254780586

254780586

BolA family protein

GeneID in NCBI database:8209583Locus tag:CLIBASIA_02365
Protein GI in NCBI database:254780586Protein Accession:YP_003064999.1
Gene range:-(697529, 697834)Protein Length:101aa
Gene description:BolA family protein
COG prediction:[T] Stress-induced morphogen (activity unknown)
KEGG prediction:BolA family protein; K05527 BolA protein
SEED prediction:Cell division protein BolA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial Cell Division;
Glutaredoxins;
Broadly distributed proteins not in subsystems
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MQICHTSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEAFSPDEKHTLKNH
ccccHHHHHHHHHHHHHHHccccEEEEEEcHHHccccccccccccccEEEEEEEcHHHccccHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHcc
ccccHHHHHHHHHHHHHHHcccccEEEEEcHHHcccccccccccccccEEEEEEccHcccccHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHccc
MQICHTSLINRITEKIRialspddlqvineshlhvghqpqfnglgethirikivsptftgisktFRHRKIYDLLHKEIKEELHALsieafspdekhtlknh
MQICHTSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSptftgisktfRHRKIYDLLHKEIKEELHAlsieafspdekhtlknh
MQICHTSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEAFSPDEKHTLKNH
*************EKIRIALSPDDLQVINESHLHVGHQ****GLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEAFS**********
MQICHTSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEAFSPD********
MQICHTSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEAFSPDEKHT****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQICHTSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEAFSPDEKHTLKNH
MQICHTSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEAFSPDEKHTLKNH
MQICHTSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEAFSPDEKHTLKNH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target101 BolA family protein [Candidatus Liberibacter asiaticus
25478096979 hypothetical protein CLIBASIA_04350 [Candidatus Li 7e-05
254780474332 ubiquinol oxidase, subunit II [Candidatus Liberiba 0.003
>gi|254780969|ref|YP_003065382.1| hypothetical protein CLIBASIA_04350 [Candidatus Liberibacter asiaticus str. psy62] Length = 79 Back     alignment
 Score = 37.0 bits (84), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%)

Query: 47 THIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEAFSPDEK 95
           H   +I+S  F G ++  +H+ +YD L  ++   LHALSI+   PD +
Sbjct: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79

>gi|254780474|ref|YP_003064887.1| ubiquinol oxidase, subunit II [Candidatus Liberibacter asiaticus str. psy62] Length = 332 Back     alignment
 Score = 32.0 bits (71), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 13/78 (16%)

Query: 27  VINESHLHVGHQPQFNGLGETHIRIKIVSPTFTG----ISK-----TFRHRKIYDLLHKE 77
           V+N+   + G    ++G G +H+R K    +  G    ISK     TF +R+ Y LL K 
Sbjct: 211 VMNKKGAYSGFSANYSGRGFSHMRFKFYGKSEKGFEDWISKVKRQGTFLNRQEYLLLKKP 270

Query: 78  IKEELHALSIEAFSPDEK 95
            + +    S+  FSP EK
Sbjct: 271 SERD----SVRYFSPIEK 284

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target101 BolA family protein [Candidatus Liberibacter asiaticus
315121778101 BolA family protein [Candidatus Liberibacter solanacear 1 1e-35
22782325093 hypothetical protein NGR_c27200 [Sinorhizobium fredii N 1 1e-20
20955116993 BolA family protein [Rhizobium leguminosarum bv. trifol 1 4e-20
1596642793 putative transcription regulator protein [Sinorhizobium 1 6e-20
21851237894 BolA family protein [Rhizobium etli 8C-3] Length = 94 1 1e-19
24120657294 BolA family protein [Rhizobium leguminosarum bv. trifol 1 4e-19
22208737695 BolA-like protein [Agrobacterium radiobacter K84] Lengt 1 5e-19
218673216104 BolA family protein [Rhizobium etli GR56] Length = 104 1 1e-18
26746493 RecName: Full=Uncharacterized protein in cobS 5'region; 1 2e-18
15039776093 BolA family protein [Sinorhizobium medicae WSM419] Leng 1 2e-18
>gi|315121778|ref|YP_004062267.1| BolA family protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 101 Back     alignment and organism information
 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 85/101 (84%)

