254780585

254780585

molecular chaperone DnaJ family protein

GeneID in NCBI database:8209582Locus tag:CLIBASIA_02360
Protein GI in NCBI database:254780585Protein Accession:YP_003064998.1
Gene range:+(697932, 698507)Protein Length:191aa
Gene description:molecular chaperone DnaJ family protein
COG prediction:[O] DnaJ-class molecular chaperone
KEGG prediction:dnaJ; molecular chaperone DnaJ family protein
SEED prediction:FIG003437: hypothetical with DnaJ-like domain
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MKLDSKYFDRIRTRKKRKKNAPSPKSSICQWDNCQCIGEYRAPVGSGAEEQFFLFCLDHVKKYNKGYNYFLGLSDDEVGRYQKEGVTGERFTWTAHLYAERYPSNSSFFQDHRSSYGHFADRPDHRVGSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDRGSEERFQAVIQAYKILKKSGFC
ccccccccccEEEcccccccHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHcccHHccccHHHHHHHHHHccccccHHHcccHHHHHHHHHHcccHHHHHHHHHHcccHHHccccccccHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccc
cccccccccHEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccHHcccccHHHHcccccccccccccHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccc
MKLDSKYFDRIRTRkkrkknapspkssicqwdncqcigeyrapvgsgaeEQFFLFCLDHVKkynkgynyflglsddevgryqkegvtgerfTWTAHLYaerypsnssffqdhrssyghfadrpdhrvgsmqFNAFEILGllsdsspeeIRGRYKDLVKkhhpdanggdrgsEERFQAVIQAYKILKKSGFC
mkldskyfdrirtrkkrkknapspkssicqwdncqCIGEYRAPVGSGAEEQFFLFCLDHVKKYNKGYNYFLGLSDDEVGRYQKEGVTGERFTWTAHLYAERYPSNSSFFQDHRSSYGHFADRPDHRVGSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHpdanggdrgseeRFQAVIQAYKILKKSGFC
MKLDSKYFDRIRTRKKRKKNAPSPKSSICQWDNCQCIGEYRAPVGSGAEEQFFLFCLDHVKKYNKGYNYFLGLSDDEVGRYQKEGVTGERFTWTAHLYAERYPSNSSFFQDHRSSYGHFADRPDHRVGSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDRGSEERFQAVIQAYKILKKSGFC
***DSKY*************************NCQCIGEYRAPVGSGAEEQFFLFCLDHVKKYNKGYNYFLGLSDDEVGRYQKEG*TGE********************Q************************FEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDRGSEERFQAVIQAYKILKKSGFC
MKLDSKYFDRIRT**************ICQWDNCQCIGEYRAPVGSGAEEQFFLFCLDHVKKYNKGYNYFLGLSDDEVGRYQKEGVTGERFTWTAHLYAERYPSNSSFFQDHRSSYGHFADRPDHRVGSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDRGSEERFQAVIQAYKILKKSGFC
****SKYFDRIRTRKK**********SICQWDNCQCIGEYRAPVGSGAEEQFFLFCLDHVKKYNKGYNYFLGLSDDEVGRYQKEGVTGERFTWTAHLYAERYPSNSSFFQDHRSSYGHFADRPDHRVGSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDRGSEERFQAVIQAYKILKKSGFC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLDSKYFDRIRTRKKRKKNAPSPKSSICQWDNCQCIGEYRAPVGSGAEEQFFLFCLDHVKKYNKGYNYFLGLSDDEVGRYQKEGVTGERFTWTAHLYAERYPSNSSFFQDHRSSYGHFADRPDHRVGSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDRGSEERFQAVIQAYKILKKSGFC
MKLDSKYFDRIRTRKKRKKNAPSPKSSICQWDNCQCIGEYRAPVGSGAEEQFFLFCLDHVKKYNKGYNYFLGLSDDEVGRYQKEGVTGERFTWTAHLYAERYPSNSSFFQDHRSSYGHFADRPDHRVGSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDRGSEERFQAVIQAYKILKKSGFC
MKLDSKYFDRIRTRKKRKKNAPSPKSSICQWDNCQCIGEYRAPVGSGAEEQFFLFCLDHVKKYNKGYNYFLGLSDDEVGRYQKEGVTGERFTWTAHLYAERYPSNSSFFQDHRSSYGHFADRPDHRVGSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDRGSEERFQAVIQAYKILKKSGFC

