254780595

254780595

nucleoside-diphosphate-sugar epimerase protein

GeneID in NCBI database:8209592Locus tag:CLIBASIA_02410
Protein GI in NCBI database:254780595Protein Accession:YP_003065008.1
Gene range:-(688736, 689605)Protein Length:289aa
Gene description:nucleoside-diphosphate-sugar epimerase protein
COG prediction:[M] [G] Nucleoside-diphosphate-sugar epimerases
KEGG prediction:nucleoside-diphosphate-sugar epimerase protein
SEED prediction:Nucleoside-diphosphate-sugar epimerases
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL
cEEEEEcccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHccccEEEccccccHHHHHHHcccccEEEEEcccHHHccHHHHHHHHHHHHHHccccccEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHcccccEEccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHcccccccccccccccccHHHHHccccccccHHHHHHcccccccccHHHHHHHHHHHHHcc
cEEEEEcccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHccccEEEccccccccHHHHHHccccEEEEEccccccccHHHHHHHHHHHHccccccEEEEEEEccEcccccccEEccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHccccEEccccccEEEEEcHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHcccccccccHHHccccccHHHcccccccccHHHHHHcccccccccHHHHHHHHHHccccc
mhlmifgagytgkFIADAALKVGVYTCGTTRSVSNLLtlkhkgispflfADQKINNLLREKLYFTTHIVQcikpssegdpciismSKDFYKFMPHVKWIGYlsstsiygnregqwvdehsfvhpiscvATQRFNAEKEWLAITKKLNIKLAVLRLsgiygpkrnpfikirqknslrlvkknqvfnrirvEDVARCVIFLMTHHlggifnlsddepappqnVIMEAASLmkitppleqcfdtanispftrffYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL
MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQcikpssegdpCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRlsgiygpkrnpfikirqknslrlvkknqvfnrirvEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL
MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL
MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIR**********NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL
MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL
MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL
MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL
MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target289 nucleoside-diphosphate-sugar epimerase protein [Candida
315121795289 nucleoside-diphosphate-sugar epimerase protein [Candida 1 1e-132
222084590298 nucleoside-diphosphate-sugar epimerase protein [Agrobac 1 9e-81
116250093289 hypothetical protein RL0325 [Rhizobium leguminosarum bv 1 2e-80
86355964289 putative nucleoside-diphosphate-sugar epimerase protein 1 2e-79
209551885289 NAD-dependent epimerase/dehydratase [Rhizobium legumino 1 1e-78
241207262290 NAD-dependent epimerase/dehydratase [Rhizobium legumino 1 2e-78
222147272298 hypothetical protein Avi_0339 [Agrobacterium vitis S4] 1 5e-78
190889975289 nucleoside-diphosphate-sugar epimerase [Rhizobium etli 1 9e-78
327192011286 putative nucleoside-diphosphate-sugar epimerase protein 1 1e-76
15964078291 hypothetical protein SMc00405 [Sinorhizobium meliloti 1 1 1e-75
>gi|315121795|ref|YP_004062284.1| nucleoside-diphosphate-sugar epimerase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 289 Back     alignment and organism information
 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 217/289 (75%), Positives = 259/289 (89%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MHLMIFGAGY G+FIADAALK+G++T GTTRS SNL TLK+KGIS FLFA+QKIN+ L++
Sbjct: 1   MHLMIFGAGYAGQFIADAALKIGIHTSGTTRSESNLQTLKNKGISAFLFANQKINSTLQK 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           KLY  TH+VQCIKP  E DPCI+SM ++ YKF+P++KWIGYLSSTS+YGNR GQWVDE +
Sbjct: 61  KLYSITHVVQCIKPEFESDPCILSMGEELYKFIPNIKWIGYLSSTSVYGNRAGQWVDEQT 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            +HPIS  ATQRF  EK+W++I KKL+IK+A+LRLSGIYGPKRNPFI I+QK S+RL+KK
Sbjct: 121 PIHPISYTATQRFEVEKKWISIAKKLDIKIAILRLSGIYGPKRNPFITIKQKKSVRLIKK 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           +QVFNRIRVED+A+CVIFLM ++LGGIFN+SDDEP+PPQNVIMEAASLMK+ PPLEQ FD
Sbjct: 181 DQVFNRIRVEDIAQCVIFLMKNNLGGIFNVSDDEPSPPQNVIMEAASLMKVNPPLEQYFD 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL 289
           TA +SP TR FYADNKRISNAKIKSLGF+LLYPNYRISLKQLW++ +N+
Sbjct: 241 TAKVSPITRLFYADNKRISNAKIKSLGFRLLYPNYRISLKQLWEDDKNI 289


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084590|ref|YP_002543119.1| nucleoside-diphosphate-sugar epimerase protein [Agrobacterium radiobacter K84] Length = 298 Back     alignment and organism information
>gi|116250093|ref|YP_765931.1| hypothetical protein RL0325 [Rhizobium leguminosarum bv. viciae 3841] Length = 289 Back     alignment and organism information
>gi|86355964|ref|YP_467856.1| putative nucleoside-diphosphate-sugar epimerase protein [Rhizobium etli CFN 42] Length = 289 Back     alignment and organism information
>gi|209551885|ref|YP_002283802.1| NAD-dependent epimerase/dehydratase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 289 Back     alignment and organism information
>gi|241207262|ref|YP_002978358.1| NAD-dependent epimerase/dehydratase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 290 Back     alignment and organism information