Query: 1   MQICHTSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTG 60
           MQ  H SL NRITEK+RIALSPD+L+VINESHLH GHQPQFNG GETHIRIK++S  F G
Sbjct: 1   MQTTHVSLSNRITEKVRIALSPDELKVINESHLHAGHQPQFNGSGETHIRIKVISKQFIG 60

Query: 61  ISKTFRHRKIYDLLHKEIKEELHALSIEAFSPDEKHTLKNH 101
           ++   RH+ IY+LL  EIK+ELHALSIEAFSPDEKHTL+ H
Sbjct: 61  MNLLSRHKIIYELLKVEIKDELHALSIEAFSPDEKHTLEKH 101


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227823250|ref|YP_002827222.1| hypothetical protein NGR_c27200 [Sinorhizobium fredii NGR234] Length = 93 Back     alignment and organism information
>gi|209551169|ref|YP_002283086.1| BolA family protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 93 Back     alignment and organism information
>gi|15966427|ref|NP_386780.1| putative transcription regulator protein [Sinorhizobium meliloti 1021] Length = 93 Back     alignment and organism information
>gi|218512378|ref|ZP_03509218.1| BolA family protein [Rhizobium etli 8C-3] Length = 94 Back     alignment and organism information
>gi|241206572|ref|YP_002977668.1| BolA family protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 94 Back     alignment and organism information
>gi|222087376|ref|YP_002545913.1| BolA-like protein [Agrobacterium radiobacter K84] Length = 95 Back     alignment and organism information
>gi|218673216|ref|ZP_03522885.1| BolA family protein [Rhizobium etli GR56] Length = 104 Back     alignment and organism information
>gi|267464|sp|P29943|YCB1_PSEDE RecName: Full=Uncharacterized protein in cobS 5'region; AltName: Full=ORF1 Length = 93 Back     alignment and organism information
>gi|150397760|ref|YP_001328227.1| BolA family protein [Sinorhizobium medicae WSM419] Length = 93 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target101 BolA family protein [Candidatus Liberibacter asiaticus
pfam0172272 pfam01722, BolA, BolA-like protein 5e-15
KOG2313100 KOG2313, KOG2313, KOG2313, Stress-induced protein UVI31 2e-14
PRK11628105 PRK11628, PRK11628, transcriptional regulator BolA; Pro 4e-10
KOG334885 KOG3348, KOG3348, KOG3348, BolA (bacterial stress-induc 2e-05
COG027190 COG0271, BolA, Stress-induced morphogen (activity unkno 3e-15
COG500780 COG5007, COG5007, Predicted transcriptional regulator, 2e-04
>gnl|CDD|145069 pfam01722, BolA, BolA-like protein Back     alignment and domain information
>gnl|CDD|37524 KOG2313, KOG2313, KOG2313, Stress-induced protein UVI31+ [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183243 PRK11628, PRK11628, transcriptional regulator BolA; Provisional Back     alignment and domain information
>gnl|CDD|38558 KOG3348, KOG3348, KOG3348, BolA (bacterial stress-induced morphogen)-related protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|30620 COG0271, BolA, Stress-induced morphogen (activity unknown) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|34612 COG5007, COG5007, Predicted transcriptional regulator, BolA superfamily [Transcription] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 101 BolA family protein [Candidatus Liberibacter asiaticus
PRK11628105 transcriptional regulator BolA; Provisional 100.0
COG027190 BolA Stress-induced morphogen (activity unknown) [Signa 99.96
KOG2313100 consensus 99.95
pfam0172272 BolA BolA-like protein. This family consist of the morp 99.93
KOG334885 consensus 99.91
COG500780 Predicted transcriptional regulator, BolA superfamily [ 99.86
>PRK11628 transcriptional regulator BolA; Provisional Back     alignment and domain information
>COG0271 BolA Stress-induced morphogen (activity unknown) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2313 consensus Back     alignment and domain information
>pfam01722 BolA BolA-like protein Back     alignment and domain information
>KOG3348 consensus Back     alignment and domain information
>COG5007 Predicted transcriptional regulator, BolA superfamily [Transcription] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target101 BolA family protein [Candidatus Liberibacter asiaticus
2dhm_A107 Solution Structure Of The Bola Protein From Escheri 7e-26
1v60_A123 Solution Structure Of Bola1 Protein From Mus Muscul 2e-22
2kdn_A108 Solution Structure Of Pfe0790c, A Putative Bola-Lik 6e-18
3o2e_A105 Crystal Structure Of A Bol-Like Protein From Babesi 4e-17
1v9j_A113 Solution Structure Of A Bola-Like Protein From Mus 1e-15
1xs3_A80 Solution Structure Analysis Of The Xc975 Protein Le 4e-15
1ny8_A97 Solution Structure Of Protein Yrba From Escherichia 8e-10
2kz0_A76 Solution Structure Of A Bola Protein (Ech_0303) Fro 2e-06
>gi|159164108|pdb|2DHM|A Chain A, Solution Structure Of The Bola Protein From Escherichia Coli Length = 107 Back     alignment and structure
 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 50/99 (50%), Gaps = 5/99 (5%)

