254780588

254780588

acetyl-CoA carboxylase carboxyltransferase subunit alpha

GeneID in NCBI database:8209585Locus tag:CLIBASIA_02375
Protein GI in NCBI database:254780588Protein Accession:YP_003065001.1
Gene range:-(695059, 696012)Protein Length:317aa
Gene description:acetyl-CoA carboxylase carboxyltransferase subunit alpha
COG prediction:[I] Acetyl-CoA carboxylase alpha subunit
KEGG prediction:accA; acetyl-CoA carboxylase carboxyltransferase subunit alpha (EC:6.4.1.2); K01962 acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2]
SEED prediction:Acetyl-coenzyme A carboxyl transferase alpha chain (EC 6.4.1.2)
Pathway involved in KEGG:Pyruvate metabolism [PATH:las00620]
Propanoate metabolism [PATH:las00640]
Fatty acid biosynthesis [PATH:las00061]
Tetracycline biosynthesis
Subsystem involved in SEED:Fatty Acid Biosynthesis FASII
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MRHYLDFEEPISDLEAKIHELKKLSREDINEDFSEEIRELEAMVCKTLSEIYSKLTPWQKTQVSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKGSDTKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIARATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIYSVISPEGAASILWRDSSRAAQAAIAMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTISSVGEIISQFLSETSTYSETEIREHRRQKYLNIGRNL
cccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccccHHHHHHHHHccccEEccccccccccccEEEEEEEEccEEEEEEEEcccccccHHHHHHcccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccEEEccccEEEEEcccEEEEEcHHHHHHHHHHcccHHHHcHHHccccHHHHHHcccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccc
cccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccHEEccEEccccccEEEEEccccccHHHHHHHHcccccccHHHHHHHHHHHHHHccccEEEEEccccccccccHHHcccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHccHHHHHHHHcccEEEcccHHHHHHHHHcHHHHHHHHHHHcccHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccc
mrhyldfeepISDLEAKIHELKKLSREDINEDFSEEIRELEAMVCKTLSEIYSkltpwqktqvsrhpnrphyIDYINSLFTHFISLagdrlfgddpamQIGLarfhgqpvaiigqekgsdtksrikhnfgsprpegYRKAVRLMEMADrfkipvisfidtagaypgvdaeargQGEAIARATEMCLKLQVPILSIIigeggsggaMGIAAANFVYMLEHAIYsvispegaasILWRDSSRAAQAAIAMKIIATdlqdlsiidgiipepiggahrnpaqtiSSVGEIISQFLsetstysetEIREHRRQKYLNIGRNL
mrhyldfeepisdLEAKIHElkklsredinEDFSEEIRELEAMVCKTLSEIYSKLTPWQKTQVSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIgqekgsdtksrikhnfgsprpegyRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIARATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIYSVISPEGAASILWRDSSRAAQAAIAMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTISSVGEIISQFLSetstyseteirehrrqkylnigrnl
MRHYLDFEEPISDLEAKIHELKKLSREDINEDFSEEIRELEAMVCKTLSEIYSKLTPWQKTQVSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKGSDTKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIARATEMCLKLQVPILSiiigeggsggamgiaaaNFVYMLEHAIYSVISPEGAASILWRDSSRaaqaaiamkiiaTDLQDLSiidgiipepiggAHRNPAQTISSVGEIISQFLSETSTYSETEIREHRRQKYLNIGRNL
*RHYLDFEEPISDLEAKIHEL***************IRELEAMVCKTLSEIYSKLTPWQKTQVSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKGSDTKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIARATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIYSVISPEGAASILWRDSSRAAQAAIAMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTISSVGEIISQFLSETSTYSETEIREHRRQKYLNIGRNL
MRHYLDFEEPISDLEAKIHELKKLSREDINEDFSEEIRELEAMVCKTLSEIYSKLTPW********PNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKGSDTKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIARATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIYSVISPEGAASILWRDSSRAAQAAIAMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTISSVGEIISQFLSETSTYSETEIREHRRQKYLNIGRNL
**HYLDFEEPISDLEAKIHELKKLSREDINEDFSEEIRELEAMVCKTLSEIYSKLTPWQKTQVSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKGSDTKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIARATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIYSVISPEGAASILWRDSSRAAQAAIAMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTISSVGEIISQFLSETSTYSETEIREHRRQKYLNIGRNL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRHYLDFEEPxxxxxxxxxxxxxxxxxxxxxDFSEEIRELEAMVCKTLSEIYSKLTPWQKTQVSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKGSDTKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIARATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIYSVISPEGAASILWRDSSRAAQAAIAMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTISSVGEIISQFLSETSTYSETEIREHRRQKYLNIGRNL
MRHYLDFEEPISDLEAKIHELKKLSREDINEDFSEEIRELEAMVCKTLSEIYSKLTPWQKTQVSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKGSDTKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIARATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIYSVISPEGAASILWRDSSRAAQAAIAMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTISSVGEIISQFLSETSTYSETEIREHRRQKYLNIGRNL
MRHYLDFEEPISDLEAKIHELKKLSREDINEDFSEEIRELEAMVCKTLSEIYSKLTPWQKTQVSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKGSDTKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIARATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIYSVISPEGAASILWRDSSRAAQAAIAMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTISSVGEIISQFLSETSTYSETEIREHRRQKYLNIGRNL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target317 acetyl-CoA carboxylase carboxyltransferase subunit alph
315121781317 acetyl-CoA carboxylase carboxyltransferase subunit alph 1 1e-144
332716419317 acetyl-CoA carboxylase, carboxyl transferase alpha subu 1 1e-128
222087382317 acetyl-CoA carboxylase, carboxyl transferase, alpha sub 1 1e-128
15966435317 acetyl-CoA carboxylase carboxyltransferase subunit alph 1 1e-127
15891310317 acetyl-CoA carboxylase carboxyltransferase subunit alph 1 1e-127
227823256317 acetyl-CoA carboxylase carboxyltransferase subunit alph 1 1e-126
150397766317 acetyl-CoA carboxylase carboxyltransferase subunit alph 1 1e-126
222149987318 acetyl-CoA carboxylase carboxyltransferase subunit alph 1 1e-126
209551175317 acetyl-CoA carboxylase carboxyltransferase subunit alph 1 1e-125
218662494317 acetyl-CoA carboxylase carboxyltransferase subunit alph 1 1e-125
>gi|315121781|ref|YP_004062270.1| acetyl-CoA carboxylase carboxyltransferase subunit alpha [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 317 Back     alignment and organism information
 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 261/317 (82%), Positives = 292/317 (92%)

