosphatidylserine decarboxylase; Reviewed 99.96
PRK04722280 consensus 99.96
PRK01734294 consensus 99.96
PRK03481322 consensus 99.96
PRK03140259 phosphatidylserine decarboxylase; Provisional 99.96
PRK09629610 bifunctional thiosulfate sulfurtransferase/phosphatidyl 99.96
PRK04599285 consensus 99.95
PRK00723297 phosphatidylserine decarboxylase; Provisional 99.95
PRK00882295 consensus 99.94
KOG2419975 consensus 99.83
KOG2420382 consensus 99.69
TIGR00163328 PS_decarb phosphatidylserine decarboxylase; InterPro: I 99.04
PRK09824625 beta-glucoside-specific PTS system components IIABC; Pr 98.32
PRK09439169 glucose-specific PTS system component; Provisional 98.18
pfam00358133 PTS_EIIA_1 phosphoenolpyruvate-dependent sugar phosphot 97.9
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specif 97.64
COG2190156 NagE Phosphotransferase system IIA components [Carbohyd 97.55
PRK10255648 N-acetyl glucosamine specific PTS system components IIA 98.14
PRK09439169 glucose-specific PTS system component; Provisional 93.9
TIGR00830129 PTBA PTS system, glucose subfamily, IIA component; Inte 91.91
TIGR00830129 PTBA PTS system, glucose subfamily, IIA component; Inte 97.43
TIGR01995660 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIA 94.8
pfam00358133 PTS_EIIA_1 phosphoenolpyruvate-dependent sugar phosphot 95.12
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specif 93.51
COG0688239 Psd Phosphatidylserine decarboxylase [Lipid metabolism] 91.48
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabolism] 94.88
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier protein 93.51
cd0685067 biotinyl_domain The biotinyl-domain or biotin carboxyl 93.44
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre 93.4
PRK0705180 hypothetical protein; Validated 92.97
pfam0036473 Biotin_lipoyl Biotin-requiring enzyme. This family cove 92.82
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl carrier 92.7
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr 92.48
PRK09282580 pyruvate carboxylase subunit B; Validated 91.83
PRK129991147 pyruvate carboxylase; Reviewed 91.59
TIGR01348 655 PDHac_trf_long pyruvate dehydrogenase complex dihydroli 90.15
CHL00117 1350 rpoC2 RNA polymerase beta'' subunit; Reviewed 94.29
PRK10255648 N-acetyl glucosamine specific PTS system components IIA 94.01
CHL00006 1372 consensus 91.3
PRK02597 1295 DNA-directed RNA polymerase subunit beta'; Provisional 90.28
>PRK05305 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>COG0688 Psd Phosphatidylserine decarboxylase [Lipid metabolism] Back     alignment and domain information
>TIGR00164 PS_decarb_rel phosphatidylserine decarboxylase homolog; InterPro: IPR004428 Phosphatidylserine decarboxylase is synthesized as a single chain precursor Back     alignment and domain information
>PRK03934 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>pfam02666 PS_Dcarbxylase Phosphatidylserine decarboxylase Back     alignment and domain information
>PRK00044 psd phosphatidylserine decarboxylase; Reviewed Back     alignment and domain information
>PRK04722 consensus Back     alignment and domain information
>PRK01734 consensus Back     alignment and domain information
>PRK03481 consensus Back     alignment and domain information
>PRK03140 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK04599 consensus Back     alignment and domain information
>PRK00723 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK00882 consensus Back     alignment and domain information
>KOG2419 consensus Back     alignment and domain information
>KOG2420 consensus Back     alignment and domain information
>TIGR00163 PS_decarb phosphatidylserine decarboxylase; InterPro: IPR005221 Phosphatidylserine decarboxylase is synthesized as a single chain precursor Back     alignment and domain information
>PRK09824 beta-glucoside-specific PTS system components IIABC; Provisional Back     alignment and domain information
>PRK09439 glucose-specific PTS system component; Provisional Back     alignment and domain information
>pfam00358 PTS_EIIA_1 phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10255 N-acetyl glucosamine specific PTS system components IIABC; Provisional Back     alignment and domain information
>PRK09439 glucose-specific PTS system component; Provisional Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) , is a major carbohydrate transport system in bacteria Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) , is a major carbohydrate transport system in bacteria Back     alignment and domain information
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component; InterPro: IPR011297 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) , is a major carbohydrate transport system in bacteria Back     alignment and domain information
>pfam00358 PTS_EIIA_1 phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>COG0688 Psd Phosphatidylserine decarboxylase [Lipid metabolism] Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>pfam00364 Biotin_lipoyl Biotin-requiring enzyme Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees Back     alignment and domain information
>CHL00117 rpoC2 RNA polymerase beta'' subunit; Reviewed Back     alignment and domain information
>PRK10255 N-acetyl glucosamine specific PTS system components IIABC; Provisional Back     alignment and domain information
>CHL00006 consensus Back     alignment and domain information
>PRK02597 DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target232 phosphatidylserine decarboxylase [Candidatus Liberibact
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phosphotrans 98.26
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransferase 98.05
2gpr_A154 Glucose-permease IIA component; phosphotransferase, enz 98.01
1z6h_A72 Biotin/lipoyl attachment protein; solution structure, b 95.57
2auk_A190 DNA-directed RNA polymerase beta' chain; sandwich-barre 94.91
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component of py 94.52
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; biotin-r 94.4
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; biotin, do 94.07
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 93.55
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, f 93.32
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase compon 93.28
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, trans 93.18
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehydroge 93.01
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein compl 92.85
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase component 92.81
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 92.23
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 91.99
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, pyru 91.47
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, 90.79
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic acid 90.52
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase component 90.51
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, trans 93.4
2gpr_A154 Glucose-permease IIA component; phosphotransferase, enz 92.67
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phosphotrans 92.6
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein compl 91.35
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
Probab=98.26  E-value=1.2e-05  Score=56.15  Aligned_cols=135  Identities=12%  Similarity=0.103  Sum_probs=92.2