Query: 2   QICHTSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGI 61
                 +  RI EK+R A  P  L+V++ES+ H           E+H ++ +VS  FTG 
Sbjct: 4   GSSGMMIRERIEEKLRAAFQPVFLEVVDESYRH-----NVPAGSESHFKVVLVSDRFTGE 58

Query: 62  SKTFRHRKIYDLLHKEIKEELHALSIEAFSPDEKHTLKN 100
               RHR IY  L +E+   +HAL++  ++  E   L++
Sbjct: 59  RFLNRHRMIYSTLAEELSTTVHALALHTYTIKEWEGLQD 97


>gi|159163196|pdb|1V60|A Chain A, Solution Structure Of Bola1 Protein From Mus Musculus Length = 123 Back     alignment and structure
>gi|221046468|pdb|2KDN|A Chain A, Solution Structure Of Pfe0790c, A Putative Bola-Like Protein From The Protozoan Parasite Plasmodium Falciparum Length = 108 Back     alignment and structure
>gi|308387908|pdb|3O2E|A Chain A, Crystal Structure Of A Bol-Like Protein From Babesia Bovis Length = 105 Back     alignment and structure
>gi|46016011|pdb|1V9J|A Chain A, Solution Structure Of A Bola-Like Protein From Mus Musculus Length = 113 Back     alignment and structure
>gi|62738509|pdb|1XS3|A Chain A, Solution Structure Analysis Of The Xc975 Protein Length = 80 Back     alignment and structure
>gi|50513260|pdb|1NY8|A Chain A, Solution Structure Of Protein Yrba From Escherichia Coli: Northeast Structural Genomics Consortium Target Er115 Length = 97 Back     alignment and structure
>gi|299688705|pdb|2KZ0|A Chain A, Solution Structure Of A Bola Protein (Ech_0303) From Ehrlichia Chaffeensis. Seattle Structural Genomics Center For Infectious Disease Target Ehcha.10365.A Length = 76 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target101 BolA family protein [Candidatus Liberibacter asiaticus
1v60_A123 BOLA1, riken cDNA 1810037G04; stationary phase morphoge 1e-19
2dhm_A107 Protein BOLA; stationary-phase, stress-induced, morphog 5e-18
2kdn_A108 Putative uncharacterized protein PFE0790C; solution str 2e-16
3o2e_A105 BOLA-like protein; ssgcid, iodide, SAD, seattle structu 4e-16
1v9j_A113 BOLA-like protein riken cDNA 1110025L05; stationary pha 4e-15
1xs3_A80 Hypothetical protein XC975; BOLA-like, structural genom 1e-13
1ny8_A97 Protein YRBA; structure, autoassign, autostructure, NES 2e-11
2kz0_A76 BOLA family protein; BOLA protein family, human monocyt 2e-08
>1v60_A BOLA1, riken cDNA 1810037G04; stationary phase morphogene, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 123 Back     alignment and structure
 Score = 90.3 bits (224), Expect = 1e-19
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 5/85 (5%)

Query: 10  NRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRK 69
             I  K+  ALSP+ L++ NES  H           ETH R+ +VS  F G+S   RHR 
Sbjct: 29  AAIRAKLEQALSPEVLELRNESGGHAVPAG-----SETHFRVAVVSSRFEGMSPLQRHRL 83

