254780578

254780578

phosphatidylserine synthase

GeneID in NCBI database:8209575Locus tag:CLIBASIA_02325
Protein GI in NCBI database:254780578Protein Accession:YP_003064991.1
Gene range:-(703100, 703996)Protein Length:298aa
Gene description:phosphatidylserine synthase
COG prediction:[I] Phosphatidylserine synthase
KEGG prediction:pssA; phosphatidylserine synthase; K00998 phosphatidylserine synthase [EC:2.7.8.8]
SEED prediction:CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)
Pathway involved in KEGG:Glycerophospholipid metabolism [PATH:las00564]
Glycine, serine and threonine metabolism [PATH:las00260]
Subsystem involved in SEED:Glycerolipid and Glycerophospholipid Metabolism in Bacteria
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM6 TM-Helix
TOPPRED5 TM-Helix
HMMTOP8 TM-Helix
MEMSAT8 TM-Helix
MEMSAT_SVM8 TM-Helix
PHOBIUS8 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MGNTLQCKEIPRGKKKYNVLPDDFVVPSDQDEARYSFYKGKRWSLQEKEIPPFKFLFPNLVTILAICAGFSGIGSAIEGNYETAVCMVLVAAFLDGIDGRIARFMEATSKFGAQLDSLADVINFGVAPSLVTYIAVLRQAHAFGWSIALMYTIAISLRLARFNIMNDCDEKDNWKSEYFVGVPAPLGAILLMLPLYINFLGFKISVIYGYGSTIYAMIISFLLCSRLPVWSGKKIHRKFVLPIVLCSVAYIAFMIHFLWEMIIFSTLCYIMLLPISFYCWKKRYGIKPEQKKHKDYIK
cccccccccccccHHHHHcHHHcccccccHHHHHHHcccccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcHHccc
cccEEEEEEcccccccccccccccccccccccccccccccccHcHcccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHEcccccHccccHccHHHHHHHcHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
mgntlqckeiprgkkkynvlpddfvvpsdqdearysfykgkrwslqekeippfkflfpNLVTILAICAGfsgigsaiegNYETAVCMVLVAAFLDGIDGRIARFMEATSKFGAQLDSLADVINFGVAPSLVTYIAVLRQAHAFGWSIALMYTIAISLRLARFnimndcdekdnwkseyfvgvpaplGAILLMLPLYINFLGFKISVIYGYGSTIYAMIISFLLCsrlpvwsgkkihrkfVLPIVLCSVAYIAFMIHFLWEMIIFSTLCYIMLLPISfycwkkrygikpeqkkhkdyik
mgntlqckeiprgkkkynvlpddfvvpsdqdearYSFYKGKRWSLQEKEIPPFKFLFPNLVTILAICAGFSGIGSAIEGNYETAVCMVLVAAFLDGIDGRIARFMEATSKFGAQLDSLADVINFGVAPSLVTYIAVLRQAHAFGWSIALMYTIAISLRLARFNIMNDCDEKDNWKSEYFVGVPAPLGAILLMLPLYINFLGFKISVIYGYGSTIYAMIISFLLCSRLPVWSGKKIHRKFVLPIVLCSVAYIAFMIHFLWEMIIFSTLCYIMLLPISFYCWKKrygikpeqkkhkdyik
MGNTLQCKEIPRGKKKYNVLPDDFVVPSDQDEARYSFYKGKRWSLQEKEIPPFKFLFPNLVTILAICAGFSGIGSAIEGNYETAVCMVLVAAFLDGIDGRIARFMEATSKFGAQLDSLADVINFGVAPSLVTYIAVLRQAHAFGWSIALMYTIAISLRLARFNIMNDCDEKDNWKSEYFVGVPAPLGAILLMLPLYINFLGFKISVIYGYGSTIYAMIISFLLCSRLPVWSGKKIHRKFVLPIVLCSVAYIAFMIHFLWEMIIFSTLCYIMLLPISFYCWKKRYGIKPEQKKHKDYIK