Query: 1   MRHYLDFEEPISDLEAKIHELKKLSREDINEDFSEEIRELEAMVCKTLSEIYSKLTPWQK 60
           M +YLDFE+ ISDLEA+IHELKKLSRED  +++SEEI++LEA V   LSEIYSKLTPWQK
Sbjct: 1   MHNYLDFEKQISDLEAQIHELKKLSREDDAKEYSEEIKKLEAAVQNALSEIYSKLTPWQK 60

Query: 61  TQVSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKGSD 120
           TQ+SRHPNRPHY+DYINSLFT FI L+GDRLFGDDPAMQIGLA+FHGQ VAI+GQEKGSD
Sbjct: 61  TQISRHPNRPHYVDYINSLFTDFIPLSGDRLFGDDPAMQIGLAKFHGQSVAIVGQEKGSD 120

Query: 121 TKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIAR 180
           TKSRIKHNFGSPRPEGYRKA+RLM+MAD F++PVIS IDTAGAYPGVDAE RGQGEAIAR
Sbjct: 121 TKSRIKHNFGSPRPEGYRKAIRLMKMADHFELPVISLIDTAGAYPGVDAEERGQGEAIAR 180

Query: 181 ATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIYSVISPEGAASILWRDSSR 240
           +TEMCLKLQVPI++IIIGEGGSGGAMGIAAAN+VYMLEH+IYSVISPEGAASILWRD SR
Sbjct: 181 STEMCLKLQVPIIAIIIGEGGSGGAMGIAAANYVYMLEHSIYSVISPEGAASILWRDPSR 240

Query: 241 AAQAAIAMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTISSVGEIISQFLSETSTYSET 300
           AAQAAIAMKI ++DL++L+IIDGIIPEPIGGAHRNPAQTI+SV E+I + L E S YS  
Sbjct: 241 AAQAAIAMKITSSDLKELAIIDGIIPEPIGGAHRNPAQTIASVDEVIKKSLLEASIYSGK 300