Q ss_pred             CCEEEEECCCCEEEEEECCCCCHHHCCCCCEEEEEEEECCCCCCEEEEEECCEEEEEEECCCCCCCHHHCCCCCCCEEEE
Q ss_conf             66088630541432331157300000468726999960511012489753154510131465556501012001570689
Q gi|254780577|r   65 PNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIKSVHRNGQFMNAALDKASEQNERQS  144 (232)
Q Consensus        65 ~~~ivSPaDG~V~~i~~~~~~~~~~~~~~~~~~I~Ifls~~dvH~~raP~~G~V~~~~~~~G~~~~a~~~~~~~~NER~~  144 (232)
                      .-.++||++|++..++++.|+...+-.=++..  .|  -|-+ +..+||++|+|..+.-.                 ...
T Consensus        12 ~i~v~APv~G~vi~L~~v~D~vFs~~~~G~G~--AI--~P~~-~~v~AP~dG~I~~i~~T-----------------~HA   69 (161)
T 1f3z_A           12 TIEIIAPLSGEIVNIEDVPDVVFAEKIVGDGI--AI--KPTG-NKMVAPVDGTIGKIFET-----------------NHA   69 (161)
T ss_dssp             CEEEECSSCEEEEEGGGSSSHHHHTTSSCEEE--EE--EECS-SEEECSSSEEEEEECTT-----------------SSE
T ss_pred             CEEEEECCCCEEEECCCCCCHHHHCCCCCCEE--EE--ECCC-CEEEECCCEEEEEECCC-----------------CCE
T ss_conf             68999636727988330988588267812629--99--8369-98990789799998689-----------------979