******************************************************FLFPNLVTILAICAGFSGIGSAIEGNYETAVCMVLVAAFLDGIDGRIARFMEATSKFGAQLDSLADVINFGVAPSLVTYIAVLRQAHAFGWSIALMYTIAISLRLARFNIMNDCDEKDNWKSEYFVGVPAPLGAILLMLPLYINFLGFKISVIYGYGSTIYAMIISFLLCSRLPVWSGKKIHRKFVLPIVLCSVAYIAFMIHFLWEMIIFSTLCYIMLLPISFYC*******************
MGNTLQCKEIPRGKKKYNVLPDDFVVPSDQDEARYSFYKGKRWSLQEKEIPPFKFLFPNLVTILAICAGFSGIGSAIEGNYETAVCMVLVAAFLDGIDGRIARFMEATSKFGAQLDSLADVINFGVAPSLVTYIAVLRQAHAFGWSIALMYTIAISLRLARFNIMNDCDEKDNWKSEYFVGVPAPLGAILLMLPLYINFLGFKISVIYGYGSTIYAMIISFLLCSRLPVWSGKKIHRKFVLPIVLCSVAYIAFMIHFLWEMIIFSTLCYIMLLPISFYCWKKRYGIKP**********
*GNTLQCKEIPRGKKKYNVLPDDFVVPSDQDEARYSFYKGKRWSLQEKEIPPFKFLFPNLVTILAICAGFSGIGSAIEGNYETAVCMVLVAAFLDGIDGRIARFMEATSKFGAQLDSLADVINFGVAPSLVTYIAVLRQAHAFGWSIALMYTIAISLRLARFNIMNDCDEKDNWKSEYFVGVPAPLGAILLMLPLYINFLGFKISVIYGYGSTIYAMIISFLLCSRLPVWSGKKIHRKFVLPIVLCSVAYIAFMIHFLWEMIIFSTLCYIMLLPISFYCWKKRYGIK***********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNTLQCKEIPRGKKKYNVLPDDFVVPSDQDEARYSFYKGKRWSLQEKEIPPFKFLFPNLVTILAICAGFSGIGSAIEGNYETAVCMVLVAAFLDGIDGRIARFMEATSKFGAQLDSLADVINFGVAPSLVTYIAVLRQAHAFGWSIALMYTIAISLRLARFNIMNDCDEKDNWKSEYFVGVPAPLGAILLMLPLYINFLGFKISVIYGYGSTIYAMIISFLLCSRLPVWSGKKIHRKFVLPIVLCSVAYIAFMIHFLWEMIIFSTLCYIMLLPISFYCWKKRYGIKPEQKKHKDYIK
MGNTLQCKEIPRGKKKYNVLPDDFVVPSDQDEARYSFYKGKRWSLQEKEIPPFKFLFPNLVTILAICAGFSGIGSAIEGNYETAVCMVLVAAFLDGIDGRIARFMEATSKFGAQLDSLADVINFGVAPSLVTYIAVLRQAHAFGWSIALMYTIAISLRLARFNIMNDCDEKDNWKSEYFVGVPAPLGAILLMLPLYINFLGFKISVIYGYGSTIYAMIISFLLCSRLPVWSGKKIHRKFVLPIVLCSVAYIAFMIHFLWEMIIFSTLCYIMLLPISFYCWKKRYGIKPEQKKHKDYIK
MGNTLQCKEIPRGKKKYNVLPDDFVVPSDQDEARYSFYKGKRWSLQEKEIPPFKFLFPNLVTILAICAGFSGIGSAIEGNYETAVCMVLVAAFLDGIDGRIARFMEATSKFGAQLDSLADVINFGVAPSLVTYIAVLRQAHAFGWSIALMYTIAISLRLARFNIMNDCDEKDNWKSEYFVGVPAPLGAILLMLPLYINFLGFKISVIYGYGSTIYAMIISFLLCSRLPVWSGKKIHRKFVLPIVLCSVAYIAFMIHFLWEMIIFSTLCYIMLLPISFYCWKKRYGIKPEQKKHKDYIK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target298 phosphatidylserine synthase [Candidatus Liberibacter as
254780600200 CDP-diacylglycerol/glycerol-3-phosphate 3-phosphat 0.019
254780841246 phosphatidylcholine synthase protein [Candidatus L 0.045
>gi|254780600|ref|YP_003065013.1| CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 200 Back     alignment
 Score = 31.2 bits (69), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 10/73 (13%)

