254780582

254780582

Methyltransferase type 11

GeneID in NCBI database:8209579Locus tag:CLIBASIA_02345
Protein GI in NCBI database:254780582Protein Accession:YP_003064995.1
Gene range:+(700249, 700977)Protein Length:242aa
Gene description:Methyltransferase type 11
COG prediction:[Q] [R] SAM-dependent methyltransferases
KEGG prediction:methyltransferase type 11
SEED prediction:SAM-dependent methyltransferase 2, in cluster with Hydroxyacylglutathione hydrolase (EC 3.1.2.6)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Glutathione: Non-redox reactions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST
cccHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHcccccEEEEccHHHHHHHHHHcccccEEEEcHHHcccccccEEEEEHHHHHHccccHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHcccccccccccHHHHHHHHHHcccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEcccccccccccccccccccccccccc
ccccHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccEEEEccccccHcHHHHHHHHHHHHccccccccccccccccccEEEEcccccccccccHcEEEEHcHccccccHHHHHHHHHHHHccccEEEEEEccccccHcHHccccccccccccHHHHHHHHHHccccEcccccEEcccccccHHHHHHHHHHHHHHccccccHHHEEEEEEEEEccccccccccccccccccccccccccc
MRVDIVELRQFYSSFLGKCTTDAISKVLSttwddvtgcrllglgyaipffscfhgkvertlafmpagqgatnwpdqyfsstalvsegnlpladssvDCVLMVHYlefaedpfLMLHEIWRVLTSGGrmivvvpnkrgmwarmehtpfgsgqpysWYQMISLLREANFTLsitsrslffppthkkCILKLWSVFEKIgnifgpgfaGIYVIEARKILYqglpiteskkkhisspilvphtvst
MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPiteskkkhisspilvphtvst
MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST
*RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQ************************
MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST
*RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPIT*******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST
MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST
MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target242 Methyltransferase type 11 [Candidatus Liberibacter asia
315121774246 Methyltransferase type 11 [Candidatus Liberibacter sola 1 1e-114
241206560246 methyltransferase type 11 [Rhizobium leguminosarum bv. 1 3e-75
209551157258 methyltransferase type 11 [Rhizobium leguminosarum bv. 1 3e-75
116254074258 hypothetical protein RL4339 [Rhizobium leguminosarum bv 1 4e-75
222149970253 hypothetical protein Avi_4035 [Agrobacterium vitis S4] 1 1e-74
227823239254 putative methyltransferase [Sinorhizobium fredii NGR234 1 5e-74
190893648246 methyltransferase [Rhizobium etli CIAT 652] Length = 24 1 6e-74
159185822253 hypothetical protein Atu3613 [Agrobacterium tumefaciens 1 6e-74
327193568246 putative methyltransferase protein [Rhizobium etli CNPA 1 1e-73
222087364247 SAM-dependent methyltransferase protein [Agrobacterium 1 6e-73
>gi|315121774|ref|YP_004062263.1| Methyltransferase type 11 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 246 Back     alignment and organism information
 Score =  414 bits (1064), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 193/242 (79%), Positives = 215/242 (88%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MRVDI+ LRQFYSSFLG+   DAISKVLSTTWDD+TG RLLGLGYA+PFF CF GK E  
Sbjct: 1   MRVDIIVLRQFYSSFLGRYVRDAISKVLSTTWDDITGYRLLGLGYAVPFFPCFDGKTECN 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPAGQGATNWPDQ  SSTAL+SEG LPL DSSVDCVLM HYLEFAEDP +ML E+WR
Sbjct: 61  LAFMPAGQGATNWPDQNLSSTALISEGQLPLLDSSVDCVLMAHYLEFAEDPSVMLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+SGGRMI++VPN+RG+WARME+TPFGSGQPYSW QMISLLRE+NFTLS TSR+LFFPP
Sbjct: 121 VLSSGGRMIIIVPNRRGVWARMENTPFGSGQPYSWTQMISLLRESNFTLSSTSRALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           T+K CILKLWS+FEKIGNIF PGFAGIY IEARKILY+G+PI ES KK+IS P+LVP  +
Sbjct: 181 TNKMCILKLWSIFEKIGNIFWPGFAGIYAIEARKILYEGIPIVESSKKNISVPVLVPQAI 240

Query: 241 ST 242
           ST
Sbjct: 241 ST 242


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241206560|ref|YP_002977656.1| methyltransferase type 11 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 246 Back     alignment and organism information
>gi|209551157|ref|YP_002283074.1| methyltransferase type 11 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 258 Back     alignment and organism information
>gi|116254074|ref|YP_769912.1| hypothetical protein RL4339 [Rhizobium leguminosarum bv. viciae 3841] Length = 258 Back     alignment and organism information
>gi|222149970|ref|YP_002550927.1| hypothetical protein Avi_4035 [Agrobacterium vitis S4] Length = 253 Back     alignment and organism information