Q ss_pred             EEEECCCCEEEEEEECCC----CCCEEEEECCCCCEEECCCEEEEEEE--------CCEEEEEECC--CCEEEEECCCEE
Q ss_conf             999708982999985157----65503651389985703866888832--------8989999639--973676229889
Q gi|254780577|r  145 LVLKTIHGNIGIVQIAGF----VARRIVCWVKPTMKVEAGMRFGIIRF--------GSRVDLFLPK--DANIRVEIGQKT  210 (232)
Q Consensus       145 ~~~~~~~~~i~~~qiag~----~arrI~~~~~~g~~v~~G~r~G~irf--------GS~vdi~lP~--~~~~~V~~Gq~V  210 (232)
                      +.+++++|.-.+++++--    ...-..+.+++||++++||.+.-+-+        --.+-+.+.+  +.+..+...+.|
T Consensus        70 igi~t~~G~eiLiHiGidTv~l~G~gF~~~vk~Gd~V~~G~~L~~~D~~~i~~~g~~~~t~vvv~n~~~~~~~~~~~~~v  149 (161)
T 1f3z_A           70 FSIESDSGVELFVHFGIDTVELKGEGFKRIAEEGQRVKVGDTVIEFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSGSV  149 (161)
T ss_dssp             EEEEETTSCEEEEECSBSGGGGTTTTEEECSCTTCEECTTCEEEEECHHHHHHHCSBCCEEEEESCGGGCSEEEECCSEE
T ss_pred             EEEEECCCCEEEEEECCCHHHCCCCCEEEEECCCCEEECCCEEEEECHHHHHHCCCCCCEEEEEECCHHCCEEEECCCCE
T ss_conf             99994899899999764577618974089976899993898989987999986199982599997656603146247858


Q ss_pred             EEEEEEEEEEC
Q ss_conf             93077879717
Q gi|254780577|r  211 VAGETVIAEFN  221 (232)
Q Consensus       211 ~aGeTila~l~  221 (232)
                      ++|++.|-++.
T Consensus       150 ~~g~~~l~~i~  160 (161)
T 1f3z_A          150 TVGETPVIRIK  160 (161)
T ss_dssp             CTTTSEEEEEE
T ss_pred             EECCCEEEEEE
T ss_conf             62992799998



>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, domain, BCCP, X-RAY diffraction, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii OT3} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hammerhead structure, selenomethionine, ligase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase isozyme 2, glucose metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target232 phosphatidylserine decarboxylase [Candidatus Liberibact
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia coli 98.09
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus subtilis 98.09
d2gpra_154 Glucose permease IIa domain, IIa-glc {Mycoplasma capric 97.97
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferase {Az 94.82
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase (TC 93.5
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase compl 92.97
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escherichia 92.92
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain alpha 92.5
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferase {Es 92.38
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferase {Ne 91.41
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia coli 90.16
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Duplicated hybrid motif
family: Glucose permease-like
domain: Glucose-specific factor III (glsIII)
species: Escherichia coli [TaxId: 562]
Probab=98.09  E-value=1.7e-05  Score=53.53  Aligned_cols=133  Identities=12%  Similarity=0.131  Sum_probs=88.6