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target191 molecular chaperone DnaJ family protein [Candidatus Lib
254780638 384 molecular chaperone protein DnaJ [Candidatus Liber 2e-05
>gi|254780638|ref|YP_003065051.1| molecular chaperone protein DnaJ [Candidatus Liberibacter asiaticus str. psy62] Length = 384 Back     alignment
 Score = 40.4 bits (93), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 35/52 (67%)

Query: 135 FEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDRGSEERFQAVIQAYKILK 186
           +++LG+  +++  +++  ++ L  K+HPD N  D  ++E+F  + +AY++L+
Sbjct: 7   YQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLR 58

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target191 molecular chaperone DnaJ family protein [Candidatus Lib
315121777191 molecular chaperone DnaJ family protein [Candidatus Lib 1 6e-85
163759943205 putative DNAJ chaperone family protein [Hoeflea phototr 1 3e-54
227823249212 putative DNAJ chaperone family protein [Sinorhizobium f 1 2e-53
222149981223 molecular chaperone DnaJ family [Agrobacterium vitis S4 1 4e-53
327188708205 molecular chaperone protein DnaJ [Rhizobium etli CNPAF5 1 1e-52
86359405269 DnaJ family molecular chaperone [Rhizobium etli CFN 42] 1 1e-52
190893660269 molecular chaperone protein DnaJ [Rhizobium etli CIAT 6 1 1e-52
116254083205 DNAJ chaperone family protein [Rhizobium leguminosarum 1 2e-52
209551168205 heat shock protein DnaJ domain protein [Rhizobium legum 1 6e-52
241206571205 heat shock protein DnaJ domain protein [Rhizobium legum 1 9e-52
>gi|315121777|ref|YP_004062266.1| molecular chaperone DnaJ family protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 191 Back     alignment and organism information
 Score =  317 bits (812), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 177/191 (92%)

Query: 1   MKLDSKYFDRIRTRKKRKKNAPSPKSSICQWDNCQCIGEYRAPVGSGAEEQFFLFCLDHV 60
           M L+SKYFDRIR RKKRKKN PSPKSSICQWDNCQC GEYRAPVGSGAE+ FFLFCL+HV
Sbjct: 1   MNLNSKYFDRIRNRKKRKKNDPSPKSSICQWDNCQCTGEYRAPVGSGAEDNFFLFCLEHV 60

Query: 61  KKYNKGYNYFLGLSDDEVGRYQKEGVTGERFTWTAHLYAERYPSNSSFFQDHRSSYGHFA 120
           KKYNKGYNYF+GLSDDEVGRYQKE V GERFTWTA LYA+RYPS+  FFQ+ ++SYG+F+
Sbjct: 61  KKYNKGYNYFVGLSDDEVGRYQKEAVAGERFTWTALLYAKRYPSDVFFFQESKNSYGNFS 120

Query: 121 DRPDHRVGSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDRGSEERFQAVIQ 180
           DR +HR+ ++QFNAFEILGLLSDSSPEEIRGRYK+LVKKHHPD+NGGDRG+EE FQAV+Q
Sbjct: 121 DRAEHRLNAIQFNAFEILGLLSDSSPEEIRGRYKNLVKKHHPDSNGGDRGTEEHFQAVVQ 180