>gi|227823239|ref|YP_002827211.1| putative methyltransferase [Sinorhizobium fredii NGR234] Length = 254 Back     alignment and organism information
>gi|190893648|ref|YP_001980190.1| methyltransferase [Rhizobium etli CIAT 652] Length = 246 Back     alignment and organism information
>gi|159185822|ref|NP_356998.2| hypothetical protein Atu3613 [Agrobacterium tumefaciens str. C58] Length = 253 Back     alignment and organism information
>gi|327193568|gb|EGE60458.1| putative methyltransferase protein [Rhizobium etli CNPAF512] Length = 246 Back     alignment and organism information
>gi|222087364|ref|YP_002545901.1| SAM-dependent methyltransferase protein [Agrobacterium radiobacter K84] Length = 247 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target242 Methyltransferase type 11 [Candidatus Liberibacter asia
pfam0824195 pfam08241, Methyltransf_11, Methyltransferase domain 2e-08
PRK08317241 PRK08317, PRK08317, hypothetical protein; Provisional 2e-04
TIGR01934223 TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone biosy 0.002
COG2226238 COG2226, UbiE, Methylase involved in ubiquinone/menaqui 4e-04
>gnl|CDD|149353 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|162613 TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>gnl|CDD|32408 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 242 Methyltransferase type 11 [Candidatus Liberibacter asia
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 99.94
PRK11036256 putative metallothionein SmtA; Provisional 99.87
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 99.85
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 99.83
pfam01234261 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family. 98.63
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 98.54
PRK07402196 precorrin-6B methylase; Provisional 98.25
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 98.13
PRK10901428 16S rRNA methyltransferase B; Provisional 97.35
TIGR00091216 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; Inter 96.92
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 96.21
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.92
PRK08317241 hypothetical protein; Provisional 99.92
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 99.92
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 99.91
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 99.9
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 99.88
TIGR02072272 BioC biotin biosynthesis protein BioC; InterPro: IPR011 99.85
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 99.85
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 99.85
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 99.83
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 99.83
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 99.82
KOG1540296 consensus 99.71
KOG1270282 consensus 99.7
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 99.65
pfam08003315 Methyltransf_9 Protein of unknown function (DUF1698). T 99.64
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.64
KOG4300252 consensus 99.63
TIGR02081205 metW methionine biosynthesis protein MetW; InterPro: IP 99.62
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 99.49
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.48
pfam05219265 DREV DREV methyltransferase. This family contains DREV 99.39
pfam05148214 Methyltransf_8 Hypothetical methyltransferase. This fam 99.35
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Provisio 99.35
KOG3045325 consensus 99.28
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methylt 99.17
COG4976287 Predicted methyltransferase (contains TPR repeat) [Gene 99.17
KOG2940325 consensus 99.16
PRK06202233 hypothetical protein; Provisional 99.14
TIGR00452316 TIGR00452 methyltransferase, putative; InterPro: IPR010 99.14
PRK11207198 tellurite resistance protein TehB; Provisional 99.12
COG4106257 Tam Trans-aconitate methyltransferase [General function 99.11
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 98.95
KOG2361264 consensus 98.9
pfam03141 506 DUF248 Putative methyltransferase. Members of this fami 98.85
pfam05401201 NodS Nodulation protein S (NodS). This family consists 98.8
pfam03291327 Pox_MCEL mRNA capping enzyme. This family of enzymes ar 98.73
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 98.7
pfam06080201 DUF938 Protein of unknown function (DUF938). This famil 98.68
pfam03848192 TehB Tellurite resistance protein TehB. 98.67
KOG1269364 consensus 98.66
KOG3987288 consensus 98.66
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 98.64