>gi|222147272|ref|YP_002548229.1| hypothetical protein Avi_0339 [Agrobacterium vitis S4] Length = 298 Back     alignment and organism information
>gi|190889975|ref|YP_001976517.1| nucleoside-diphosphate-sugar epimerase [Rhizobium etli CIAT 652] Length = 289 Back     alignment and organism information
>gi|327192011|gb|EGE58992.1| putative nucleoside-diphosphate-sugar epimerase protein [Rhizobium etli CNPAF512] Length = 286 Back     alignment and organism information
>gi|15964078|ref|NP_384431.1| hypothetical protein SMc00405 [Sinorhizobium meliloti 1021] Length = 291 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target289 nucleoside-diphosphate-sugar epimerase protein [Candida
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases 3e-14
COG1091281 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell e 8e-06
KOG0747331 KOG0747, KOG0747, KOG0747, Putative NAD+-dependent epim 4e-15
pfam01370235 pfam01370, Epimerase, NAD dependent epimerase/dehydrata 3e-05
COG1090297 COG1090, COG1090, Predicted nucleoside-diphosphate suga 0.001
>gnl|CDD|30800 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|31288 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|35966 KOG0747, KOG0747, KOG0747, Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|144821 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|31287 COG1090, COG1090, Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 289 nucleoside-diphosphate-sugar epimerase protein [Candida
TIGR01181340 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: 100.0
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 100.0
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 100.0
TIGR01179341 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synon 100.0
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 100.0
PRK10675338 UDP-galactose-4-epimerase; Provisional 100.0
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 100.0
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisio 100.0
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 100.0
KOG0747331 consensus 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biog 100.0
TIGR01777307 yfcH conserved hypothetical protein TIGR01777; InterPro 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, 100.0
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell enve 100.0
TIGR02197353 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; 100.0
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [Gener 100.0
KOG1429350 consensus 100.0
TIGR01214317 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005 100.0
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 100.0
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 100.0
KOG1502327 consensus 100.0
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi 100.0
KOG1371343 consensus 100.0
KOG1430361 consensus 99.97
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis 99.93
KOG1431315 consensus 99.93
TIGR01472365 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368 Th 99.9
TIGR02622361 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: I 99.88
KOG3019315 consensus 99.88
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G 99.81
KOG1372376 consensus 99.75
PRK12320 699 hypothetical protein; Provisional 99.7
pfam01073280 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase 100.0
pfam02719280 Polysacc_synt_2 Polysaccharide biosynthesis protein. Th 100.0
CHL00194319 ycf39 Ycf39; Provisional 99.97
PRK07201 663 short chain dehydrogenase; Provisional 99.97
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzy 99.94
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase 99.92
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 99.92
TIGR01746405 Thioester-redct thioester reductase domain; InterPro: I 99.89
COG3320382 Putative dehydrogenase domain of multifunctional non-ri 99.85
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases [Cell 99.78
COG1086588 Predicted nucleoside-diphosphate sugar epimerases [Cell 99.77
PRK05865 854 hypothetical protein; Provisional 99.67
KOG2865391 consensus 99.64
KOG1221467 consensus 99.53
KOG2774366 consensus 99.37
PRK09009235 C factor cell-cell signaling protein; Provisional 98.98
PRK06483236 short chain dehydrogenase; Provisional 98.91
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 98.86
PRK05875277 short chain dehydrogenase; Provisional 98.78
PRK07890258 short chain dehydrogenase; Provisional 98.77
PRK07479252 consensus 98.75
PRK06953222 short chain dehydrogenase; Provisional 98.72
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.71
PRK08177225 short chain dehydrogenase; Provisional 98.7
PRK07856254 short chain dehydrogenase; Provisional 98.67
PRK07677254 short chain dehydrogenase; Provisional 98.63
PRK07774250 short chain dehydrogenase; Provisional 98.62
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 98.61
PRK12828239 short chain dehydrogenase; Provisional 98.6
PRK09134256 short chain dehydrogenase; Provisional 98.55
PRK07067256 sorbitol dehydrogenase; Provisional 98.55