Q ss_pred             EEEEECCCCEEEEEECCCCCHHHCCCCCEEEEEEEECCCCCCEEEEEECCEEEEEEECCCCCCCHHHCCCCCCCEEEEEE
Q ss_conf             08863054143233115730000046872699996051101248975315451013146555650101200157068999
Q gi|254780577|r   67 LLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIKSVHRNGQFMNAALDKASEQNERQSLV  146 (232)
Q Consensus        67 ~ivSPaDG~V~~i~~~~~~~~~~~~~~~~~~I~Ifls~~dvH~~raP~~G~V~~~~~~~G~~~~a~~~~~~~~NER~~~~  146 (232)
                      .++||++|++..++++.|+...+-.=+  .=+.|  -|-+ +...||++|+|....-.                 .-.+.
T Consensus         3 ~i~aP~~G~vi~L~~v~D~vFs~~~mG--~GvAI--~P~~-~~v~AP~dG~V~~v~~T-----------------~HAig   60 (150)
T d2f3ga_           3 EIIAPLSGEIVNIEDVPDVVFAEKIVG--DGIAI--KPTG-NKMVAPVDGTIGKIFET-----------------NHAFS   60 (150)
T ss_dssp             EEECSSSEEEECGGGSSCHHHHTTSSC--EEEEE--EECS-SEEECSSSEEEEEECTT-----------------SSEEE
T ss_pred             EEEEECCCEEEECCCCCCHHHHCCCCC--CEEEE--EECC-CEEEEECCEEEEEECCC-----------------CCEEE
T ss_conf             999826856988231989588068843--75999--9579-92995108799998778-----------------98999


Q ss_pred             EECCCCEEEEEEECC----CCCCEEEEECCCCCEEECCCEEEEEEE--------CCEEEEEECC--CCEEEEECCCEEEE
Q ss_conf             970898299998515----765503651389985703866888832--------8989999639--97367622988993
Q gi|254780577|r  147 LKTIHGNIGIVQIAG----FVARRIVCWVKPTMKVEAGMRFGIIRF--------GSRVDLFLPK--DANIRVEIGQKTVA  212 (232)
Q Consensus       147 ~~~~~~~i~~~qiag----~~arrI~~~~~~g~~v~~G~r~G~irf--------GS~vdi~lP~--~~~~~V~~Gq~V~a  212 (232)
                      +++++|.-.+++++-    +...-..+.+++||++++||.+.-+-+        --.+-+.+.+  +++........|++
T Consensus        61 i~t~~G~eiLIHiGidTV~L~G~gF~~~v~~Gd~V~~G~~L~~~D~~~i~~~g~~~~t~vvitn~~~~~~~~~~~g~v~~  140 (150)
T d2f3ga_          61 IESDSGVELFVHFGIDTVELKGEGFKRIAEEGQRVKVGDTVIEFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSGSVTV  140 (150)
T ss_dssp             EEETTSCEEEEECSBSGGGGTTTTEEECSCTTCEECTTCEEEEECHHHHHHHCSBCCEEEEETTGGGCSEEEECCSEECT
T ss_pred             EEECCCEEEEEEECCCHHHCCCCCEEEEECCCCEECCCCEEEEECHHHHHHCCCCCEEEEEEECCHHCCEEEECCCCEEE
T ss_conf             99289339999976455424884148995689998899999998599998549997169999774760203424785851


Q ss_pred             EEEEEEEEC
Q ss_conf             077879717
Q gi|254780577|r  213 GETVIAEFN  221 (232)
Q Consensus       213 GeTila~l~  221 (232)
                      |++.|-.+.
T Consensus       141 g~~~i~~i~  149 (150)
T d2f3ga_         141 GETPVIRIK  149 (150)
T ss_dssp             TTSEEEEEE
T ss_pred             CCCEEEEEE
T ss_conf             993799998