Query: 181 AYKILKKSGFC 191
           AY++LK+SGFC
Sbjct: 181 AYRVLKQSGFC 191


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163759943|ref|ZP_02167027.1| putative DNAJ chaperone family protein [Hoeflea phototrophica DFL-43] Length = 205 Back     alignment and organism information
>gi|227823249|ref|YP_002827221.1| putative DNAJ chaperone family protein [Sinorhizobium fredii NGR234] Length = 212 Back     alignment and organism information
>gi|222149981|ref|YP_002550938.1| molecular chaperone DnaJ family [Agrobacterium vitis S4] Length = 223 Back     alignment and organism information
>gi|327188708|gb|EGE55907.1| molecular chaperone protein DnaJ [Rhizobium etli CNPAF512] Length = 205 Back     alignment and organism information
>gi|86359405|ref|YP_471297.1| DnaJ family molecular chaperone [Rhizobium etli CFN 42] Length = 269 Back     alignment and organism information
>gi|190893660|ref|YP_001980202.1| molecular chaperone protein DnaJ [Rhizobium etli CIAT 652] Length = 269 Back     alignment and organism information
>gi|116254083|ref|YP_769921.1| DNAJ chaperone family protein [Rhizobium leguminosarum bv. viciae 3841] Length = 205 Back     alignment and organism information
>gi|209551168|ref|YP_002283085.1| heat shock protein DnaJ domain protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 205 Back     alignment and organism information
>gi|241206571|ref|YP_002977667.1| heat shock protein DnaJ domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 205 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target191 molecular chaperone DnaJ family protein [Candidatus Lib
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-11
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homology dom 2e-11
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with C-te 5e-11
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provisional 9e-10
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provisional 2e-09
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provisional 3e-09
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provisional 5e-09
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provisional 6e-09
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 8e-09
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provisional 1e-08
KOG0721230 KOG0721, KOG0721, KOG0721, Molecular chaperone (DnaJ su 2e-08
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provisional 3e-08
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provisional 4e-08
KOG0716 279 KOG0716, KOG0716, KOG0716, Molecular chaperone (DnaJ su 1e-07
KOG0713 336 KOG0713, KOG0713, KOG0713, Molecular chaperone (DnaJ su 3e-07
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provisional 3e-07
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provisional 3e-07
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provisional 5e-07
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provisional 5e-07
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provisional 5e-07
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provisional 6e-07
KOG0715 288 KOG0715, KOG0715, KOG0715, Molecular chaperone (DnaJ su 9e-07
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provisional 1e-06
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provisional 1e-06
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provisional 2e-06
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provisional 2e-06
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provisional 2e-06
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provisional 3e-06
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provisional 4e-06
KOG0691 296 KOG0691, KOG0691, KOG0691, Molecular chaperone (DnaJ su 6e-06
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provisional 1e-05
KOG0712 337 KOG0712, KOG0712, KOG0712, Molecular chaperone (DnaJ su 2e-05
COG2214 237 COG2214, CbpA, DnaJ-class molecular chaperone [Posttran 3e-05
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provision 3e-05
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provisional 4e-05
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provisional 4e-05
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provisional 6e-05
KOG0722 329 KOG0722, KOG0722, KOG0722, Molecular chaperone (DnaJ su 8e-05
KOG0717 508 KOG0717, KOG0717, KOG0717, Molecular chaperone (DnaJ su 1e-04
KOG0568 342 KOG0568, KOG0568, KOG0568, Molecular chaperone (DnaJ su 2e-04
KOG0720 490 KOG0720, KOG0720, KOG0720, Molecular chaperone (DnaJ su 3e-04
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provisional 4e-04
KOG0719 264 KOG0719, KOG0719, KOG0719, Molecular chaperone (DnaJ su 5e-04
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle assembly 7e-04
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provisional 8e-04
KOG1150 250 KOG1150, KOG1150, KOG1150, Predicted molecular chaperon 0.001
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec63 [I 0.001
KOG1789 2235 KOG1789, KOG1789, KOG1789, Endocytosis protein RME-8, c 0.002
KOG0550486 KOG0550, KOG0550, KOG0550, Molecular chaperone (DnaJ su 0.002
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein CbpA; Pr 0.002
KOG0718 546 KOG0718, KOG0718, KOG0718, Molecular chaperone (DnaJ su 0.003
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 5e-12
>gnl|CDD|143981 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|128567 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|30832 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184601 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182712 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184610 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172782 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|162815 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|184605 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|35940 KOG0721, KOG0721, KOG0721, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|35935 KOG0716, KOG0716, KOG0716, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35932 KOG0713, KOG0713, KOG0713, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184609 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172769 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184607 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|35934 KOG0715, KOG0715, KOG0715, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172777 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172789 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184602 