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 98.59
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 98.56
pfam11968220 DUF3321 Protein of unknown function (DUF3321). This fam 98.5
COG2521287 Predicted archaeal methyltransferase [General function 98.48
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 98.41
pfam00891239 Methyltransf_2 O-methyltransferase. This family include 98.33
COG4123248 Predicted O-methyltransferase [General function predict 98.3
COG1041347 Predicted DNA modification methylase [DNA replication, 98.28
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 98.27
pfam07942268 N2227 N2227-like protein. This family features sequence 98.2
PRK12335289 tellurite resistance protein TehB; Provisional 98.16
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 98.1
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 97.93
KOG1271227 consensus 97.89
KOG2899288 consensus 97.81
pfam03269177 DUF268 Caenorhabditis protein of unknown function, DUF2 97.81
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 97.65
pfam05724203 TPMT Thiopurine S-methyltransferase (TPMT). This family 97.64
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 97.57
pfam05891217 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransfer 97.53
TIGR00740247 TIGR00740 methyltransferase, putative; InterPro: IPR005 97.51
PRK00107216 gidB glucose-inhibited division protein B; Reviewed 97.33
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 97.24
pfam12147311 Hydrolase_5 Putative lysophospholipase. This domain is 97.11
KOG3178342 consensus 97.07
pfam01269229 Fibrillarin Fibrillarin. 97.03
PTZ00146296 fibrillarin; Provisional 96.77
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU; InterPro: 96.69
COG4798238 Predicted methyltransferase [General function predictio 96.49
PRK04266226 fibrillarin; Provisional 96.48
KOG3201201 consensus 96.42
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 96.39
PRK13341726 recombination factor protein RarA/unknown domain fusion 96.16
COG1092393 Predicted SAM-dependent methyltransferases [General fun 96.16
PRK00811283 spermidine synthase; Provisional 96.13
COG2520341 Predicted methyltransferase [General function predictio 95.91
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 95.62
pfam04672268 DUF574 Protein of unknown function (DUF574). Family of 95.28
TIGR03439319 methyl_EasF probable methyltransferase domain, EasF fam 95.15
COG0357215 GidB Predicted S-adenosylmethionine-dependent methyltra 95.12
PRK10083339 putative dehydrogenase; Provisional 94.79
pfam10672286 Methyltrans_SAM S-adenosylmethionine-dependent methyltr 94.75
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 94.27
COG1189245 Predicted rRNA methylase [Translation, ribosomal struct 94.18
PRK13255218 thiopurine S-methyltransferase; Reviewed 93.9
PRK01581363 speE spermidine synthase; Validated 93.8
PRK03612516 spermidine synthase; Provisional 92.78
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 92.76
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, ribo 92.28
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 92.21
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 91.24
PRK11760356 putative RNA 2'-O-ribose methyltransferase; Provisional 90.71
PRK05785225 hypothetical protein; Provisional 99.73
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 99.7
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 99.54
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 99.5
pfam05175170 MTS Methyltransferase small domain. This domain is foun 99.06
KOG3010261 consensus 98.94
PRK06922679 hypothetical protein; Provisional 98.76
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 98.73
KOG1541270 consensus 98.71
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 98.6
KOG1331293 consensus 98.59
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 98.58
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 98.57
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 98.55
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 98.55
KOG1975389 consensus 98.38
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.27
PRK13943317 protein-L-isoaspartate O-methyltransferase; Provisional 98.24
KOG2352 482 consensus 98.22
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 98.19
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 98.17
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 98.13
COG0500257 SmtA SAM-dependent methyltransferases [Secondary metabo 98.07
pfam10294171 Methyltransf_16 Putative methyltransferase. 97.99