Query: 301 EIREHRRQKYLNIGRNL 317
           EIR+HR QKYLNIGRNL
Sbjct: 301 EIRQHRHQKYLNIGRNL 317


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|332716419|ref|YP_004443885.1| acetyl-CoA carboxylase, carboxyl transferase alpha subunit [Agrobacterium sp. H13-3] Length = 317 Back     alignment and organism information
>gi|222087382|ref|YP_002545919.1| acetyl-CoA carboxylase, carboxyl transferase, alpha subunit [Agrobacterium radiobacter K84] Length = 317 Back     alignment and organism information
>gi|15966435|ref|NP_386788.1| acetyl-CoA carboxylase carboxyltransferase subunit alpha [Sinorhizobium meliloti 1021] Length = 317 Back     alignment and organism information
>gi|15891310|ref|NP_356982.1| acetyl-CoA carboxylase carboxyltransferase subunit alpha [Agrobacterium tumefaciens str. C58] Length = 317 Back     alignment and organism information
>gi|227823256|ref|YP_002827228.1| acetyl-CoA carboxylase carboxyltransferase subunit alpha [Sinorhizobium fredii NGR234] Length = 317 Back     alignment and organism information
>gi|150397766|ref|YP_001328233.1| acetyl-CoA carboxylase carboxyltransferase subunit alpha [Sinorhizobium medicae WSM419] Length = 317 Back     alignment and organism information
>gi|222149987|ref|YP_002550944.1| acetyl-CoA carboxylase carboxyltransferase subunit alpha [Agrobacterium vitis S4] Length = 318 Back     alignment and organism information
>gi|209551175|ref|YP_002283092.1| acetyl-CoA carboxylase carboxyltransferase subunit alpha [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 317 Back     alignment and organism information
>gi|218662494|ref|ZP_03518424.1| acetyl-CoA carboxylase carboxyltransferase subunit alpha [Rhizobium etli IE4771] Length = 317 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target317 acetyl-CoA carboxylase carboxyltransferase subunit alph
PRK05724319 PRK05724, PRK05724, acetyl-CoA carboxylase carboxyltran 1e-151
TIGR00513316 TIGR00513, accA, acetyl-CoA carboxylase, carboxyl trans 1e-108
CHL00198322 CHL00198, accA, acetyl-CoA carboxylase carboxyltransfer 4e-84
PLN03230431 PLN03230, PLN03230, acetyl-coenzyme A carboxylase carbo 8e-84
PLN03229 762 PLN03229, PLN03229, acetyl-coenzyme A carboxylase carbo 8e-79
COG0825317 COG0825, AccA, Acetyl-CoA carboxylase alpha subunit [Li 1e-125
PRK12319256 PRK12319, PRK12319, acetyl-CoA carboxylase subunit alph 5e-70
pfam03255145 pfam03255, ACCA, Acetyl co-enzyme A carboxylase carboxy 3e-54
pfam01039487 pfam01039, Carboxyl_trans, Carboxyl transferase domain 2e-18
COG4799526 COG4799, COG4799, Acetyl-CoA carboxylase, carboxyltrans 2e-16
TIGR01117512 TIGR01117, mmdA, methylmalonyl-CoA decarboxylase alpha 1e-12
KOG0540536 KOG0540, KOG0540, KOG0540, 3-Methylcrotonyl-CoA carboxy 2e-11
COG4799 526 COG4799, COG4799, Acetyl-CoA carboxylase, carboxyltrans 4e-06
PLN02820569 PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, b 6e-06
PLN02820 569 PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, b 6e-04
TIGR01117 512 TIGR01117, mmdA, methylmalonyl-CoA decarboxylase alpha 0.001
>gnl|CDD|180223 PRK05724, PRK05724, acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|161909 TIGR00513, accA, acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>gnl|CDD|164574 CHL00198, accA, acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>gnl|CDD|178769 PLN03230, PLN03230, acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|178768 PLN03229, PLN03229, acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|31167 COG0825, AccA, Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|183435 PRK12319, PRK12319, acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|112085 pfam03255, ACCA, Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit Back     alignment and domain information
>gnl|CDD|144579 pfam01039, Carboxyl_trans, Carboxyl transferase domain Back     alignment and domain information
>gnl|CDD|34408 COG4799, COG4799, Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|130187 TIGR01117, mmdA, methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>gnl|CDD|35760 KOG0540, KOG0540, KOG0540, 3-Methylcrotonyl-CoA carboxylase, non-biotin containing subunit/Acetyl-CoA carboxylase carboxyl transferase, subunit beta [Amino acid transport and metabolism, Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|34408 COG4799, COG4799, Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|178415 PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>gnl|CDD|178415 PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>gnl|CDD|130187 TIGR01117, mmdA, methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 317 acetyl-CoA carboxylase carboxyltransferase subunit alph
). It catalyzes the first step in the synthesis of long-chain fatty acids which involves the carboxylation of acetyl-CoA to malonyl-CoA. The acetyl-CoA carboxylase complex () is a heterohexamer of biotin carboxyl carrier protein, biotin carboxylase and two non-identical carboxyl transferase subunits (alpha and beta) in a 2:2 association . The reaction involves two steps: Biotin carrier protein + ATP + HCO_3^- -> Carboxybiotin carrier protein + ADP + P_i Carboxybiotin carrier protein + Acetyl-CoA -> Malonyl-CoA + Biotin carrier protein ; GO: 0003989 acetyl-CoA carboxylase activity, 0006633 fatty acid biosynthetic process, 0009317 acetyl-CoA carboxylase complex." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00513">TIGR00513329 accA acetyl-CoA carboxylase, carboxyl transferase, alph 100.0
PRK05724318 acetyl-CoA carboxylase carboxyltransferase subunit alph 100.0
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase alpha s 100.0
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabo 100.0