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184598 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184613 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|35910 KOG0691, KOG0691, KOG0691, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184608 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|35931 KOG0712, KOG0712, KOG0712, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|32396 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|173334 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|184600 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172784 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|35941 KOG0722, KOG0722, KOG0722, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35936 KOG0717, KOG0717, KOG0717, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35788 KOG0568, KOG0568, KOG0568, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35939 KOG0720, KOG0720, KOG0720, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184606 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|35938 KOG0719, KOG0719, KOG0719, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163547 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|36365 KOG1150, KOG1150, KOG1150, Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|34966 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|37000 KOG1789, KOG1789, KOG1789, Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35770 KOG0550, KOG0550, KOG0550, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|35937 KOG0718, KOG0718, KOG0718, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 191 molecular chaperone DnaJ family protein [Candidatus Lib
PRK10767 376 chaperone protein DnaJ; Provisional 99.72
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-terminal Zn 99.69
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.66
PTZ00037 422 DnaJ_C chaperone protein; Provisional 99.62
KOG0713 336 consensus 99.58
PRK09430269 djlA Dna-J like membrane chaperone protein; Provisional 99.46
KOG0712 337 consensus 99.39
KOG0716 279 consensus 99.39
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat shock pr 99.37
pfam0022663 DnaJ DnaJ domain. DnaJ domains (J-domains) are associat 99.37
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.32
KOG0715 288 consensus 99.32
KOG0691 296 consensus 99.29
KOG0717 508 consensus 99.27
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslational 99.14
KOG0721230 consensus 99.14
KOG0719 264 consensus 98.97
KOG0718 546 consensus 98.93
KOG0722 329 consensus 98.84
KOG0720 490 consensus 98.82
KOG0550486 consensus 98.81
PTZ00100114 DnaJ chaperone protein; Provisional 98.81
KOG0714 306 consensus 98.57
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intracellul 98.57
KOG1150 250 consensus 98.52
KOG0568 342 consensus 98.46
KOG0624504 consensus 98.4
PRK01356166 hscB co-chaperone HscB; Provisional 98.36
KOG1789 2235 consensus 98.34
PRK05014 171 hscB co-chaperone HscB; Provisional 98.28
PRK00294 173 hscB co-chaperone HscB; Provisional 98.25
PRK01773 173 hscB co-chaperone HscB; Provisional 98.22
PRK03578 176 hscB co-chaperone HscB; Provisional 98.21
KOG0723112 consensus 98.02
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Translation, 97.48
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttranslation 97.35
TIGR02349 386 DnaJ_bact chaperone protein DnaJ; InterPro: IPR012724 M 96.5
KOG0431453 consensus 96.35
COG1076 174 DjlA DnaJ-domain-containing proteins 1 [Posttranslation 93.59
pfam03656127 Pam16 Pam16. The Pam16 protein is the fifth essential s 92.6
KOG3192168 consensus 92.29
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>KOG0713 consensus Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG0712 consensus Back     alignment and domain information
>KOG0716 consensus Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>pfam00226 DnaJ DnaJ domain Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0715 consensus Back     alignment and domain information
>KOG0691 consensus Back     alignment and domain information
>KOG0717 consensus Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0721 consensus Back     alignment and domain information
>KOG0719 consensus Back     alignment and domain information
>KOG0718 consensus Back     alignment and domain information
>KOG0722 consensus Back     alignment and domain information
>KOG0720 consensus Back     alignment and domain information
>KOG0550 consensus Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0714 consensus Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1150 consensus Back     alignment and domain information
>KOG0568 consensus Back     alignment and domain information
>KOG0624 consensus Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG1789 consensus Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0723 consensus Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ; InterPro: IPR012724 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>KOG0431 consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam03656 Pam16 Pam16 Back     alignment and domain information
>KOG3192 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target191 molecular chaperone DnaJ family protein [Candidatus Lib
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 5e-14
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 6e-14
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 8e-14
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 3e-13
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-12
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 2e-12
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 2e-12
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 2e-12
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 4e-12
3lz8_A 329 Structure Of A Putative Chaperone Dnaj From Klebsie 4e-11
3apq_A 210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 4e-11
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 5e-11
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 6e-11
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 7e-11
2och_A73 J-Domain Of Dnj-12 From Caenorhabditis Elegans Leng 2e-09
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 7e-09
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 8e-09
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 6e-08
>gi|159163954|pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
 Score = 81.7 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 15/66 (22%), Positives = 36/66 (54%)