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 97.98
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Methylate 97.9
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 97.79
pfam09243275 Rsm22 Mitochondrial small ribosomal subunit Rsm22. Rsm2 97.79
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 97.79
TIGR00477239 tehB tellurite resistance protein TehB; InterPro: IPR00 97.76
KOG1709271 consensus 97.74
KOG1499346 consensus 97.71
pfam01739194 CheR CheR methyltransferase, SAM binding domain. CheR p 97.68
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 97.62
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 97.52
COG4122219 Predicted O-methyltransferase [General function predict 97.5
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 97.41
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 97.37
PRK11933 471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 97.33
KOG1500 517 consensus 97.27
COG5459 484 Predicted rRNA methylase [Translation, ribosomal struct 97.21
COG1352268 CheR Methylase of chemotaxis methyl-accepting proteins 97.16
TIGR00438192 rrmJ ribosomal RNA large subunit methyltransferase J; I 96.89
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 96.8
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 96.69
KOG1661237 consensus 96.59
pfam01728176 FtsJ FtsJ-like methyltransferase. This family consists 96.5
PRK00536262 speE spermidine synthase; Provisional 96.34
PRK04457262 spermidine synthase; Provisional 96.28
pfam02527184 GidB rRNA small subunit methyltransferase G. This is a 95.99
PRK11783716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 95.93
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 95.9
KOG2915314 consensus 95.77
PRK10611287 chemotaxis methyltransferase CheR; Provisional 95.63
pfam03141506 DUF248 Putative methyltransferase. Members of this fami 95.58
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal structu 95.43
PTZ00338296 dimethyladenosine transferase; Provisional 95.2
KOG1663237 consensus 95.17
COG3897218 Predicted methyltransferase [General function predictio 95.13
TIGR00138197 gidB methyltransferase GidB; InterPro: IPR003682 GidB ( 95.1
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 94.85
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 94.81
PRK09880343 L-idonate 5-dehydrogenase; Provisional 94.63
) (PCMT) (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00080">TIGR00080228 pimt protein-L-isoaspartate O-methyltransferase; InterP 94.58
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 93.68
KOG1122460 consensus 92.36
pfam08468155 MTS_N Methyltransferase small domain N-terminal. This d 92.31
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 92.24
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 91.82
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 91.77
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 91.28
PRK13771332 putative alcohol dehydrogenase; Provisional 90.56
KOG2539491 consensus 90.19
COG4627185 Uncharacterized protein conserved in bacteria [Function 98.61
KOG2798369 consensus 93.86
pfam10354166 DUF2431 Domain of unknown function (DUF2431). This is t 92.61
PRK01544503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 97.32
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associated met 97.2
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism] 97.03
TIGR03438301 probable methyltransferase. This model represents a dis 96.5
pfam08123205 DOT1 Histone methylation protein DOT1. The DOT1 domain 93.09
KOG3191209 consensus 96.96
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 96.89
KOG3420185 consensus 95.56
PRK00274267 ksgA dimethyladenosine transferase; Reviewed 95.48
smart00650169 rADc Ribosomal RNA adenine dimethylases. 95.43
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 94.18
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 94.11
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 93.21
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 92.83
TIGR00755277 ksgA dimethyladenosine transferase; InterPro: IPR011530 96.77
KOG0820315 consensus 95.64
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 95.63
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 91.87
PRK11524284 putative methyltransferase; Provisional 95.7
pfam11899376 DUF3419 Protein of unknown function (DUF3419). This fam 93.89
KOG2904328 consensus 94.5