Query: 70  IYDLLHKEIKEELHALSIEAFSPDE 94
           +++ L +E+   +HAL+I+A +P +
Sbjct: 84  VHEALSEELAGPVHALAIQAKTPAQ 108


>2dhm_A Protein BOLA; stationary-phase, stress-induced, morphogene, structural genomics, NPPSFA; NMR {Escherichia coli str} Length = 107 Back     alignment and structure
>2kdn_A Putative uncharacterized protein PFE0790C; solution structure, ssgcid, seattle structural genomics center for infectious disease; NMR {Plasmodium falciparum} Length = 108 Back     alignment and structure
>3o2e_A BOLA-like protein; ssgcid, iodide, SAD, seattle structural genom center for infectious disease, BOL like protein, unknown FU; 1.95A {Babesia bovis} Length = 105 Back     alignment and structure
>1v9j_A BOLA-like protein riken cDNA 1110025L05; stationary phase morphogene, stress-induced morphogene, structural genomics; NMR {Mus musculus} SCOP: d.52.6.1 Length = 113 Back     alignment and structure
>1xs3_A Hypothetical protein XC975; BOLA-like, structural genomics, AN integrated structural and functional genomic project, unknown function; NMR {Synthetic} Length = 80 Back     alignment and structure
>1ny8_A Protein YRBA; structure, autoassign, autostructure, NESG, structural genomics, PSI, protein structure initiative; NMR {Escherichia coli} SCOP: d.52.6.1 Length = 97 Back     alignment and structure
>2kz0_A BOLA family protein; BOLA protein family, human monocytotropic ehrlichiosis, STRE response, structural genomics; NMR {Ehrlichia chaffeensis} Length = 76 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target101 BolA family protein [Candidatus Liberibacter asiaticus
2dhm_A107 Protein BOLA; stationary-phase, stress-induced, morphog 100.0
1v60_A123 BOLA1, riken cDNA 1810037G04; stationary phase morphoge 99.98
2kdn_A108 Putative uncharacterized protein PFE0790C; solution str 99.96
3o2e_A105 BOLA-like protein; ssgcid, iodide, SAD, seattle structu 99.96
1v9j_A113 BOLA-like protein riken cDNA 1110025L05; stationary pha 99.95
1ny8_A97 Protein YRBA; structure, autoassign, autostructure, NES 99.92
1xs3_A80 Hypothetical protein XC975; BOLA-like, structural genom 99.9
2kz0_A76 BOLA family protein; BOLA protein family, human monocyt 99.83
1ylq_A96 Putative nucleotidyltransferase, hypothetical protein A 95.84
>2dhm_A Protein BOLA; stationary-phase, stress-induced, morphogene, structural genomics, NPPSFA; NMR {Escherichia coli str} Back     alignment and structure
Probab=100.00  E-value=2.6e-34  Score=205.24  Aligned_cols=94  Identities=33%  Similarity=0.467  Sum_probs=88.8

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEHHHCCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             85514199999999984199517999950656888777778998508999998203479988899999999999983378
Q gi|254780586|r    2 QICHTSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEE   81 (101)
Q Consensus         2 ~i~~~~~~~~I~~kL~~~l~~~~i~V~D~S~~H~gH~~~~~~~~~sHf~i~IvS~~F~g~s~i~rHr~V~~~L~~e~~~~   81 (101)
                      +.+.|.+.++|+++|++.|+|.+++|+|+|++|+||.|     +++||+|+|||+.|.|+++|+|||+||++|+++|+++
T Consensus         4 ~~~~m~~~~~I~~~L~~~~~~~~l~V~D~S~~H~~h~g-----~~~Hf~i~IvS~~F~g~s~i~rHR~V~~~L~~ei~~~   78 (107)
T 2dhm_A            4 GSSGMMIRERIEEKLRAAFQPVFLEVVDESYRHNVPAG-----SESHFKVVLVSDRFTGERFLNRHRMIYSTLAEELSTT   78 (107)
T ss_dssp             SSCCCCHHHHHHHHHHHHTCCSCCEEEECCCCCSSCCC-----SCCCEEEEEECGGGSSCCSSHHHHHHHHHTHHHHHTT
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC-----CCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             66777899999999984189857999978776668899-----9727999998675368878999999999999997179


