254780589

254780589

hypothetical protein CLIBASIA_02380

GeneID in NCBI database:8209586Locus tag:CLIBASIA_02380
Protein GI in NCBI database:254780589Protein Accession:YP_003065002.1
Gene range:-(694297, 695016)Protein Length:239aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein
SEED prediction:probable exported protein STY0357
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI
cHHHHHHHHHHHHHHHHHcccHHHHcccccccccHHHHHHHHHccccccccEEEEEEccccEEEEEEccccccEEEEEEEEccccccccccHHHccccccccEEEEEccccccccccEEEEEEcccccHHHHHHccccccEEEccccccccEEEEcHHHHHHHHHHHHHHcccccccEEEEEEEEcccccHHHHHcccccccHHHHHHHcccHHHHHHcccccEEEEccEEEEEccccc
ccHHHHHHHHHHHHHHHHccccHHHcccccccccHHHHHHHHHHcccccccEEEEEEccHcEEEEEEcccccccEEEEEEEEEccccccccccccccccccccEEEEEcccccccccHEEEEEcccccHHHHHHccccccEEEEcccccccEEEEcHHHHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHccccccHHHHHHcccccHHHHccccccEEEEccEEEEcccccc
MTNRYNILLFALFIFLNgchhsrslidkaehplseNLIISMqkkrtspfhptvirifknENILEIWKRNVDAEYVLLKEYKIcawsgtfgpkietgdeqapegfyyigwnnlnpnskyflsinigfpnefdkahnrtgadlmihgecasagcyaMNNKQMQEIYAIVRDSLRgnmqshiqiqafpfrmtsknmqlyqnnpnySFWNMLKLGHDyfeknhqepfIQIINKQYVFFKGQTI
MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISmqkkrtspfhPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI
MTNRYNillfalfiflNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI
*TNRYNILLFALFIFLNGCHHS************************SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG***
MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI
MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI
MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI
MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target239 hypothetical protein CLIBASIA_02380 [Candidatus Liberib
315121782212 hypothetical protein CKC_00160 [Candidatus Liberibacter 1 4e-95
209551176 409 hypothetical protein Rleg2_3600 [Rhizobium leguminosaru 1 1e-63
86359412 410 hypothetical protein RHE_CH03829 [Rhizobium etli CFN 42 1 2e-63
190893666 408 hypothetical protein RHECIAT_CH0004100 [Rhizobium etli 1 3e-63
327188715 408 hypothetical protein RHECNPAF_800017 [Rhizobium etli CN 1 3e-63
116254089 430 hypothetical protein RL4356 [Rhizobium leguminosarum bv 1 1e-62
241206579 408 ErfK/YbiS/YcfS/YnhG family protein [Rhizobium leguminos 1 1e-62
218462567265 hypothetical protein RetlK5_25260 [Rhizobium etli Kim 5 1 2e-62
158424938 425 hypothetical protein AZC_3314 [Azorhizobium caulinodans 1 2e-62
306843460 403 lipoprotein [Brucella sp. BO1] Length = 403 1 2e-62
>gi|315121782|ref|YP_004062271.1| hypothetical protein CKC_00160 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 212 Back     alignment and organism information
 Score =  351 bits (901), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 154/211 (72%), Positives = 188/211 (89%)

Query: 25  LIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICA 84
           ++DKAE+PL ++L+  M+KK+TSP+HP++IRIFK ENILEIWK   DA+Y+LLK+YKICA
Sbjct: 1   MVDKAEYPLPKSLVRYMEKKKTSPYHPSLIRIFKEENILEIWKYTYDAQYILLKQYKICA 60

Query: 85  WSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIH 144
           WSG  GPKIETGD Q+PEGFYYIGWNNLNPNSKY+LSINIGFPNEFD+ HNRTG D+MIH
Sbjct: 61  WSGIIGPKIETGDRQSPEGFYYIGWNNLNPNSKYYLSINIGFPNEFDREHNRTGTDIMIH 120