Query: 58  PNLVT--------ILAICAGFSGIGSAIEGNYE--TAVCMVLVAAFLDGIDGRIARFMEA 107
           PN++T        ++ +C     IGS    N     A+ +  +A+  D  DG +AR    
Sbjct: 9   PNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYLARVWNQ 68

Query: 108 TSKFGAQLDSLAD 120
           TS  G  LD +AD
Sbjct: 69  TSNIGRMLDPIAD 81

>gi|254780841|ref|YP_003065254.1| phosphatidylcholine synthase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 246 Back     alignment
 Score = 30.0 bits (66), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 14/109 (12%)

Query: 90  VAAFLDGIDGRIARFMEATSKF----GAQLDSLADVINFGVAPSLVTYIAVLRQAHAFGW 145
           +A  +DG DG IAR M          G  LD++ D + + V P+   Y + L   ++ G 
Sbjct: 52  LALIIDGFDGPIARKMRVKEVLPNWSGDTLDNIIDYLTYVVLPAFALYQSNL-LGNSTGS 110

Query: 146 SIAL-MYTIAISLRLARFNIMNDCDEKDNWKSEYFVGVPAPLGAILLML 193
           S+A  M  I+ S+  A  N+  +          +F G PA    ++  L
Sbjct: 111 SVAAGMMVISSSIYYAYTNMKTE--------EHFFSGFPAVWNMVVFSL 151

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target298 phosphatidylserine synthase [Candidatus Liberibacter as
315121771273 phosphatidylserine synthase [Candidatus Liberibacter so 1 1e-111
222148098302 phosphatidylserine synthase [Agrobacterium vitis S4] Le 1 2e-75
159184598288 phosphatidylserine synthase [Agrobacterium tumefaciens 1 2e-75
15488440274 phosphatidylserine synthase [Agrobacterium sp. 31749] L 1 1e-74
325292441289 Phosphatidylserine synthase [Agrobacterium sp. H13-3] L 1 1e-74
218671624272 putative phosphatidylserine synthase [Rhizobium etli GR 1 2e-72
209548624281 CDP-diacylglycerol/serine O-phosphatidyltransferase [Rh 1 2e-72
86357048281 CDP-diacylglycerol-serine O-phosphatidyltransferase pro 1 6e-72
116251298285 phosphatidylserine synthase [Rhizobium leguminosarum bv 1 6e-72
241203911281 CDP-diacylglycerol/serine O-phosphatidyltransferase [Rh 1 8e-72
>gi|315121771|ref|YP_004062260.1| phosphatidylserine synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 273 Back     alignment and organism information
 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 207/280 (73%), Positives = 231/280 (82%), Gaps = 10/280 (3%)

Query: 14  KKKYNVLPDDFVVPSDQDEARYSFYKGKRWSLQEKEIPPFKFLFPNLVTILAICAGFSGI 73
            K+ +VL    V  S+QD          +  L  KE+PP KFLFP LVTILAICAGFSGI
Sbjct: 3   NKECDVLLKKPVASSNQD---------IKLDLPGKEMPPLKFLFPTLVTILAICAGFSGI 53

Query: 74  GSAIEGNYETAVCMVLVAAFLDGIDGRIARFMEATSKFGAQLDSLADVINFGVAPSLVTY 133
           GSA+EGN ETAV MVLVAAFLDGIDGRIAR M+ATSKFG Q+DSLADVINFGVAPSLVTY
Sbjct: 54  GSALEGNLETAVSMVLVAAFLDGIDGRIARLMKATSKFGEQMDSLADVINFGVAPSLVTY 113

Query: 134 IAVLRQAHAFGWSIALMYTIAISLRLARFNIMNDCDEKDNWKSEYFVGVPAPLGAILLML 193
           IAVL QA+ FGWSIALMYTIAISLRLARFNIMN+CD K+ WK EYFVG+PAP+GAILLML
Sbjct: 114 IAVLNQANTFGWSIALMYTIAISLRLARFNIMNECDHKEVWKDEYFVGLPAPIGAILLML 173

Query: 194 PLYINFLGFKISVIYGYGSTIYAMIISFLLCSRLPVWSGKKIHRKFVLPIVLCSVAYIAF 253
           PLYI FLGFK++ IYGY ST+YAMIISFLLCSRLPVWSGKKI RK ++P++L S AYIAF
Sbjct: 174 PLYIKFLGFKVNTIYGYTSTVYAMIISFLLCSRLPVWSGKKIPRKCIVPMILFSAAYIAF 233

Query: 254 MIHFLWEMIIFSTLCY-IMLLPISFYCWKKRYGIKPEQKK 292
           MI FLWE++I STLCY I+LLPISFY W KRYGI  +  K
Sbjct: 234 MIRFLWEVVIASTLCYIIILLPISFYSWNKRYGIIKKTPK 273