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>pfam01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00091 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; InterPro: IPR004395 This predicted S-adenosylmethionine-dependent methyltransferase is found in a single copy in most Bacteria Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233 This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable) Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>KOG1540 consensus Back     alignment and domain information
>KOG1270 consensus Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>pfam08003 Methyltransf_9 Protein of unknown function (DUF1698) Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>KOG4300 consensus Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>pfam05219 DREV DREV methyltransferase Back     alignment and domain information
>pfam05148 Methyltransf_8 Hypothetical methyltransferase Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>KOG3045 consensus Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2940 consensus Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00452 TIGR00452 methyltransferase, putative; InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase; InterPro: IPR010251 Chlorophyll and bacteriochlorophyll are essential photosynthetic pigments involved in oxygenic and non-oxygenic photosythesis respectively Back     alignment and domain information
>KOG2361 consensus Back     alignment and domain information
>pfam03141 DUF248 Putative methyltransferase Back     alignment and domain information
>pfam05401 NodS Nodulation protein S (NodS) Back     alignment and domain information
>pfam03291 Pox_MCEL mRNA capping enzyme Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam06080 DUF938 Protein of unknown function (DUF938) Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>KOG1269 consensus Back     alignment and domain information
>KOG3987 consensus Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>pfam11968 DUF3321 Protein of unknown function (DUF3321) Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam00891 Methyltransf_2 O-methyltransferase Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>pfam07942 N2227 N2227-like protein Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>KOG1271 consensus Back     alignment and domain information
>KOG2899 consensus Back     alignment and domain information
>pfam03269 DUF268 Caenorhabditis protein of unknown function, DUF268 Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>pfam05724 TPMT Thiopurine S-methyltransferase (TPMT) Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>pfam05891 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransferase Back     alignment and domain information
>TIGR00740 TIGR00740 methyltransferase, putative; InterPro: IPR005271 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK00107 gidB glucose-inhibited division protein B; Reviewed Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam12147 Hydrolase_5 Putative lysophospholipase Back     alignment and domain information
>KOG3178 consensus Back     alignment and domain information
>pfam01269 Fibrillarin Fibrillarin Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU; InterPro: IPR014088 Members of this protein family include S-adenosylmethionine-dependent C-20 methyltransferase (BchU), part of the pathway of bacteriochlorophyll c production in photosynthetic green sulphur bacteria Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>KOG3201 consensus Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>pfam04672 DUF574 Protein of unknown function (DUF574) Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10083 putative dehydrogenase; Provisional Back     alignment and domain information
>pfam10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase Back     alignment and domain information
>pfam01564 Spermine_synth Spermine/spermidine synthase Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L-threonine 3-dehydrogenase (1 Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; InterPro: IPR001566 This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family Back     alignment and domain information
>PRK11760 putative RNA 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>pfam08242 Methyltransf_12 Methyltransferase domain Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>KOG3010 consensus Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG1541 consensus Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>KOG1331 consensus Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>KOG1975 consensus Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG2352 consensus Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>pfam10294 Methyltransf_16 Putative methyltransferase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>pfam09243 Rsm22 Mitochondrial small ribosomal subunit Rsm22 Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB; InterPro: IPR004537 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>KOG1709 consensus Back     alignment and domain information