Query: 145 GECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF 204
           G C+SAGCYAMN+KQ+ EIYAI+RDSLRG MQS+IQ+QAFPFRMT +NM+ YQ +P+Y F
Sbjct: 121 GGCSSAGCYAMNDKQILEIYAIIRDSLRGKMQSYIQVQAFPFRMTQENMKRYQTHPDYFF 180

Query: 205 WNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           WN+LK+G+DYFE NH EP +Q++NKQYVF K
Sbjct: 181 WNILKIGYDYFENNHLEPIVQVLNKQYVFLK 211


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209551176|ref|YP_002283093.1| hypothetical protein Rleg2_3600 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 409 Back     alignment and organism information
>gi|86359412|ref|YP_471304.1| hypothetical protein RHE_CH03829 [Rhizobium etli CFN 42] Length = 410 Back     alignment and organism information
>gi|190893666|ref|YP_001980208.1| hypothetical protein RHECIAT_CH0004100 [Rhizobium etli CIAT 652] Length = 408 Back     alignment and organism information
>gi|327188715|gb|EGE55914.1| hypothetical protein RHECNPAF_800017 [Rhizobium etli CNPAF512] Length = 408 Back     alignment and organism information
>gi|116254089|ref|YP_769927.1| hypothetical protein RL4356 [Rhizobium leguminosarum bv. viciae 3841] Length = 430 Back     alignment and organism information
>gi|241206579|ref|YP_002977675.1| ErfK/YbiS/YcfS/YnhG family protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 408 Back     alignment and organism information
>gi|218462567|ref|ZP_03502658.1| hypothetical protein RetlK5_25260 [Rhizobium etli Kim 5] Length = 265 Back     alignment and organism information
>gi|158424938|ref|YP_001526230.1| hypothetical protein AZC_3314 [Azorhizobium caulinodans ORS 571] Length = 425 Back     alignment and organism information
>gi|306843460|ref|ZP_07476061.1| lipoprotein [Brucella sp. BO1] Length = 403 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target239 hypothetical protein CLIBASIA_02380 [Candidatus Liberib
pfam03734122 pfam03734, YkuD, L,D-transpeptidase catalytic domain 1e-09
COG3034298 COG3034, COG3034, Uncharacterized protein conserved in 3e-57
>gnl|CDD|146395 pfam03734, YkuD, L,D-transpeptidase catalytic domain Back     alignment and domain information
>gnl|CDD|32849 COG3034, COG3034, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 239 hypothetical protein CLIBASIA_02380 [Candidatus Liberib
COG3034298 Uncharacterized protein conserved in bacteria [Function 100.0
pfam03734122 YkuD L,D-transpeptidase catalytic domain. This family o 99.59
PRK06132 365 hypothetical protein; Provisional 98.58
PRK10260306 hypothetical protein; Provisional 98.55
PRK10190310 hypothetical protein; Provisional 98.53
COG3786217 Uncharacterized protein conserved in bacteria [Function 98.44
COG1376232 ErfK Uncharacterized protein conserved in bacteria [Fun 97.78
PRK12472 512 hypothetical protein; Provisional 97.67
pfam10908121 DUF2778 Protein of unknown function (DUF2778). This is 93.23
>COG3034 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam03734 YkuD L,D-transpeptidase catalytic domain Back     alignment and domain information
>PRK06132 hypothetical protein; Provisional Back     alignment and domain information
>PRK10260 hypothetical protein; Provisional Back     alignment and domain information
>PRK10190 hypothetical protein; Provisional Back     alignment and domain information
>COG3786 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1376 ErfK Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK12472 hypothetical protein; Provisional Back     alignment and domain information
>pfam10908 DUF2778 Protein of unknown function (DUF2778) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target239 hypothetical protein CLIBASIA_02380 [Candidatus Liberib
1y7m_A164 Crystal Structure Of The B. Subtilis Ykud Protein A 0.004
>gi|61680534|pdb|1Y7M|A Chain A, Crystal Structure Of The B. Subtilis Ykud Protein At 2 A Resolution Length = 164 Back     alignment and structure
 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 43/130 (33%), Gaps = 33/130 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I +      L +   N      + K Y I         KI T   Q P G +YI   
Sbjct: 55  PYHIAVSIGAKTLTLSLNN-----RVXKTYPIAVG------KILT---QTPTGEFYIINR 100