Q ss_pred             CEEEEEECCCHHHHHHHHC
Q ss_conf             2287776076899998533
Q gi|254780586|r   82 LHALSIEAFSPDEKHTLKN  100 (101)
Q Consensus        82 iHAlsik~~tp~E~~~~k~  100 (101)
                      ||||+|+|+||+||++.++
T Consensus        79 IHALsik~~T~~Ew~~~~~   97 (107)
T 2dhm_A           79 VHALALHTYTIKEWEGLQD   97 (107)
T ss_dssp             CCCCEEEEECHHHHHTSSC
T ss_pred             CCEEEEEECCHHHHHHCCC
T ss_conf             7536878389999997379



>1v60_A BOLA1, riken cDNA 1810037G04; stationary phase morphogene, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2kdn_A Putative uncharacterized protein PFE0790C; solution structure, ssgcid, seattle structural genomics center for infectious disease; NMR {Plasmodium falciparum} Back     alignment and structure
>3o2e_A BOLA-like protein; ssgcid, iodide, SAD, seattle structural genom center for infectious disease, BOL like protein, unknown FU; 1.95A {Babesia bovis} Back     alignment and structure
>1v9j_A BOLA-like protein riken cDNA 1110025L05; stationary phase morphogene, stress-induced morphogene, structural genomics; NMR {Mus musculus} SCOP: d.52.6.1 Back     alignment and structure
>1ny8_A Protein YRBA; structure, autoassign, autostructure, NESG, structural genomics, PSI, protein structure initiative; NMR {Escherichia coli} SCOP: d.52.6.1 Back     alignment and structure
>1xs3_A Hypothetical protein XC975; BOLA-like, structural genomics, AN integrated structural and functional genomic project, unknown function; NMR {Synthetic} Back     alignment and structure
>2kz0_A BOLA family protein; BOLA protein family, human monocytotropic ehrlichiosis, STRE response, structural genomics; NMR {Ehrlichia chaffeensis} Back     alignment and structure
>1ylq_A Putative nucleotidyltransferase, hypothetical protein AF0614; structural genomics, PSI, protein structure initiative; 2.02A {Archaeoglobus fulgidus} SCOP: d.218.1.5 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 101 BolA family protein [Candidatus Liberibacter asiaticus
d1v9ja_113 d.52.6.1 (A:) BolA-like protein {Mouse (Mus musculus) [ 3e-13
d1ny8a_97 d.52.6.1 (A:) Hypothetical protein YrbA {Escherichia co 1e-10
>d1v9ja_ d.52.6.1 (A:) BolA-like protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Alpha-lytic protease prodomain-like
superfamily: BolA-like
family: BolA-like
domain: BolA-like protein
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 67.6 bits (165), Expect = 3e-13
 Identities = 19/85 (22%), Positives = 38/85 (44%), Gaps = 11/85 (12%)

Query: 10  NRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRK 69
           + + EK+R  L  + ++V + +               T  R+ +VS  F G     RHR 
Sbjct: 33  DYLREKLRQDLEAEHVEVEDTTLNRCA----------TSFRVLVVSAKFEGKPLLQRHRL 82

Query: 70  IYDLLHKEIKEELHALSIEAFSPDE 94
           + + L +E+   +HA   +  +P++
Sbjct: 83  VNECLAEELP-HIHAFEQKTLTPEQ 106


>d1ny8a_ d.52.6.1 (A:) Hypothetical protein YrbA {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target101 BolA family protein [Candidatus Liberibacter asiaticus
d1v9ja_113 BolA-like protein {Mouse (Mus musculus) [TaxId: 10090]} 99.95
d1ny8a_97 Hypothetical protein YrbA {Escherichia coli [TaxId: 562 99.92
d1ylqa190 Putative nucleotidyltransferase AF0614 {Archaeon Archae 96.42
>d1v9ja_ d.52.6.1 (A:) BolA-like protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Alpha-lytic protease prodomain-like
superfamily: BolA-like
family: BolA-like
domain: BolA-like protein
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.95  E-value=2.5e-29  Score=176.95  Aligned_cols=86  Identities=22%  Similarity=0.381  Sum_probs=78.1