PRK09135249 pteridine reductase; Provisional 98.52
PRK05867253 short chain dehydrogenase; Provisional 98.52
PRK08085254 gluconate 5-dehydrogenase; Provisional 98.48
PRK07806248 short chain dehydrogenase; Provisional 98.46
PRK07831261 short chain dehydrogenase; Provisional 98.46
PRK08339263 short chain dehydrogenase; Provisional 98.45
PRK07478254 short chain dehydrogenase; Provisional 98.37
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 98.33
PRK08324676 short chain dehydrogenase; Validated 98.33
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 98.29
PRK12747252 short chain dehydrogenase; Provisional 98.28
PRK06194301 hypothetical protein; Provisional 98.27
PRK06463254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.27
PRK07985294 oxidoreductase; Provisional 98.27
PRK12745259 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 98.26
PRK06128300 oxidoreductase; Provisional 98.2
PRK07063259 short chain dehydrogenase; Provisional 98.15
PRK08226263 short chain dehydrogenase; Provisional 98.1
PRK07791285 short chain dehydrogenase; Provisional 97.88
PRK07792303 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.51
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 96.91
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 100.0
pfam07993245 NAD_binding_4 Male sterility protein. This family repre 99.91
COG2910211 Putative NADH-flavin reductase [General function predic 99.48
PRK10538248 3-hydroxy acid dehydrogenase; Provisional 99.17
PRK08017256 short chain dehydrogenase; Provisional 99.15
PRK06101241 short chain dehydrogenase; Provisional 99.13
PRK08340259 glucose-1-dehydrogenase; Provisional 99.12
KOG1203411 consensus 99.11
PRK07102243 short chain dehydrogenase; Provisional 99.03
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 98.96
PRK05872296 short chain dehydrogenase; Provisional 98.95
PRK05599246 hypothetical protein; Provisional 98.94
PRK07454241 short chain dehydrogenase; Provisional 98.92
PRK08219226 short chain dehydrogenase; Provisional 98.91
PRK07024256 short chain dehydrogenase; Provisional 98.9
PRK08267258 short chain dehydrogenase; Provisional 98.89
PRK09072262 short chain dehydrogenase; Provisional 98.88
PRK08251248 short chain dehydrogenase; Provisional 98.86
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.86
PRK05650270 short chain dehydrogenase; Provisional 98.86
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.83
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.83
PRK07326235 short chain dehydrogenase; Provisional 98.82
PRK06924251 short chain dehydrogenase; Provisional 98.82
PRK07578199 short chain dehydrogenase; Provisional 98.82
PRK08703239 short chain dehydrogenase; Provisional 98.81
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.8
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 98.78
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 98.78
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 98.78
PRK07832272 short chain dehydrogenase; Provisional 98.77
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.76
PRK07060245 short chain dehydrogenase; Provisional 98.74
PRK08945245 short chain dehydrogenase; Provisional 98.74
PRK09186255 flagellin modification protein A; Provisional 98.73
PRK07825273 short chain dehydrogenase; Provisional 98.73
PRK06181263 short chain dehydrogenase; Provisional 98.71
PRK07775275 short chain dehydrogenase; Provisional 98.71
PRK06139324 short chain dehydrogenase; Provisional 98.71
PRK07577234 short chain dehydrogenase; Provisional 98.69
PRK07201663 short chain dehydrogenase; Provisional 98.69
PRK12824245 acetoacetyl-CoA reductase; Provisional 98.69
PRK07035252 short chain dehydrogenase; Provisional 98.68
PRK05884223 short chain dehydrogenase; Provisional 98.67
PRK12939250 short chain dehydrogenase; Provisional 98.64
PRK07041240 short chain dehydrogenase; Provisional 98.63
COG4221246 Short-chain alcohol dehydrogenase of unknown specificit 98.63
PRK05717255 oxidoreductase; Validated 98.62
PRK06550237 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.62
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisional 98.62
PRK07776252 consensus 98.62
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 98.6
PRK06124259 gluconate 5-dehydrogenase; Provisional 98.6
TIGR01830238 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reducta 98.6
PRK06346251 consensus 98.6
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 98.59
PRK07109338 short chain dehydrogenase; Provisional 98.58
PRK08265261 short chain dehydrogenase; Provisional 98.55
PRK06125259 short chain dehydrogenase; Provisional 98.55
PRK09242258 tropinone reductase; Provisional 98.55
PRK06500249 short chain dehydrogenase; Provisional 98.54
PRK08277278 D-mannonate oxidoreductase; Provisional 98.54
PRK07707239 consensus 98.53
PRK06057255 short chain dehydrogenase; Provisional 98.52
PRK07097265 gluconate 5-dehydrogenase; Provisional 98.52
PRK12742237 oxidoreductase; Provisional 98.52
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 98.49