Query: 123 PDHRVGSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDRGSEERFQAVIQAY 182
               + +   + + +LGL  +++ ++I+  Y+ L  K+HPD N  +  + ++F+ +  A+
Sbjct: 8   RQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAH 67

Query: 183 KILKKS 188
            IL  +
Sbjct: 68  AILTDA 73


>gi|157834231|pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>gi|157830433|pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>gi|159163963|pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>gi|159162127|pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>gi|159164245|pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>gi|159164236|pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>gi|159164396|pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>gi|329665912|pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>gi|291463722|pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>gi|329665913|pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>gi|157831304|pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>gi|159163951|pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>gi|159163949|pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>gi|126031509|pdb|2OCH|A Chain A, J-Domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>gi|122921354|pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>gi|159164851|pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>gi|294979280|pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target191 molecular chaperone DnaJ family protein [Candidatus Lib
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structural ge 5e-10
3lz8_A 329 Putative chaperone DNAJ; structure genomics, structural 5e-09
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; chaperon 5e-09
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain, AN 6e-09
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapi 4e-08
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR {Bos t 4e-08
1faf_A79 Large T antigen; J domain, HPD motif, anti-parallel hai 2e-06
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chaperone 3e-06
2guz_A71 Mitochondrial import inner membrane translocase subunit 3e-06
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydr 2e-05
1fpo_A 171 HSC20, chaperone protein HSCB; molecular chaperone; 1.8 2e-05
3hho_A 174 CO-chaperone protein HSCB homolog; structural genomics, 4e-05
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein, str 6e-05
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein folding, DN 1e-04
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural genomic 2e-04
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, antitum 2e-04
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precursor; str 3e-04
2guz_B65 Mitochondrial import inner membrane translocase subunit 4e-04
2yua_A99 Williams-beuren syndrome chromosome region 18 protein; 6e-04
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national 0.002
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, stru 0.002
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
 Score = 59.4 bits (144), Expect = 5e-10
 Identities = 13/61 (21%), Positives = 23/61 (37%), Gaps = 1/61 (1%)

Query: 128 GSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDR-GSEERFQAVIQAYKILK 186
           GS+      ++         E +   + L  K HPD N  +   + E F+ +      L+
Sbjct: 12  GSILKEVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRLE 71

Query: 187 K 187
           K
Sbjct: 72  K 72


>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein structure initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphorylation; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, PSI-2, protein structure initiative; 1.86A {Caenorhabditis elegans} Length = 73 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulator/viral protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3hho_A CO-chaperone protein HSCB homolog; structural genomics, IDP01304, center for structural genomics of infectious diseases, CSGI; 2.15A {Vibrio cholerae} Length = 174 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precursor; structural genomics medical relevance, protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 65 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target191 molecular chaperone DnaJ family protein [Candidatus Lib
3lz8_A 329 Putative chaperone DNAJ; structure genomics, structural 99.6
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chaperone 99.44
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structural ge 99.4
2yua_A99 Williams-beuren syndrome chromosome region 18 protein; 99.39
1fpo_A 171 HSC20, chaperone protein HSCB; molecular chaperone; 1.8 99.39
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein folding, DN 99.37
3hho_A 174 CO-chaperone protein HSCB homolog; structural genomics, 99.37
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chaperone, 99.36
2guz_A71 Mitochondrial import inner membrane translocase subunit 99.33
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, struct 99.31
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, antitum 99.31
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, stru 99.31
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precursor; str 99.28
1faf_A79 Large T antigen; J domain, HPD motif, anti-parallel hai 99.25
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein, str 99.22
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural genomic 99.19
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chaperone, 99.18
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, helix 99.18
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, 99.17
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national 99.17
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain, AN 99.12
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapi 99.11
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chaperone 99.11
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydr 99.11
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; chaperon 99.09
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chaperone 99.0
2guz_B65 Mitochondrial import inner membrane translocase subunit 98.98
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR {Bos t 98.94
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, RAS- 97.79
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein structure initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
Probab=99.60  E-value=5.5e-17  Score=130.76  Aligned_cols=61  Identities=25%  Similarity=0.481  Sum_probs=54.7