Q ss_pred             CCCH-HHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEHHHCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             5141-999999999841995179999506568887777789985089999982034799888999999999999833782
Q gi|254780586|r    4 CHTS-LINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEEL   82 (101)
Q Consensus         4 ~~~~-~~~~I~~kL~~~l~~~~i~V~D~S~~H~gH~~~~~~~~~sHf~i~IvS~~F~g~s~i~rHr~V~~~L~~e~~~~i   82 (101)
                      ..|+ ..+.|+++|+++|+|.+++|+|+|+.|          +++||+|+|||+.|.|+++|+|||+||++|+++|+ +|
T Consensus        26 ~~m~~~~e~I~~kL~~~~~~~~leV~D~S~~h----------~G~Hf~i~IvS~~F~g~s~v~rHr~Vy~~L~~ei~-~i   94 (113)
T d1v9ja_          26 ATMELSADYLREKLRQDLEAEHVEVEDTTLNR----------CATSFRVLVVSAKFEGKPLLQRHRLVNECLAEELP-HI   94 (113)
T ss_dssp             SSSSSCHHHHHHHHHHHHTCSEEEEEECCSSS----------SCCCEEEEEECSHHHHSCHHHHHHHHHHHTTTTGG-GC
T ss_pred             CCCCCCHHHHHHHHHHHCCCCEEEEEECCCCC----------CCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHH-CC
T ss_conf             77763699999999844898379999667899----------87059999986021477440788947999999972-04


Q ss_pred             EEEEEECCCHHHHHHHHC
Q ss_conf             287776076899998533
Q gi|254780586|r   83 HALSIEAFSPDEKHTLKN  100 (101)
Q Consensus        83 HAlsik~~tp~E~~~~k~  100 (101)
                      |||+|+|+||+||++.+.
T Consensus        95 HAlsi~t~Tp~Ew~~~~~  112 (113)
T d1v9ja_          95 HAFEQKTLTPEQWTRQRR  112 (113)
T ss_dssp             SSEEEEEECHHHHHHSCC
T ss_pred             EEEEEEECCHHHHHHHHC
T ss_conf             204878189999987535



>d1ny8a_ d.52.6.1 (A:) Hypothetical protein YrbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ylqa1 d.218.1.5 (A:1-90) Putative nucleotidyltransferase AF0614 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 101 BolA family protein [Candidatus Liberibacter asiat
1v60_A_123 (A:) BOLA1, riken cDNA 1810037G04; stationary phas 2e-20
2dhm_A_107 (A:) Protein BOLA; stationary-phase, stress-induce 5e-20
1xs3_A_80 (A:) Hypothetical protein XC975; BOLA-like, struct 2e-17
1v9j_A_113 (A:) BOLA-like protein riken cDNA 1110025L05; stat 1e-14
2kdn_A_108 (A:) Putative uncharacterized protein PFE0790C; so 1e-14
1ny8_A_97 (A:) Protein YRBA; structure, autoassign, autostru 2e-13
>1v60_A (A:) BOLA1, riken cDNA 1810037G04; stationary phase morphogene, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus}Length = 123 Back     alignment and structure
 Score = 92.6 bits (230), Expect = 2e-20
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 5/89 (5%)

Query: 6   TSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTF 65
             +   I  K+  ALSP+ L++ NES  H           ETH R+ +VS  F G+S   
Sbjct: 25  GPVEAAIRAKLEQALSPEVLELRNESGGHAVPAG-----SETHFRVAVVSSRFEGMSPLQ 79

Query: 66  RHRKIYDLLHKEIKEELHALSIEAFSPDE 94
           RHR +++ L +E+   +HAL+I+A +P +
Sbjct: 80  RHRLVHEALSEELAGPVHALAIQAKTPAQ 108