>KOG1499 consensus Back     alignment and domain information
>pfam01739 CheR CheR methyltransferase, SAM binding domain Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>pfam01596 Methyltransf_3 O-methyltransferase Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>KOG1500 consensus Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00438 rrmJ ribosomal RNA large subunit methyltransferase J; InterPro: IPR004512 The ribosomal RNA large subunit methyltransferase J 2 Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>KOG1661 consensus Back     alignment and domain information
>pfam01728 FtsJ FtsJ-like methyltransferase Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>pfam02527 GidB rRNA small subunit methyltransferase G Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2915 consensus Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>pfam03141 DUF248 Putative methyltransferase Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase; Provisional Back     alignment and domain information
>KOG1663 consensus Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00138 gidB methyltransferase GidB; InterPro: IPR003682 GidB (glucose-inhibited division protein B) appears to be present and in a single copy in all complete eubacterial genomes so far Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate O-methyltransferase; InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>KOG1122 consensus Back     alignment and domain information
>pfam08468 MTS_N Methyltransferase small domain N-terminal Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>KOG2539 consensus Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2798 consensus Back     alignment and domain information
>pfam10354 DUF2431 Domain of unknown function (DUF2431) Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>pfam08123 DOT1 Histone methylation protein DOT1 Back     alignment and domain information
>KOG3191 consensus Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3420 consensus Back     alignment and domain information
>PRK00274 ksgA dimethyladenosine transferase; Reviewed Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase; InterPro: IPR011530 This family of proteins represent the rRNA adenine dimethylases (e Back     alignment and domain information
>KOG0820 consensus Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>pfam11899 DUF3419 Protein of unknown function (DUF3419) Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target242 Methyltransferase type 11 [Candidatus Liberibacter asia
2gs9_A211 Crystal Structure Of Tt1324 From Thermus Thermophil 2e-14
1vlm_A219 Crystal Structure Of Sam-Dependent Methyltransferas 4e-12
3dli_A240 Crystal Structure Of A Sam Dependent Methyltransfer 2e-07
3g5l_A253 Crystal Structure Of Putative S-Adenosylmethionine 5e-07
3ege_A261 Crystal Structure Of Putative Methyltransferase Fro 9e-06
1p91_A269 Crystal Structure Of Rlma(I) Enzyme: 23s Rrna N1-G7 5e-05
2avn_A260 Crystal Structure Of A UbiquinoneMENAQUINONE BIOSYN 8e-10
3bkw_A243 Crystal Structure Of S-Adenosylmethionine Dependent 9e-09
3bus_A273 Crystal Structure Of Rebm Length = 273 2e-08
3ccf_A279 Crystal Structure Of Putative Methyltransferase (Yp 2e-04
3mgg_A276 Crystal Structure Of Methyl Transferase From Methan 2e-07
1xxl_A239 The Crystal Structure Of Ycgj Protein From Bacillus 2e-05
3cc8_A230 Crystal Structure Of A Putative Methyltransferase ( 2e-06
3l8d_A242 Crystal Structure Of Methyltransferase From Bacillu 1e-04
>gi|145579455|pdb|2GS9|A Chain A, Crystal Structure Of Tt1324 From Thermus Thermophilis Hb8 Length = 211 Back     alignment and structure
 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/205 (18%), Positives = 60/205 (29%), Gaps = 7/205 (3%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
                 +Y + LG        + L        G  LL +G    ++       ++     
Sbjct: 7   AEAYEAWYGTPLGAYVIAEEERALKGLLP--PGESLLEVGAGTGYWLRRLPYPQKV-GVE 63

Query: 65  PAGQGATNWPDQ-YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
           P+         +   ++        LP    S D VL+   LEF ED   +L E  RVL 
Sbjct: 64  PSEAXLAVGRRRAPEATWVRAWGEALPFPGESFDVVLLFTTLEFVEDVERVLLEARRVLR 123