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 100.0
pfam01039487 Carboxyl_trans Carboxyl transferase domain. All of the 100.0
COG4799526 Acetyl-CoA carboxylase, carboxyltransferase component ( 100.0
TIGR01117513 mmdA methylmalonyl-CoA decarboxylase alpha subunit; Int 99.95
KOG0540536 consensus 99.94
PRK05654288 acetyl-CoA carboxylase subunit beta; Validated 99.57
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabol 99.23
pfam03255145 ACCA Acetyl co-enzyme A carboxylase carboxyltransferase 100.0
COG4799 526 Acetyl-CoA carboxylase, carboxyltransferase component ( 99.89
pfam01039 487 Carboxyl_trans Carboxyl transferase domain. All of the 99.84
KOG0540 536 consensus 99.73
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subunit. M 99.69
TIGR01117 513 mmdA methylmalonyl-CoA decarboxylase alpha subunit; Int 99.59
CHL00174305 accD acetyl-CoA carboxylase beta subunit; Reviewed 99.37
pfam06833234 MdcE Malonate decarboxylase gamma subunit (MdcE). This 99.17
KOG1680290 consensus 97.64
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit. Mem 99.84
PRK07189302 malonate decarboxylase subunit beta; Reviewed 99.74
KOG0368 2196 consensus 97.56
TIGR00515292 accD acetyl-CoA carboxylase, carboxyl transferase, beta 98.72
KOG0840275 consensus 96.83
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is an AT 98.62
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-depen 98.22
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-depende 97.77
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serin 97.69
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Posttra 97.26
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K 96.7
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a serine 96.66
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K 96.52
pfam01972286 SDH_sah Serine dehydrogenase proteinase. This family of 95.26
PRK10949618 protease 4; Provisional 90.96
KOG0016266 consensus 98.62
PRK06688263 enoyl-CoA hydratase; Provisional 98.19
PRK06023248 enoyl-CoA hydratase; Provisional 98.03
PRK05869225 enoyl-CoA hydratase; Validated 97.98
PRK07260260 enoyl-CoA hydratase; Provisional 97.94
PRK06144262 enoyl-CoA hydratase; Provisional 97.91
PRK08139265 enoyl-CoA hydratase; Validated 97.75
PRK06213229 enoyl-CoA hydratase; Provisional 97.55
TIGR00706224 SppA_dom signal peptide peptidase SppA, 36K type; Inter 95.52
cd07021178 Clp_protease_NfeD_like Nodulation formation efficiency 98.58
pfam00574182 CLP_protease Clp protease. The Clp protease has an acti 98.49
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficiency D ( 98.46
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 98.27
PRK07327271 enoyl-CoA hydratase; Provisional 98.25
PRK06494259 enoyl-CoA hydratase; Provisional 98.21
PRK05862257 enoyl-CoA hydratase; Provisional 98.19
cd07015172 Clp_protease_NfeD Nodulation formation efficiency D (Nf 98.19
PRK09674257 enoyl-CoA hydratase-isomerase; Provisional 98.17
PRK07658257 enoyl-CoA hydratase; Provisional 98.16
PRK07110257 polyketide biosynthesis enoyl-CoA hydratase; Validated 98.15
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 98.15
PRK00277197 clpP ATP-dependent Clp protease proteolytic subunit; Re 98.14
PRK12553204 ATP-dependent Clp protease proteolytic subunit; Reviewe 98.14
PRK07511259 enoyl-CoA hydratase; Provisional 98.1
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Reviewe 98.08
PRK07629261 consensus 98.06
CHL00028201 clpP ATP-dependent Clp protease proteolytic subunit 98.05
PRK07830267 consensus 98.04
PRK06127269 enoyl-CoA hydratase; Provisional 98.03
PRK07659260 enoyl-CoA hydratase; Provisional 97.99
PRK05995261 enoyl-CoA hydratase; Provisional 97.99
PRK03580262 carnitinyl-CoA dehydratase; Provisional 97.98
PRK06951254 consensus 97.97
PRK05980260 enoyl-CoA hydratase; Provisional 97.95
PRK06142271 enoyl-CoA hydratase; Provisional 97.9
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydrata 97.85
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [Postt 97.84
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid met 97.79
PRK06143260 enoyl-CoA hydratase; Provisional 97.79
PRK09076258 enoyl-CoA hydratase; Provisional 97.71
PRK05870254 enoyl-CoA hydratase; Provisional 97.69
PRK07509262 enoyl-CoA hydratase; Provisional 97.68
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteases [P 97.68
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Members o 97.64
PRK07510266 consensus 97.63
PRK06495257 enoyl-CoA hydratase; Provisional 97.61
PRK07799263 enoyl-CoA hydratase; Provisional 97.54
PRK07827255 enoyl-CoA hydratase; Provisional 97.51
PRK06210272 enoyl-CoA hydratase; Provisional 97.51
PRK08258270 enoyl-CoA hydratase; Provisional 97.49
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydrata 97.41
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 97.18
PRK08321302 naphthoate synthase; Validated 97.16
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptide pep 97.05
PRK05617 356 enoyl-CoA hydratase; Provisional 93.27
PRK09245266 enoyl-CoA hydratase; Provisional 98.05
pfam00378169 ECH Enoyl-CoA hydratase/isomerase family. This family c 97.94
PRK05674271 gamma-carboxygeranoyl-CoA hydratase; Validated 97.92
PRK05981266 enoyl-CoA hydratase; Provisional 97.9
PRK07657261 enoyl-CoA hydratase; Provisional 97.88
PRK08150264 enoyl-CoA hydratase; Provisional 97.87
PRK07854243 enoyl-CoA hydratase; Provisional 97.84
PRK08140262 enoyl-CoA hydratase; Provisional 97.82
PRK07468262 enoyl-CoA hydratase; Provisional 97.69
PRK05864269 enoyl-CoA hydratase; Provisional 97.67
PRK09120277 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 97.66
PRK08138260 enoyl-CoA hydratase; Provisional 97.65