>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target232 phosphatidylserine decarboxylase [Candidatus Liberibact
2gpr_A_154 Glucose-permease IIA component; phosphotransferase 98.18
1ax3_A_162 Iiaglc, glucose permease IIA domain; phosphotransf 98.05
1f3z_A_161 EIIA-GLC, glucose-specific phosphocarrier; phospho 97.99
1iyu_A_79 E2P, dihydrolipoamide acetyltransferase component 96.28
1k8m_A_93 E2 component of branched-chain ahpha-ketoacid dehy 95.02
1dcz_A_77 Transcarboxylase 1.3S subunit; antiparallel beta s 95.0
1bdo_A_80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 94.92
1qjo_A_80 Dihydrolipoamide acetyltransferase; lipoyl domain, 94.86
3hbl_A_1069-115082 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 94.79
2dn8_A_100 Acetyl-COA carboxylase 2; biotin required enzyme, 94.76
1z6h_A_72 Biotin/lipoyl attachment protein; solution structu 94.73
3crk_C_87 Dihydrolipoyllysine-residue acetyltransferase comp 94.68
2ejm_A_99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 94.63
1ghj_A_79 E2, E2, the dihydrolipoamide succinyltransferase c 94.39
2kcc_A_84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 94.07
1gjx_A_81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 93.89
2d5d_A_74 Methylmalonyl-COA decarboxylase gamma chain; bioti 93.58
2dnc_A_98 Pyruvate dehydrogenase protein X component; lipoic 93.37
2dne_A_108 Dihydrolipoyllysine-residue acetyltransferase comp 92.86
1y8o_B_128 Dihydrolipoyllysine-residue acetyltransferase comp 91.83
3bg3_A_644-71875 Pyruvate carboxylase, mitochondrial; TIM barrel, A 91.44
2jku_A_94 Propionyl-COA carboxylase alpha chain, mitochondri 90.67
2k7v_A_85 Dihydrolipoyllysine-residue acetyltransferase comp 90.57
2qf7_A_1087-116579 Pyruvate carboxylase protein; multi-domain, multi- 90.06
2gu1_A_206-361156 Zinc peptidase; alpha/beta, beta barrel, structura 92.56
2hsi_A_116-267152 Putative peptidase M23; structural genomics, PSI, 92.18
2auk_A_83-190108 DNA-directed RNA polymerase beta' chain; sandwich- 92.33
3hbl_A_1069-115082 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 90.81
2gpr_A_154 Glucose-permease IIA component; phosphotransferase 90.13
>2gpr_A (A:) Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} Back     alignment and structure
Probab=98.18  E-value=2.3e-05  Score=55.37  Aligned_cols=133  Identities=13%  Similarity=0.185  Sum_probs=93.2

Q ss_pred             CCCEEEEECCCCEEEEEECCCCCHHHCCCCCEEEEEEEECCCCCCEEEEEECCEEEEEEECCCCCCCHHHCCCCCCCEEE
Q ss_conf             76608863054143233115730000046872699996051101248975315451013146555650101200157068
Q gi|254780577|r   64 DPNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIKSVHRNGQFMNAALDKASEQNERQ  143 (232)
Q Consensus        64 ~~~~ivSPaDG~V~~i~~~~~~~~~~~~~~~~~~I~Ifls~~dvH~~raP~~G~V~~~~~~~G~~~~a~~~~~~~~NER~  143 (232)
                      .+..++||++|++..++++.|+....  +--..-+.|..   +-+...||++|+|..+.-.                 +-
T Consensus         6 k~~~i~aP~~G~~i~l~~v~D~vFa~--~~~G~G~aI~P---~~~~i~AP~dG~I~~i~~T-----------------~H   63 (154)
T 2gpr_A            6 KNLKVLAPCDGTIITLDEVEDEVFKE--RMLGDGFAINP---KSNDFHAPVSGKLVTAFPT-----------------KH   63 (154)
T ss_dssp             CCEEEECSSSEEEECGGGSSCHHHHT--TSSCEEEEEEE---SSSEEECSSCEEEEECCTT-----------------CS
T ss_pred             CCEEEEECCCCEEEECCCCCCHHHCC--CCCCCEEEEEE---CCCEEECCCCEEEEEECCC-----------------CC
T ss_conf             73199964761798811087834267--89616599990---6997991788699998789-----------------96