>2dhm_A (A:) Protein BOLA; stationary-phase, stress-induced, morphogene, structural genomics, NPPSFA; NMR {Escherichia coli str}Length = 107 Back     alignment and structure
>1xs3_A (A:) Hypothetical protein XC975; BOLA-like, structural genomics, AN integrated structural and functional genomic project, unknown function; NMR {Synthetic}Length = 80 Back     alignment and structure
>1v9j_A (A:) BOLA-like protein riken cDNA 1110025L05; stationary phase morphogene, stress-induced morphogene, structural genomics; NMR {Mus musculus}Length = 113 Back     alignment and structure
>2kdn_A (A:) Putative uncharacterized protein PFE0790C; solution structure, ssgcid, seattle structural genomics center for infectious disease; NMR {Plasmodium falciparum}Length = 108 Back     alignment and structure
>1ny8_A (A:) Protein YRBA; structure, autoassign, autostructure, NESG, structural genomics, PSI, protein structure initiative; NMR {Escherichia coli}Length = 97 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target101 BolA family protein [Candidatus Liberibacter asiaticus
1v60_A_123 BOLA1, riken cDNA 1810037G04; stationary phase mor 100.0
2dhm_A_107 Protein BOLA; stationary-phase, stress-induced, mo 100.0
2kdn_A_108 Putative uncharacterized protein PFE0790C; solutio 99.96
1v9j_A_113 BOLA-like protein riken cDNA 1110025L05; stationar 99.95
1ny8_A_97 Protein YRBA; structure, autoassign, autostructure 99.94
1xs3_A_80 Hypothetical protein XC975; BOLA-like, structural 99.88
>1v60_A (A:) BOLA1, riken cDNA 1810037G04; stationary phase morphogene, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=2.5e-33  Score=200.76  Aligned_cols=93  Identities=33%  Similarity=0.442  Sum_probs=87.1

Q ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEHHHCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             55141999999999841995179999506568887777789985089999982034799888999999999999833782
Q gi|254780586|r    3 ICHTSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEEL   82 (101)
Q Consensus         3 i~~~~~~~~I~~kL~~~l~~~~i~V~D~S~~H~gH~~~~~~~~~sHf~i~IvS~~F~g~s~i~rHr~V~~~L~~e~~~~i   82 (101)
                      ...|+++++|+++|+..|+|.+++|+|+|++|+||.|     +++||+|+|||+.|+|+++|+|||+||++|+++|+++|
T Consensus        22 ~~~~~~~~~I~~~L~~~l~~~~l~V~d~S~~H~~~~g-----~~~Hf~i~IVS~~F~g~s~v~rHr~Vy~~L~~el~~~I   96 (123)
T 1v60_A           22 AAAGPVEAAIRAKLEQALSPEVLELRNESGGHAVPAG-----SETHFRVAVVSSRFEGMSPLQRHRLVHEALSEELAGPV   96 (123)
T ss_dssp             SSSCHHHHHHHHHHHHHTCCSEEEEEECCCSSSCCTT-----CCSEEEEEEECGGGTTCCHHHHHHHHHHHTHHHHTTTC
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC-----CCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCC
T ss_conf             5456699999999985089847999977855466689-----98689999997864798789999999999999974897


Q ss_pred             EEEEEECCCHHHHHHHHC
Q ss_conf             287776076899998533
Q gi|254780586|r   83 HALSIEAFSPDEKHTLKN  100 (101)
Q Consensus        83 HAlsik~~tp~E~~~~k~  100 (101)
                      |||+|+||||+||++.+.
T Consensus        97 HALsikt~tp~Ew~~~~~  114 (123)
T 1v60_A           97 HALAIQAKTPAQWRENPQ  114 (123)
T ss_dssp             SEEEEEEECTTTTTTCCC
T ss_pred             CEEEEEECCHHHHHHCCC
T ss_conf             436878189999971799



>2dhm_A (A:) Protein BOLA; stationary-phase, stress-induced, morphogene, structural genomics, NPPSFA; NMR {Escherichia coli str} Back     alignment and structure
>2kdn_A (A:) Putative uncharacterized protein PFE0790C; solution structure, ssgcid, seattle structural genomics center for infectious disease; NMR {Plasmodium falciparum} Back     alignment and structure
>1v9j_A (A:) BOLA-like protein riken cDNA 1110025L05; stationary phase morphogene, stress-induced morphogene, structural genomics; NMR {Mus musculus} Back     alignment and structure
>1ny8_A (A:) Protein YRBA; structure, autoassign, autostructure, NESG, structural genomics, PSI, protein structure initiative; NMR {Escherichia coli} Back     alignment and structure
>1xs3_A (A:) Hypothetical protein XC975; BOLA-like, structural genomics, AN integrated structural and functional genomic project, unknown function; NMR {Synthetic} Back     alignment and structure