PRK08259254 enoyl-CoA hydratase; Provisional 97.64
PRK06563255 enoyl-CoA hydratase; Provisional 97.54
PRK08252254 enoyl-CoA hydratase; Provisional 97.53
PRK06190258 enoyl-CoA hydratase; Provisional 97.49
PRK07112251 polyketide biosynthesis enoyl-CoA hydratase; Validated 97.45
PRK07396273 naphthoate synthase; Validated 97.45
PRK08272308 enoyl-CoA hydratase; Provisional 97.41
PRK07938249 enoyl-CoA hydratase; Provisional 97.36
PRK08260293 enoyl-CoA hydratase; Provisional 97.24
PRK12478298 enoyl-CoA hydratase; Provisional 97.11
PRK06072240 enoyl-CoA hydratase; Provisional 96.9
PRK08788286 enoyl-CoA hydratase; Validated 96.09
PRK11730 715 fadB multifunctional fatty acid oxidation complex subun 95.28
PRK11154 706 fadJ multifunctional fatty acid oxidation complex subun 94.17
PRK08290284 enoyl-CoA hydratase; Provisional 97.14
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabol 91.86
KOG1682287 consensus 90.99
pfam01343154 Peptidase_S49 Peptidase family S49. 93.64
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit; InterPro: IPR001095 This entry contains the alpha subunit the acetyl coenzyme A carboxylase complex (Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>pfam01039 Carboxyl_trans Carboxyl transferase domain Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit; InterPro: IPR005783 This family describes methymalonyl-CoA decarboxylase alpha subunit in archaea and bacteria Back     alignment and domain information
>KOG0540 consensus Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>pfam03255 ACCA Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>pfam01039 Carboxyl_trans Carboxyl transferase domain Back     alignment and domain information
>KOG0540 consensus Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit; InterPro: IPR005783 This family describes methymalonyl-CoA decarboxylase alpha subunit in archaea and bacteria Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>pfam06833 MdcE Malonate decarboxylase gamma subunit (MdcE) Back     alignment and domain information
>KOG1680 consensus Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit; InterPro: IPR000438 Fatty acid synthesis involves a set of reactions, commencing with carboxylation of acetyl-CoA to malonyl-CoA Back     alignment and domain information
>KOG0840 consensus Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>pfam01972 SDH_sah Serine dehydrogenase proteinase Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>KOG0016 consensus Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type; InterPro: IPR004635 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>pfam00574 CLP_protease Clp protease Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK07629 consensus Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>PRK07830 consensus Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK06951 consensus Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK07510 consensus Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>PRK05617 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>pfam00378 ECH Enoyl-CoA hydratase/isomerase family Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07396 naphthoate synthase; Validated Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>KOG1682 consensus Back     alignment and domain information
>pfam01343 Peptidase_S49 Peptidase family S49 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target317 acetyl-CoA carboxylase carboxyltransferase subunit alph
2f9y_A339 The Crystal Structure Of The Carboxyltransferase Su 9e-86
2f9i_A327 Crystal Structure Of The Carboxyltransferase Subuni 2e-75
1pix_A 587 Crystal Structure Of The Carboxyltransferase Subuni 0.003
2a7s_A548 Crystal Structure Of The Acyl-Coa Carboxylase, Accd 7e-19
1vrg_A527 Crystal Structure Of Propionyl-Coa Carboxylase, Bet 4e-17
1pix_A587 Crystal Structure Of The Carboxyltransferase Subuni 2e-04
2a7s_A 548 Crystal Structure Of The Acyl-Coa Carboxylase, Accd 8e-07
2bzr_A 548 Crystal Structure Of Accd5 (Rv3280), An Acyl-Coa Ca 8e-07
1on3_A 523 Transcarboxylase 12s Crystal Structure: Hexamer Ass 5e-04
3gf3_A 588 Glutaconyl-Coa Decarboxylase A Subunit From Clostri 0.002
1x0u_A522 Crystal Structure Of The Carboxyl Transferase Subun 1e-18
2bzr_A548 Crystal Structure Of Accd5 (Rv3280), An Acyl-Coa Ca 6e-18
1xnw_A530 Acyl-Coa Carboxylase Beta Subunit From S. Coelicolo 2e-17
3iav_A530 Propionyl-Coa Carboxylase Beta Subunit, D422v Lengt 2e-17
3ib9_A530 Propionyl-Coa Carboxylase Beta Subunit, D422l Lengt 2e-17
3ibb_A530 Propionyl-Coa Carboxylase Beta Subunit, D422a Lengt 4e-17
1xnv_A530 Acyl-Coa Carboxylase Beta Subunit From S. Coelicolo 5e-17
3mfm_C530 Crystal Structures And Mutational Analyses Of Acyl- 5e-17
1on3_A523 Transcarboxylase 12s Crystal Structure: Hexamer Ass 2e-15
3n6r_B531 Crystal Structure Of The Holoenzyme Of Propionyl-Co 3e-15
1xnw_A 530 Acyl-Coa Carboxylase Beta Subunit From S. Coelicolo 2e-06
3iav_A 530 Propionyl-Coa Carboxylase Beta Subunit, D422v Lengt 2e-06
3ib9_A 530 Propionyl-Coa Carboxylase Beta Subunit, D422l Lengt 2e-06
3ibb_A 530 Propionyl-Coa Carboxylase Beta Subunit, D422a Lengt 2e-06
1vrg_A 527 Crystal Structure Of Propionyl-Coa Carboxylase, Bet 9e-10
1xnv_A 530 Acyl-Coa Carboxylase Beta Subunit From S. Coelicolo 2e-06
3mfm_C 530 Crystal Structures And Mutational Analyses Of Acyl- 2e-06
>gi|122920145|pdb|2F9Y|A Chain A, The Crystal Structure Of The Carboxyltransferase Subunit Of Acc From Escherichia Coli Length = 339 Back     alignment and structure
 Score =  321 bits (822), Expect = 9e-86,   Method: Composition-based stats.
 Identities = 154/314 (49%), Positives = 211/314 (67%), Gaps = 2/314 (0%)