Q ss_pred             CCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             88889769986177732889999999999999965788997987999999999999999962
Q gi|254780585|r  127 VGSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDRGSEERFQAVIQAYKILKKS  188 (191)
Q Consensus       127 ~~~~~~~Al~~Lgl~~~~~~~~ik~~yk~lvk~~HPD~n~g~~~~ee~~~~I~~Ay~~Lk~S  188 (191)
                      .+...++.|+||||+++||.+|||++||+|+++||||+|++ ..||++|++|++||++|...
T Consensus        23 ~~m~~kDyY~iLGV~~~AS~~EIKkAYRkLA~k~HPDkn~~-~~AeekFkeI~eAYevLsD~   83 (329)
T 3lz8_A           23 NAMELKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKE-NDAEAKFKDLAEAWEVLKDE   83 (329)
T ss_dssp             --------------------------------------------------------------
T ss_pred             CCCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCC-CCHHHHHHHHHHHHHHHCCH
T ss_conf             76664777898099999799999999999999868898979-46999999999999721034



>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>3hho_A CO-chaperone protein HSCB homolog; structural genomics, IDP01304, center for structural genomics of infectious diseases, CSGI; 2.15A {Vibrio cholerae} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, protein structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precursor; structural genomics medical relevance, protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulator/viral protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphorylation; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, PSI-2, protein structure initiative; 1.86A {Caenorhabditis elegans} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 191 molecular chaperone DnaJ family protein [Candidatus Lib
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 1e-06
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Esc 5e-06
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo 5e-06
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 4e-05
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {E 3e-04
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J domain { 3e-04
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} 0.002
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 46.9 bits (111), Expect = 1e-06
 Identities = 13/66 (19%), Positives = 27/66 (40%), Gaps = 3/66 (4%)

Query: 125 HRVGSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDR---GSEERFQAVIQA 181
           H V       ++ +G+    +PE+++  Y+  V   HPD   G      ++  F  +  A
Sbjct: 26  HTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDA 85

Query: 182 YKILKK 187
           +   + 
Sbjct: 86  WSEFEN 91


>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target191 molecular chaperone DnaJ family protein [Candidatus Lib
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens) [Ta 99.39
d1fafa_79 Large T antigen, the N-terminal J domain {Murine polyom 99.33
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia coli 99.31
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian virus 99.29
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domain pro 99.25
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.06
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.02
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [ 98.97
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Hypothetical protein KIAA0730
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.39  E-value=2.7e-13  Score=105.08  Aligned_cols=61  Identities=21%  Similarity=0.237  Sum_probs=55.0

Q ss_pred             CHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCH-HHHHHHHHHHHHHHHHHHC
Q ss_conf             888976998617773288999999999999996578899798-7999999999999999962
Q gi|254780585|r  128 GSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDR-GSEERFQAVIQAYKILKKS  188 (191)
Q Consensus       128 ~~~~~~Al~~Lgl~~~~~~~~ik~~yk~lvk~~HPD~n~g~~-~~ee~~~~I~~Ay~~Lk~S  188 (191)
                      ....+++|+||||.+++|.++||++|++|+++||||+|+++. .++++|+.|++||++|++-
T Consensus        12 ~~~~~~~y~iL~v~~~as~~eIKkAYrrl~~~~HPDk~~~~~~~a~~~f~~i~~Ay~~L~~~   73 (88)
T d1iura_          12 GSILKEVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRLEKQ   73 (88)
T ss_dssp             SSCHHHHHHHHHHTTSSCSHHHHHHHHHHHHHTCTTTSSSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             03799999995998898999999999999998650014100268999999999999999889