Query: 124 SGGRMIVVVPNKRGMWARMEHTPFGSGQPYS---WYQMISLLREANFTLSITSRSLFFPP 180
            GG ++V V      WA +       G        +     L+           ++F  P
Sbjct: 124 PGGALVVGVLEALSPWAALYRRLGEKGVLPWAQARFLAREDLKALLGPPEAEGEAVFLAP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFA 205
                  +      + GN       
Sbjct: 184 EAHPPYEEADLAGRRAGNRPALYLG 208


>gi|52696211|pdb|1VLM|A Chain A, Crystal Structure Of Sam-Dependent Methyltransferase, Possible Histamine N-Methyltransferase (Tm1293) From Thermotoga Maritima At 2.20 A Resolution Length = 219 Back     alignment and structure
>gi|194320120|pdb|3DLI|A Chain A, Crystal Structure Of A Sam Dependent Methyltransferase From Archaeoglobus Fulgidus Length = 240 Back     alignment and structure
>gi|223674113|pdb|3G5L|A Chain A, Crystal Structure Of Putative S-Adenosylmethionine Dependent Methyltransferase From Listeria Monocytogenes Length = 253 Back     alignment and structure
>gi|209447527|pdb|3EGE|A Chain A, Crystal Structure Of Putative Methyltransferase From Antibiotic Biosynthesis Pathway (Yp_324569.1) From Anabaena Variabilis Atcc 29413 At 2.40 A Resolution Length = 261 Back     alignment and structure
>gi|47168536|pdb|1P91|A Chain A, Crystal Structure Of Rlma(I) Enzyme: 23s Rrna N1-G745 Methyltransferase (Northeast Structural Genomics Consortium Target Er19) Length = 269 Back     alignment and structure
>gi|82407927|pdb|2AVN|A Chain A, Crystal Structure Of A UbiquinoneMENAQUINONE BIOSYNTHESIS Methyltransferase-Related Protein (Tm1389) From Thermotoga Maritima Msb8 At 2.35 A Resolution Length = 260 Back     alignment and structure
>gi|163311152|pdb|3BKW|A Chain A, Crystal Structure Of S-Adenosylmethionine Dependent Methyltransferase (Np_104914.1) From Mesorhizobium Loti At 1.60 A Resolution Length = 243 Back     alignment and structure
>gi|170785178|pdb|3BUS|A Chain A, Crystal Structure Of Rebm Length = 273 Back     alignment and structure
>gi|169791898|pdb|3CCF|A Chain A, Crystal Structure Of Putative Methyltransferase (Yp_321342.1) From Anabaena Variabilis Atcc 29413 At 1.90 A Resolution Length = 279 Back     alignment and structure
>gi|294979860|pdb|3MGG|A Chain A, Crystal Structure Of Methyl Transferase From Methanosarcina Mazei Length = 276 Back     alignment and structure
>gi|56967300|pdb|1XXL|A Chain A, The Crystal Structure Of Ycgj Protein From Bacillus Subitilis At 2.1 A Resolution Length = 239 Back     alignment and structure
>gi|169404774|pdb|3CC8|A Chain A, Crystal Structure Of A Putative Methyltransferase (Bce_1332) From Bacillus Cereus Atcc 10987 At 1.64 A Resolution Length = 230 Back     alignment and structure
>gi|283807281|pdb|3L8D|A Chain A, Crystal Structure Of Methyltransferase From Bacillus Thuringiensis Length = 242 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target242 Methyltransferase type 11 [Candidatus Liberibacter asia
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgrc, pr 9e-12
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein structure i 1e-07
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F21; 2 5e-07
3i9f_A170 Putative type 11 methyltransferase; structural genomics 4e-06
2p7i_A250 Hypothetical protein; structural genomics, joint center 4e-05
1vlm_A219 SAM-dependent methyltransferase; possible histamine N-m 5e-05
2yui_A182 Anamorsin; cytokine-induced apoptosis inhibitor 1, ciap 5e-05
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural genomics 1e-09
2gs9_A211 Hypothetical protein TT1324; methyl transferase, struct 2e-08
2aot_A292 HMT, histamine N-methyltransferase; classic methyltrans 6e-07
3dh0_A219 SAM dependent methyltransferase; cystal structure, PSI- 1e-06
2kw5_A202 SLR1183 protein; structural genomics, northeast structu 6e-06
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmethionin 3e-05
1p91_A269 Ribosomal RNA large subunit methyltransferase A; RLMA, 6e-05
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransferase, S 1e-04
3gu3_A284 Methyltransferase; alpha-beta protein, structural genom 1e-04
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl methioni 2e-04
1nkv_A256 Hypothetical protein YJHP; structural genomics, PSI, pr 3e-04
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, structu 4e-04
3m33_A226 Uncharacterized protein; structural genomics, PSI-2, pr 5e-04
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protein, st 8e-04
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methyltransf 0.001
3p2e_A225 16S rRNA methylase; methyltransferase, transferase, NPM 0.001
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycloprop 0.002