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
             NP   +  +  +        +    G    IHG           S GC   +NK + E
Sbjct: 101 QRNPGGPF-GAYWLS------LSAAHYG----IHGTNNPASIGKAVSKGCIRXHNKDVIE 149

Query: 163 IYAIVRDSLR 172
           + +IV +  R
Sbjct: 150 LASIVPNGTR 159


Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target239 hypothetical protein CLIBASIA_02380 [Candidatus Liberib
1y7m_A164 Hypothetical protein BSU14040; surface mutagenesis, cys 99.47
1zat_A250 L,D-transpeptidase; L,D-transpeptidation, peptidoglycan 99.39
>1y7m_A Hypothetical protein BSU14040; surface mutagenesis, cysteine proteases, cell WALL catabolism, structural genomics, PSI; 2.05A {Bacillus subtilis subsp} SCOP: b.160.1.1 d.7.1.1 Back     alignment and structure
Probab=99.47  E-value=4.2e-13  Score=99.85  Aligned_cols=95  Identities=28%  Similarity=0.373  Sum_probs=75.1

Q ss_pred             CCCCEEEEEECCCCEEEEEEECCCCCEEEEEEEEECCCCCCCCCHHCCCCCCCCCEEEEEEECCCCCCCCC-CEEEECCC
Q ss_conf             57847999983786999986078896689998652132389887010178747507999840125875765-21420799
Q gi|254780589|r   48 PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY-FLSINIGF  126 (239)
Q Consensus        48 ~~~pi~Irv~K~e~~Lel~~~~~~g~~~l~ktY~Ic~~sg~lGpK~~eGD~kTPEG~Y~i~~~~~np~S~y-~ls~~i~Y  126 (239)
                      ...|..|.|.+++++|.+|..+     +++++|||+.|.         .+.+||+|.|.|..+..+|++-+ ..++.++ 
T Consensus        52 ~~~~~~i~V~~~~~~l~~~~~~-----~~v~~~pv~~G~---------~~~~TP~G~~~i~~k~~~~~~p~g~~~~~l~-  116 (164)
T 1y7m_A           52 YTIPYHIAVSIGAKTLTLSLNN-----RVMKTYPIAVGK---------ILTQTPTGEFYIINRQRNPGGPFGAYWLSLS-  116 (164)
T ss_dssp             GGCCEEEEEETTTTEEEEEETT-----EEEEEEECBEEB---------TTBCCCCEEEEEEEEEECCCGGGTTEEEEES-
T ss_pred             CCCCCEEEEECCCCEEEEEECC-----EEEEEEEECCCC---------CCCCCCCCEEEEEEECCCCCCCCCCEEEECC-
T ss_conf             6798179995786589999799-----599998620457---------9996545269996322689998511687547-


Q ss_pred             CCHHHHHCCCCCCCEEECCCC--------CCCCCEEECHHHHHHHHHHHH
Q ss_conf             898899729998826871677--------866718706466999999999
Q gi|254780589|r  127 PNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIVR  168 (239)
Q Consensus       127 PN~~Dr~~grtG~~I~IHG~~--------~S~GC~amtd~~i~EIy~~v~  168 (239)
                                 ++++.|||+.        .|+|||.|+|++++++|.+++
T Consensus       117 -----------~~~~~IHGt~~p~~ig~~~ShGCIrl~~~d~~~l~~~v~  155 (164)
T 1y7m_A          117 -----------AAHYGIHGTNNPASIGKAVSKGCIRMHNKDVIELASIVP  155 (164)
T ss_dssp             -----------STTCEEECCSCGGGTTSEEESSCEECCHHHHHHHHHHCC
T ss_pred             -----------CCEEEEEECCCCCCCCCCCCCCEECCCHHHHHHHHHCCC
T ss_conf             -----------732899851155557985778870639999999996199