Query: 3   HYLDFEEPISDLEAKIHELKKLSREDINEDF--SEEIRELEAMVCKTLSEIYSKLTPWQK 60
           ++LDFE+PI++LEAKI  L   SR+D   D    EE+  L     +   +I++ L  WQ 
Sbjct: 24  NFLDFEQPIAELEAKIDSLTAGSRQDEKLDINIDEEVHRLREKSVELTRKIFADLGAWQI 83

Query: 61  TQVSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKGSD 120
            Q++RHP RP+ +DY+   F  F  LAGDR + DD A+  G+AR  G+PV IIG +KG +
Sbjct: 84  AQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQKGRE 143

Query: 121 TKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIAR 180
           TK +I+ NFG P PEGYRKA+RLM+MA+RFK+P+I+FIDT GAYPGV AE RGQ EAIAR
Sbjct: 144 TKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDTPGAYPGVGAEERGQSEAIAR 203

Query: 181 ATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIYSVISPEGAASILWRDSSR 240
                 +L VP++  +IGEGGSGGA+ I   + V ML+++ YSVISPEG ASILW+ + +
Sbjct: 204 NLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSADK 263

Query: 241 AAQAAIAMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTISSVGEIISQFLSETSTYSET 300
           A  AA AM II   L++L +ID IIPEP+GGAHRNP    +S+   +   L++    S  
Sbjct: 264 APLAAEAMGIIRPRLKELKLIDSIIPEPLGGAHRNPEAMAASLKAQLLADLADLDVLSTE 323