Q ss_pred             EEEEECCCCEEEEEEECCC----CCCEEEEECCCCCEEECCCEEEEEEE--------CCEEEEEECC--CCEEEEECCCE
Q ss_conf             9999708982999985157----65503651389985703866888832--------8989999639--97367622988
Q gi|254780577|r  144 SLVLKTIHGNIGIVQIAGF----VARRIVCWVKPTMKVEAGMRFGIIRF--------GSRVDLFLPK--DANIRVEIGQK  209 (232)
Q Consensus       144 ~~~~~~~~~~i~~~qiag~----~arrI~~~~~~g~~v~~G~r~G~irf--------GS~vdi~lP~--~~~~~V~~Gq~  209 (232)
                      .+.+++++|.-.+++++--    ...-..+.+++||+|++||.+.-+-+        --.+-+.+.+  +.++.....+.
T Consensus        64 Ai~i~~~~G~eiLiHiGidTv~L~g~gF~~~v~~Gd~V~~G~~L~~~d~~~i~~~g~~~~~~vv~~n~~~~~i~~~~~~~  143 (154)
T 2gpr_A           64 AFGIQTKSGVEILLHIGLDTVSLDGNGFESFVTQDQEVNAGDKLVTVDLKSVAKKVPSIKSPIIFTNNGGKTLEIVKMGE  143 (154)
T ss_dssp             EEEEECTTSCEEEEECSSSGGGGTTCSEEECCCTTCEECTTCEEEEECHHHHHHHSSCCCEEEEEEECSSCCCSCBCCEE
T ss_pred             EEEEECCCCCEEEEEECCCHHCCCCCCEEEEECCCCEECCCCEEEEECHHHHHHCCCCCCEEEEEECCCCCEEEECCCCC
T ss_conf             99999299989999974243014895158997489999189999998599998639998269999879872577723684


Q ss_pred             EEEEEEEEE
Q ss_conf             993077879
Q gi|254780577|r  210 TVAGETVIA  218 (232)
Q Consensus       210 V~aGeTila  218 (232)
                      |++|++++.
T Consensus       144 V~~gd~i~~  152 (154)
T 2gpr_A          144 VKQGDVVAI  152 (154)
T ss_dssp             ECTTCEEEE
T ss_pred             CCCCCEEEE
T ss_conf             648999999



>1ax3_A (A:) Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>1f3z_A (A:) EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} Back     alignment and structure
>1iyu_A (A:) E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} Back     alignment and structure
>1k8m_A (A:) E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>1dcz_A (A:) Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin; NMR {Propionibacterium freudenreichiisubsp} Back     alignment and structure
>1bdo_A (A:) Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hammerhead structure, selenomethionine, ligase; HET: BTN; 1.80A {Escherichia coli} Back     alignment and structure
>1qjo_A (A:) Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} Back     alignment and structure
>3hbl_A (A:1069-1150) Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Back     alignment and structure
>2dn8_A (A:) Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6h_A (A:) Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>3crk_C (C:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase isozyme 2, glucose metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>2ejm_A (A:) Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ghj_A (A:) E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} Back     alignment and structure
>2kcc_A (A:) Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>1gjx_A (A:) Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} Back     alignment and structure
>2d5d_A (A:) Methylmalonyl-COA decarboxylase gamma chain; biotin, domain, BCCP, X-RAY diffraction, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii OT3} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>2dnc_A (A:) Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dne_A (A:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>1y8o_B (B:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: LPA ADP; 2.48A {Homo sapiens} Back     alignment and structure
>3bg3_A (A:644-718) Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2jku_A (A:) Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, polymorphism, disease mutation, nucleotide-binding; HET: PG4; 1.5A {Homo sapiens} Back     alignment and structure
>2k7v_A (A:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>2qf7_A (A:1087-1165) Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA SAP; 2.00A {Rhizobium etli cfn 42} Back     alignment and structure
>2gu1_A (A:206-361) Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae} Back     alignment and structure
>2hsi_A (A:116-267) Putative peptidase M23; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.90A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2auk_A (A:83-190) DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} Back     alignment and structure
>3hbl_A (A:1069-1150) Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Back     alignment and structure
>2gpr_A (A:) Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} Back     alignment and structure