>1zat_A L,D-transpeptidase; L,D-transpeptidation, peptidoglycan, beta-lactam insensitive transpeptidase, antibiotic resistance, transferase; 2.40A {Enterococcus faecium} SCOP: b.160.1.1 d.335.1.1 PDB: 2hkl_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target239 hypothetical protein CLIBASIA_02380 [Candidatus Liberib
d1zata1128 L,D-transpeptidase, C-terminal, catalytic domain {Enter 99.46
d1y7ma1116 Hypothetical protein YkuD, C-terminal domain {Bacillus 99.36
>d1zata1 b.160.1.1 (A:339-466) L,D-transpeptidase, C-terminal, catalytic domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
class: All beta proteins
fold: L,D-transpeptidase catalytic domain-like
superfamily: L,D-transpeptidase catalytic domain-like
family: L,D-transpeptidase catalytic domain-like
domain: L,D-transpeptidase, C-terminal, catalytic domain
species: Enterococcus faecium [TaxId: 1352]
Probab=99.46  E-value=4.6e-14  Score=104.35  Aligned_cols=104  Identities=16%  Similarity=0.181  Sum_probs=84.7

Q ss_pred             CEEEEEECCCCEEEEEEECCCCCEEEEEEEEECCCCCCCCCHHCCCCCCCCCEEEEEEECCCCCCCCCCEEEECCCCCHH
Q ss_conf             47999983786999986078896689998652132389887010178747507999840125875765214207998988
Q gi|254780589|r   51 PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEF  130 (239)
Q Consensus        51 pi~Irv~K~e~~Lel~~~~~~g~~~l~ktY~Ic~~sg~lGpK~~eGD~kTPEG~Y~i~~~~~np~S~y~ls~~i~YPN~~  130 (239)
                      ..+|.|++++++|.||..+     +++++|+|+.|+.         +..||+|.|.|..+..++....+......|.+..
T Consensus         4 ~~~I~Vdl~~q~l~l~~~g-----~~v~~~~vs~G~~---------~~~Tp~G~~~I~~k~~~~~~~~~~~~~~~~~~~~   69 (128)
T d1zata1           4 DTYIEVDLENQHMWYYKDG-----KVALETDIVSGKP---------TTPTPAGVFYVWNKEEDATLKGTNDDGTPYESPV   69 (128)
T ss_dssp             SCEEEEETTTTEEEEEETT-----EEEEEEECBCBCT---------TSCCCCEEEECCCCEEEEECCBCC--CCCBCCEE
T ss_pred             CCEEEEECCCCEEEEEECC-----EEEEEEECCCCCC---------CCCCCCCEEEEEEECCCCEEECCCCCCCCCCCCH
T ss_conf             7199999867999999999-----9999855679988---------9847776488864127851234557788867603


Q ss_pred             HHHCCCCCCCEEECCCC-------------CCCCCEEECHHHHHHHHHHHH
Q ss_conf             99729998826871677-------------866718706466999999999
Q gi|254780589|r  131 DKAHNRTGADLMIHGEC-------------ASAGCYAMNNKQMQEIYAIVR  168 (239)
Q Consensus       131 Dr~~grtG~~I~IHG~~-------------~S~GC~amtd~~i~EIy~~v~  168 (239)
                      .......++++.|||..             +|+|||.|.|+++++||.++.
T Consensus        70 ~~~~~~~~~~~~~hg~~~~~~~~~~~~g~~~ShGCIRl~~~da~~ly~~v~  120 (128)
T d1zata1          70 NYWMPIDWTGVGIHDSDWQPEYGGDLWKTRGSHGCINTPPSVMKELFGMVE  120 (128)
T ss_dssp             EEEEECSSSSCEEEECTTCSCCSTTHHHHHCBSSSEEECHHHHHHHHHHCC
T ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCC
T ss_conf             456541687201357865443235545787887656769899999996299