Query: 301 EIREHRRQKYLNIG 314
           +++  R Q+ ++ G
Sbjct: 324 DLKNRRYQRLMSYG 337


>gi|119389444|pdb|2F9I|A Chain A, Crystal Structure Of The Carboxyltransferase Subunit Of Acc From Staphylococcus Aureus Length = 327 Back     alignment and structure
gi|34810879|pdb|1PIX|A Chain A, Crystal Structure Of The Carboxyltransferase Subunit Of The Bacterial Ion Pump Glutaconyl-Coenzyme A Decarboxylase Length = 587 Back     alignment and structure
gi|90108669|pdb|2A7S|A Chain A, Crystal Structure Of The Acyl-Coa Carboxylase, Accd5, From Mycobacterium Tuberculosis Length = 548 Back     alignment and structure
>gi|62738152|pdb|1VRG|A Chain A, Crystal Structure Of Propionyl-Coa Carboxylase, Beta Subunit (Tm0716) From Thermotoga Maritima At 2.30 A Resolution Length = 527 Back     alignment and structure
gi|34810879|pdb|1PIX|A Chain A, Crystal Structure Of The Carboxyltransferase Subunit Of The Bacterial Ion Pump Glutaconyl-Coenzyme A Decarboxylase Length = 587 Back     alignment and structure
gi|90108669|pdb|2A7S|A Chain A, Crystal Structure Of The Acyl-Coa Carboxylase, Accd5, From Mycobacterium Tuberculosis Length = 548 Back     alignment and structure
>gi|126030147|pdb|2BZR|A Chain A, Crystal Structure Of Accd5 (Rv3280), An Acyl-Coa Carboxylase Beta-Subunit From Mycobacterium Tuberculosis Length = 548 Back     alignment and structure
>gi|31615813|pdb|1ON3|A Chain A, Transcarboxylase 12s Crystal Structure: Hexamer Assembly And Substrate Binding To A Multienzyme Core (With Methylmalonyl-Coenzyme A And Methylmalonic Acid Bound) Length = 523 Back     alignment and structure
gi|254839331|pdb|3GF3|A Chain A, Glutaconyl-Coa Decarboxylase A Subunit From Clostridium Symbiosum Co-Crystallized With Glutaconyl-Coa Length = 588 Back     alignment and structure
>gi|110590693|pdb|1X0U|A Chain A, Crystal Structure Of The Carboxyl Transferase Subunit Of Putative Pcc Of Sulfolobus Tokodaii Length = 522 Back     alignment and structure
>gi|126030147|pdb|2BZR|A Chain A, Crystal Structure Of Accd5 (Rv3280), An Acyl-Coa Carboxylase Beta-Subunit From Mycobacterium Tuberculosis Length = 548 Back     alignment and structure
>gi|56967176|pdb|1XNW|A Chain A, Acyl-Coa Carboxylase Beta Subunit From S. Coelicolor (Pccb), Apo Form #2, Mutant D422i Length = 530 Back     alignment and structure
>gi|299856690|pdb|3IAV|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422v Length = 530 Back     alignment and structure
>gi|297342944|pdb|3IB9|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422l Length = 530 Back     alignment and structure
>gi|297342946|pdb|3IBB|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422a Length = 530 Back     alignment and structure
gi|56967174|pdb|1XNV|A Chain A, Acyl-Coa Carboxylase Beta Subunit From S. Coelicolor (Pccb), Apo Form #1 Length = 530 Back     alignment and structure
>gi|308387843|pdb|3MFM|C Chain C, Crystal Structures And Mutational Analyses Of Acyl-Coa Carboxylase Subunit Of Streptomyces Coelicolor Length = 530 Back     alignment and structure
>gi|31615813|pdb|1ON3|A Chain A, Transcarboxylase 12s Crystal Structure: Hexamer Assembly And Substrate Binding To A Multienzyme Core (With Methylmalonyl-Coenzyme A And Methylmalonic Acid Bound) Length = 523 Back     alignment and structure
>gi|304445936|pdb|3N6R|B Chain B, Crystal Structure Of The Holoenzyme Of Propionyl-Coa Carboxylase (Pcc) Length = 531 Back     alignment and structure
>gi|56967176|pdb|1XNW|A Chain A, Acyl-Coa Carboxylase Beta Subunit From S. Coelicolor (Pccb), Apo Form #2, Mutant D422i Length = 530 Back     alignment and structure
>gi|299856690|pdb|3IAV|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422v Length = 530 Back     alignment and structure
>gi|297342944|pdb|3IB9|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422l Length = 530 Back     alignment and structure
>gi|297342946|pdb|3IBB|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422a Length = 530 Back     alignment and structure
>gi|62738152|pdb|1VRG|A Chain A, Crystal Structure Of Propionyl-Coa Carboxylase, Beta Subunit (Tm0716) From Thermotoga Maritima At 2.30 A Resolution Length = 527 Back     alignment and structure
gi|56967174|pdb|1XNV|A Chain A, Acyl-Coa Carboxylase Beta Subunit From S. Coelicolor (Pccb), Apo Form #1 Length = 530 Back     alignment and structure
>gi|308387843|pdb|3MFM|C Chain C, Crystal Structures And Mutational Analyses Of Acyl-Coa Carboxylase Subunit Of Streptomyces Coelicolor Length = 530 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target317 acetyl-CoA carboxylase carboxyltransferase subunit alph
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha chain 5e-83
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase subu 7e-73
3iav_A530 Propionyl-COA carboxylase complex B subunit; accase, pc 1e-37
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; doma 7e-35
1xny_A530 Pccase, propionyl-COA carboxylase complex B subunit, PC 1e-31
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, struct 3e-29
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase alpha subu 1e-28
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION tran 2e-27
3ff6_A 760 Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder 2e-25
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accase, pc 3e-06
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; doma 3e-06
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein comple 2e-07
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid bios 3e-04
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, struct 0.002
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION tran 2e-11
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein comple 5e-34
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid bios 2e-30
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dependen 3e-27
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dependen 2e-16
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltransferas 2e-26
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltransferas 7e-05
3ff6_A 760 Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder 1e-04
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha chain; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Length = 339 Back     alignment and structure
 Score =  303 bits (776), Expect = 5e-83
 Identities = 153/317 (48%), Positives = 213/317 (67%), Gaps = 2/317 (0%)

Query: 1   MRHYLDFEEPISDLEAKIHELKKLSRED--INEDFSEEIRELEAMVCKTLSEIYSKLTPW 58
             ++LDFE+PI++LEAKI  L   SR+D  ++ +  EE+  L     +   +I++ L  W
Sbjct: 22  SLNFLDFEQPIAELEAKIDSLTAGSRQDEKLDINIDEEVHRLREKSVELTRKIFADLGAW 81

Query: 59  QKTQVSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKG 118
           Q  Q++RHP RP+ +DY+   F  F  LAGDR + DD A+  G+AR  G+PV IIG +KG
Sbjct: 82  QIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQKG 141