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148098|ref|YP_002549055.1| phosphatidylserine synthase [Agrobacterium vitis S4] Length = 302 Back     alignment and organism information
>gi|159184598|ref|NP_354086.2| phosphatidylserine synthase [Agrobacterium tumefaciens str. C58] Length = 288 Back     alignment and organism information
>gi|15488440|gb|AAL01116.1| phosphatidylserine synthase [Agrobacterium sp. 31749] Length = 274 Back     alignment and organism information
>gi|325292441|ref|YP_004278305.1| Phosphatidylserine synthase [Agrobacterium sp. H13-3] Length = 289 Back     alignment and organism information
>gi|218671624|ref|ZP_03521293.1| putative phosphatidylserine synthase [Rhizobium etli GR56] Length = 272 Back     alignment and organism information
>gi|209548624|ref|YP_002280541.1| CDP-diacylglycerol/serine O-phosphatidyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 281 Back     alignment and organism information
>gi|86357048|ref|YP_468940.1| CDP-diacylglycerol-serine O-phosphatidyltransferase protein [Rhizobium etli CFN 42] Length = 281 Back     alignment and organism information
>gi|116251298|ref|YP_767136.1| phosphatidylserine synthase [Rhizobium leguminosarum bv. viciae 3841] Length = 285 Back     alignment and organism information
>gi|241203911|ref|YP_002975007.1| CDP-diacylglycerol/serine O-phosphatidyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 281 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target298 phosphatidylserine synthase [Candidatus Liberibacter as
TIGR00473151 TIGR00473, pssA, CDP-diacylglycerol--serine O-phosphati 2e-21
COG0558192 COG0558, PgsA, Phosphatidylglycerophosphate synthase [L 8e-07
pfam0106696 pfam01066, CDP-OH_P_transf, CDP-alcohol phosphatidyltra 1e-12
KOG1617243 KOG1617, KOG1617, KOG1617, CDP-alcohol phosphatidyltran 2e-04
COG1183234 COG1183, PssA, Phosphatidylserine synthase [Lipid metab 1e-41
>gnl|CDD|161896 TIGR00473, pssA, CDP-diacylglycerol--serine O-phosphatidyltransferase Back     alignment and domain information
>gnl|CDD|30904 COG0558, PgsA, Phosphatidylglycerophosphate synthase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|144601 pfam01066, CDP-OH_P_transf, CDP-alcohol phosphatidyltransferase Back     alignment and domain information
>gnl|CDD|36830 KOG1617, KOG1617, KOG1617, CDP-alcohol phosphatidyltransferase/Phosphatidylglycerol-phosphate synthase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31376 COG1183, PssA, Phosphatidylserine synthase [Lipid metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 298 phosphatidylserine synthase [Candidatus Liberibacter as
COG1183234 PssA Phosphatidylserine synthase [Lipid metabolism] 100.0
TIGR00473174 pssA CDP-diacylglycerol--serine O-phosphatidyltransfera 100.0
pfam0106696 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase. Al 99.69
COG0558192 PgsA Phosphatidylglycerophosphate synthase [Lipid metab 99.63
PRK10832182 phosphatidylglycerophosphate synthetase; Provisional 99.57
KOG1617243 consensus 99.57
PTZ00307 417 ethanolamine phosphotransferase; Provisional 99.5
KOG2877389 consensus 99.49
TIGR00560217 pgsA CDP-diacylglycerol--glycerol-3-phosphate 3-phospha 99.35
COG5050384 EPT1 sn-1,2-diacylglycerol ethanolamine- and cholinepho 99.22
KOG3240218 consensus 98.98
>COG1183 PssA Phosphatidylserine synthase [Lipid metabolism] Back     alignment and domain information
>TIGR00473 pssA CDP-diacylglycerol--serine O-phosphatidyltransferase; InterPro: IPR004533 This enzyme, CDP-diacylglycerol--serine O-phosphatidyltransferase, is involved in phospholipid biosynthesis catalyzing the reaction CDP-diacylglycerol + L-serine = CMP + L-1-phosphatidylserine Back     alignment and domain information
>pfam01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase Back     alignment and domain information
>COG0558 PgsA Phosphatidylglycerophosphate synthase [Lipid metabolism] Back     alignment and domain information
>PRK10832 phosphatidylglycerophosphate synthetase; Provisional Back     alignment and domain information
>KOG1617 consensus Back     alignment and domain information
>PTZ00307 ethanolamine phosphotransferase; Provisional Back     alignment and domain information
>KOG2877 consensus Back     alignment and domain information
>TIGR00560 pgsA CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase; InterPro: IPR004570 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (2 Back     alignment and domain information
>COG5050 EPT1 sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases [Lipid metabolism] Back     alignment and domain information
>KOG3240 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00