>d1y7ma1 b.160.1.1 (A:49-164) Hypothetical protein YkuD, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target239 hypothetical protein CLIBASIA_02380 [Candidatus Liberib
1y7m_A_51-164114 Hypothetical protein BSU14040; surface mutagenesis 99.32
1zat_A_250 L,D-transpeptidase; L,D-transpeptidation, peptidog 99.27
>1y7m_A (A:51-164) Hypothetical protein BSU14040; surface mutagenesis, cysteine proteases, cell WALL catabolism, structural genomics, PSI; 2.05A {Bacillus subtilis subsp} Back     alignment and structure
Probab=99.32  E-value=6.9e-12  Score=93.30  Aligned_cols=94  Identities=28%  Similarity=0.303  Sum_probs=74.9

Q ss_pred             CCEEEEEECCCCEEEEEEECCCCCEEEEEEEEECCCCCCCCCHHCCCCCCCCCEEEEEEECCCCCCCCCCEEEECCCCCH
Q ss_conf             84799998378699998607889668999865213238988701017874750799984012587576521420799898
Q gi|254780589|r   50 HPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNE  129 (239)
Q Consensus        50 ~pi~Irv~K~e~~Lel~~~~~~g~~~l~ktY~Ic~~sg~lGpK~~eGD~kTPEG~Y~i~~~~~np~S~y~ls~~i~YPN~  129 (239)
                      .+..|.|.+.++.|.+|..+     +++++|+|+.|.         +|..||+|.|.|..+.-++.+  .......|.  
T Consensus         4 ~~~~I~Vd~~~~~l~~~~~g-----~~~~~~~vs~G~---------~~~~TP~G~~~v~~k~~~~~~--~~~~~~~~~--   65 (114)
T 1y7m_A            4 IPYHIAVSIGAKTLTLSLNN-----RVXKTYPIAVGK---------ILTQTPTGEFYIINRQRNPGG--PFGAYWLSL--   65 (114)
T ss_dssp             CCEEEEEETTTTEEEEEETT-----EEEEEEECBEEB---------TTBCCCCEEEEEEEEEECCCG--GGTTEEEEE--
T ss_pred             CCCCCCCCHHHCEEEECCCC-----CEEEEECCCCCC---------CCCCCCCCEEEEECCCCCCCC--CCCCEEECC--
T ss_conf             33200133122101110577-----279982355566---------899799850784212345567--764325316--


Q ss_pred             HHHHCCCCCCCEEECCCC--------CCCCCEEECHHHHHHHHHHHH
Q ss_conf             899729998826871677--------866718706466999999999
Q gi|254780589|r  130 FDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIVR  168 (239)
Q Consensus       130 ~Dr~~grtG~~I~IHG~~--------~S~GC~amtd~~i~EIy~~v~  168 (239)
                             .++++.|||..        +|+|||.|.++++++||.++.
T Consensus        66 -------~~~g~~ihg~~~~~~~g~~~ShGCIrl~~~da~~ly~~~~  105 (114)
T 1y7m_A           66 -------SAAHYGIHGTNNPASIGKAVSKGCIRXHNKDVIELASIVP  105 (114)
T ss_dssp             -------SSTTCEEECCSCGGGTTSEEESSCEECCHHHHHHHHHHCC
T ss_pred             -------CCCCEEECCEECCCCCCCCCCCCCCCCCHHHHHHHHHCCC
T ss_conf             -------7643776440564446997888871729999999996099



>1zat_A (A:) L,D-transpeptidase; L,D-transpeptidation, peptidoglycan, beta-lactam insensitive transpeptidase, antibiotic resistance, transferase; 2.40A {Enterococcus faecium} Back     alignment and structure