>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 191 molecular chaperone DnaJ family protein [Candidatu
2qwo_B_92 (B:) Putative tyrosine-protein phosphatase auxilin 6e-09
2guz_B_65 (B:) Mitochondrial import inner membrane transloca 9e-08
1iur_A_88 (A:) KIAA0730 protein; DNAJ like domain, riken str 1e-07
3hho_A_1-8585 (A:1-85) CO-chaperone protein HSCB homolog; struct 2e-06
2guz_A_71 (A:) Mitochondrial import inner membrane transloca 8e-06
2yua_A_99 (A:) Williams-beuren syndrome chromosome region 18 9e-06
2o37_A_92 (A:) Protein SIS1; HSP40, J-domain, cochaperone, A 2e-05
1fpo_A_1-8181 (A:1-81) HSC20, chaperone protein HSCB; molecular 2e-05
2och_A_73 (A:) Hypothetical protein DNJ-12; HSP40, J-domain, 3e-05
2ys8_A_90 (A:) RAB-related GTP-binding protein RABJ; DNAJ do 3e-05
2dn9_A_79 (A:) DNAJ homolog subfamily A member 3; J-domain, 3e-05
2ctr_A_88 (A:) DNAJ homolog subfamily B member 9; J-domain, 3e-05
2cug_A_88 (A:) Mkiaa0962 protein; DNAJ-like domain, structur 6e-05
1hdj_A_77 (A:) Human HSP40, HDJ-1; molecular chaperone; NMR 8e-05
3bvo_A_1-124124 (A:1-124) CO-chaperone protein HSCB, mitochondrial 8e-05
2ctq_A_112 (A:) DNAJ homolog subfamily C member 12; J-domain, 1e-04
1wjz_A_94 (A:) 1700030A21RIK protein; J-domain, DNAJ like pr 2e-04
2ctp_A_78 (A:) DNAJ homolog subfamily B member 12; J-domain, 4e-04
1faf_A_79 (A:) Large T antigen; J domain, HPD motif, anti-pa 4e-04
2dmx_A_92 (A:) DNAJ homolog subfamily B member 8; DNAJ J dom 5e-04
2ej7_A_82 (A:) HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, 6e-04
1gh6_A_1-7474 (A:1-74) Large T antigen; tumor suppressor, oncopr 0.004
1n4c_A_182 (A:) Auxilin; four helix bundle, protein binding; 1e-07
>2qwo_B (B:) Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphorylation; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_ALength = 92 Back     alignment and structure
 Score = 54.9 bits (132), Expect = 6e-09
 Identities = 10/57 (17%), Positives = 25/57 (43%), Gaps = 3/57 (5%)

Query: 133 NAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGD---RGSEERFQAVIQAYKILK 186
             ++ +G+    +PE+++  Y+  V   HP    G    + ++  F  +  A+   +
Sbjct: 34  TKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFE 90


>2guz_B (B:) Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae}Length = 65 Back     alignment and structure
>1iur_A (A:) KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens}Length = 88 Back     alignment and structure
>3hho_A (A:1-85) CO-chaperone protein HSCB homolog; structural genomics, IDP01304, center for structural genomics of infectious diseases, CSGI; 2.15A {Vibrio cholerae}Length = 85 Back     alignment and structure
>2guz_A (A:) Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae}Length = 71 Back     alignment and structure
>2yua_A (A:) Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens}Length = 99 Back     alignment and structure
>2o37_A (A:) Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae}Length = 92 Back     alignment and structure
>1fpo_A (A:1-81) HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli}Length = 81 Back     alignment and structure
>2och_A (A:) Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, PSI-2, protein structure initiative; 1.86A {Caenorhabditis elegans}Length = 73 Back     alignment and structure
>2ys8_A (A:) RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens}Length = 90 Back     alignment and structure
>2dn9_A (A:) DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}Length = 79 Back     alignment and structure
>2ctr_A (A:) DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens}Length = 88 Back     alignment and structure
>2cug_A (A:) Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus}Length = 88 Back     alignment and structure
>1hdj_A (A:) Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens}Length = 77 Back     alignment and structure
>3bvo_A (A:1-124) CO-chaperone protein HSCB, mitochondrial precursor; structural genomics medical relevance, protein structure initiative, PSI-2; 3.00A {Homo sapiens}Length = 124 Back     alignment and structure
>2ctq_A (A:) DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens}Length = 112 Back     alignment and structure
>1wjz_A (A:) 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus}Length = 94 Back     alignment and structure
>2ctp_A (A:) DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens}Length = 78 Back     alignment and structure
>1faf_A (A:) Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus}Length = 79 Back     alignment and structure
>2dmx_A (A:) DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens}Length = 92 Back     alignment and structure
>2ej7_A (A:) HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}Length = 82 Back     alignment and structure
>1gh6_A (A:1-74) Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40}Length = 74 Back     alignment and structure
>1n4c_A (A:) Auxilin; four helix bundle, protein binding; NMR {Bos taurus}Length = 182 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target191 molecular chaperone DnaJ family protein [Candidatus Lib
1n4c_A_182 Auxilin; four helix bundle, protein binding; NMR { 99.54
1iur_A_88 KIAA0730 protein; DNAJ like domain, riken structur 99.43
2ctw_A_109 DNAJ homolog subfamily C member 5; J-domain, chape 99.42
2qwo_B_92 Putative tyrosine-protein phosphatase auxilin; cha 99.39
2ctq_A_112 DNAJ homolog subfamily C member 12; J-domain, chap 99.34
2guz_A_71 Mitochondrial import inner membrane translocase su 99.33
1bq0_A_103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.31
2ys8_A_90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.27
3bvo_A_1-124124 CO-chaperone protein HSCB, mitochondrial precursor 99.25
2guz_B_65 Mitochondrial import inner membrane translocase su 99.25
2yua_A_99 Williams-beuren syndrome chromosome region 18 prot 99.25
2dn9_A_79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.18
2o37_A_92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.14
1wjz_A_94 1700030A21RIK protein; J-domain, DNAJ like protein 99.11
2ctr_A_88 DNAJ homolog subfamily B member 9; J-domain, chape 99.1
1fpo_A_1-8181 HSC20, chaperone protein HSCB; molecular chaperone 99.1
2dmx_A_92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.09
2cug_A_88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.08
3hho_A_1-8585 CO-chaperone protein HSCB homolog; structural geno 99.08
2ej7_A_82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.05
1faf_A_79 Large T antigen; J domain, HPD motif, anti-paralle 99.04
2och_A_73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.03
2ctp_A_78 DNAJ homolog subfamily B member 12; J-domain, chap 99.03
2pf4_E_1-9292 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 98.98
1gh6_A_1-7474 Large T antigen; tumor suppressor, oncoprotein, an 98.96
1hdj_A_77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 98.96
>1n4c_A (A:) Auxilin; four helix bundle, protein binding; NMR {Bos taurus} Back     alignment and structure
Probab=99.54  E-value=3.4e-15  Score=120.00  Aligned_cols=61  Identities=18%  Similarity=0.288  Sum_probs=54.3