Query: 119 SDTKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAI 178
            +TK +I+ NFG P PEGYRKA+RLM+MA+RFK+P+I+FIDT GAYPGV AE RGQ EAI
Sbjct: 142 RETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDTPGAYPGVGAEERGQSEAI 201

Query: 179 ARATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIYSVISPEGAASILWRDS 238
           AR      +L VP++  +IGEGGSGGA+ I   + V ML+++ YSVISPEG ASILW+ +
Sbjct: 202 ARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSA 261

Query: 239 SRAAQAAIAMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTISSVGEIISQFLSETSTYS 298
            +A  AA AM II   L++L +ID IIPEP+GGAHRNP    +S+   +   L++    S
Sbjct: 262 DKAPLAAEAMGIIRPRLKELKLIDSIIPEPLGGAHRNPEAMAASLKAQLLADLADLDVLS 321

Query: 299 ETEIREHRRQKYLNIGR 315
             +++  R Q+ ++ G 
Sbjct: 322 TEDLKNRRYQRLMSYGY 338


>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Length = 327 Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 1xny_A* 1xnv_A* 1xo6_A Length = 530 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Length = 523 Back     alignment and structure
>1xny_A Pccase, propionyl-COA carboxylase complex B subunit, PCC; polyketide, polyketide synthase, acyl-COA carboxylase, carboxyltransferase; HET: 191 BTN; 2.20A {Streptomyces coelicolor} SCOP: c.14.1.4 c.14.1.4 PDB: 1xnv_A* 1xo6_A 1xnw_A Length = 530 Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.30A {Thermotoga maritima MSB8} SCOP: c.14.1.4 c.14.1.4 Length = 527 Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase alpha subunit; lyase; 2.20A {Sulfolobus tokodaii str} Length = 522 Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Length = 588 Back     alignment and structure
>3ff6_A Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder, fatty acid metabolism, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis; HET: RCP; 3.19A {Homo sapiens} Length = 760 Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 1xny_A* 1xnv_A* 1xo6_A Length = 530 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Length = 523 Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans och 114} Length = 531 Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Length = 548 Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.30A {Thermotoga maritima MSB8} SCOP: c.14.1.4 c.14.1.4 Length = 527 Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Length = 588 Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans och 114} Length = 531 Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Length = 548 Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Length = 587 Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Length = 587 Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, CT, tepraloxydim, ATP-binding, biotin, cytoplasm, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 1od2_A* 1od4_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Length = 758 Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, CT, tepraloxydim, ATP-binding, biotin, cytoplasm, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 1od2_A* 1od4_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Length = 758 Back     alignment and structure
>3ff6_A Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder, fatty acid metabolism, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis; HET: RCP; 3.19A {Homo sapiens} Length = 760 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target317 acetyl-CoA carboxylase carboxyltransferase subunit alph
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase subu 100.0
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha chain 100.0
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, struct 100.0
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase alpha subu 100.0
3iav_A530 Propionyl-COA carboxylase complex B subunit; accase, pc 100.0
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid bios 100.0
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein comple 100.0
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; doma 100.0
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION tran 100.0
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dependen 100.0
3k8x_A758 Acetyl-COA carboxylase; transferase, carboxyltransferas 100.0
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein comple 99.86
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase alpha subu 99.85
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferase subu 99.83
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase subu 99.81
3ff6_A 760 Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder 99.67
3ff6_A760 Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder 100.0
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltransferas 99.7
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dependen 99.95
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; doma 99.9
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION tran 99.9
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid bios 99.88
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, struct 99.87
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accase, pc 99.87
3bpp_A230 1510-N membrane protease; specific for A stomatin homol 98.69
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrolase, 98.61
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydratase ho 98.39
2fbm_A291 Y chromosome chromodomain protein 1, telomeric isoform 98.38
2gtr_A261 CDY-like, chromodomain Y-like protein; structural genom 98.35
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, 98.32
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; structura 98.26
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; structu 98.23
3lke_A263 Enoyl-COA hydratase; nysgrc, target 11251J, structural 98.2
2f6i_A215 ATP-dependent CLP protease, putative; structural genomi 98.19
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; endopep 98.17
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomics, GK 98.13
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fold, th 98.12
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics center 98.1
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold 98.1
1tg6_A277 Putative ATP-dependent CLP protease proteolytic subunit 98.1
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; serin 98.08
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Escheric 98.06
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hydrola 98.05
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, 98.03
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid 98.03
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP02329, 98.02
2iex_A272 Dihydroxynapthoic acid synthetase; crotonase-like famil 98.02
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, structu 97.99
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula 19L} P 97.99
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structural g 97.98
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; isomer 97.96
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase 97.96
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seattle s 97.94
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; 97.94
3h02_A288 Naphthoate synthase; IDP00995, lyase, structural genomi 97.93
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} 97.92
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, structural 97.91
3pea_A261 Enoyl-COA hydratase/isomerase family protein; structura 97.88
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural genom 97.86
3fdu_A266