Q ss_pred             CHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCC---HHHHHHHHHHHHHHHHHHHC
Q ss_conf             88897699861777328899999999999999657889979---87999999999999999962
Q gi|254780585|r  128 GSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGD---RGSEERFQAVIQAYKILKKS  188 (191)
Q Consensus       128 ~~~~~~Al~~Lgl~~~~~~~~ik~~yk~lvk~~HPD~n~g~---~~~ee~~~~I~~Ay~~Lk~S  188 (191)
                      .....++|+||||++++|.++||++||+|+++||||++.++   ..++++|++|++||++|.+.
T Consensus       113 ~~~~~d~Y~vLgv~~~as~~eIKkAYRkLa~~~HPDk~~~~~~~~~A~e~F~~I~~AYe~Lsd~  176 (182)
T 1n4c_A          113 LWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQ  176 (182)
T ss_dssp             SCTTCCCCCCCCGGGGSSHHHHHHHHHHHHHHTCGGGGSSCTTHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCH
T ss_conf             5877678865676666899999999999999978787899678999999999999999997899



>1iur_A (A:) KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A (A:) DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2qwo_B (B:) Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphorylation; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>2ctq_A (A:) DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2guz_A (A:) Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1bq0_A (A:) DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} Back     alignment and structure
>2ys8_A (A:) RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bvo_A (A:1-124) CO-chaperone protein HSCB, mitochondrial precursor; structural genomics medical relevance, protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2guz_B (B:) Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2yua_A (A:) Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A (A:) DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o37_A (A:) Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1wjz_A (A:) 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} Back     alignment and structure
>2ctr_A (A:) DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fpo_A (A:1-81) HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} Back     alignment and structure
>2dmx_A (A:) DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A (A:) Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3hho_A (A:1-85) CO-chaperone protein HSCB homolog; structural genomics, IDP01304, center for structural genomics of infectious diseases, CSGI; 2.15A {Vibrio cholerae} Back     alignment and structure
>2ej7_A (A:) HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1faf_A (A:) Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} Back     alignment and structure
>2och_A (A:) Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, PSI-2, protein structure initiative; 1.86A {Caenorhabditis elegans} Back     alignment and structure
>2ctp_A (A:) DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pf4_E (E:1-92) Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulator/viral protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1gh6_A (A:1-74) Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} Back     alignment and structure
>1hdj_A (A:) Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} Back     alignment and structure