PRK06523260 short chain dehydrogenase; Provisional 98.49
PRK06841255 short chain dehydrogenase; Provisional 98.46
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 98.45
PRK07904253 short chain dehydrogenase; Provisional 98.45
PRK06172253 short chain dehydrogenase; Provisional 98.44
PRK07576260 short chain dehydrogenase; Provisional 98.44
PRK07074256 short chain dehydrogenase; Provisional 98.43
PRK09730247 hypothetical protein; Provisional 98.41
PRK08213259 gluconate 5-dehydrogenase; Provisional 98.41
PRK07523251 gluconate 5-dehydrogenase; Provisional 98.4
PRK06701289 short chain dehydrogenase; Provisional 98.36
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 98.35
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisional 98.34
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 98.34
PRK06138252 short chain dehydrogenase; Provisional 98.34
PRK12827251 short chain dehydrogenase; Provisional 98.33
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.33
PRK07062265 short chain dehydrogenase; Provisional 98.32
PRK05866290 short chain dehydrogenase; Provisional 98.3
PRK12743253 acetoin dehydrogenase; Provisional 98.3
PRK08643256 acetoin reductase; Validated 98.3
PRK06484 530 short chain dehydrogenase; Validated 98.29
PRK07814263 short chain dehydrogenase; Provisional 98.29
PRK08594256 enoyl-(acyl carrier protein) reductase; Provisional 98.29
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 98.29
PRK06949258 short chain dehydrogenase; Provisional 98.28
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 98.28
PRK08628258 short chain dehydrogenase; Provisional 98.27
PRK06227256 consensus 98.27
PRK12829264 short chain dehydrogenase; Provisional 98.27
PRK06484530 short chain dehydrogenase; Validated 98.26
PRK06198268 short chain dehydrogenase; Provisional 98.26
PRK06398256 aldose dehydrogenase; Validated 98.24
PRK12859257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 98.23
PRK12746254 short chain dehydrogenase; Provisional 98.23
PRK12428261 3-alpha-hydroxysteroid dehydrogenase; Provisional 98.23
PRK12938246 acetyacetyl-CoA reductase; Provisional 98.22
PRK05876275 short chain dehydrogenase; Provisional 98.21
PRK08278273 short chain dehydrogenase; Provisional 98.2
PRK06077249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.19
PRK12744257 short chain dehydrogenase; Provisional 98.18
PRK12937245 short chain dehydrogenase; Provisional 98.17
PRK06123249 short chain dehydrogenase; Provisional 98.16
PRK06947252 glucose-1-dehydrogenase; Provisional 98.12
PRK07069251 short chain dehydrogenase; Validated 98.11
PRK08589272 short chain dehydrogenase; Validated 98.1
PRK12935247 acetoacetyl-CoA reductase; Provisional 98.09
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.08
PRK08936261 glucose-1-dehydrogenase; Provisional 98.06
PRK12748257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 98.06
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.05
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 98.04
PRK06114262 short chain dehydrogenase; Provisional 98.0
PRK07533254 enoyl-(acyl carrier protein) reductase; Provisional 98.0
TIGR01829244 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR 97.99
PRK07370259 enoyl-(acyl carrier protein) reductase; Validated 97.99
PRK05855582 short chain dehydrogenase; Validated 97.97
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 97.96
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisional 97.92
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisional 97.91
KOG1205282 consensus 97.9
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisional 97.81
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisional 97.8
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 97.77
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisional 97.74
TIGR01963258 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR01 97.72
PRK06940277 short chain dehydrogenase; Provisional 97.64
PRK08261447 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.63
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisional 97.49
PRK08303305 short chain dehydrogenase; Provisional 97.44
KOG1210331 consensus 97.25
KOG0725270 consensus 97.19
TIGR02632709 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol 97.08
PRK06300298 enoyl-(acyl carrier protein) reductase; Provisional 96.89
KOG1201300 consensus 96.55
TIGR02823330 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP f 96.42
TIGR02415258 23BDH acetoin reductases; InterPro: IPR014007 One membe 94.47
PRK05693274 short chain dehydrogenase; Provisional 99.21
PRK05993277 short chain dehydrogenase; Provisional 99.0
PRK06482276 short chain dehydrogenase; Provisional 98.87
PRK06182273 short chain dehydrogenase; Validated 98.83
PRK06180277 short chain dehydrogenase; Provisional 98.82
PRK06914280 short chain dehydrogenase; Provisional 98.8
PRK07023243 short chain dehydrogenase; Provisional 98.75
PRK09291257 short chain dehydrogenase; Provisional 98.72
PRK08263275 short chain dehydrogenase; Provisional 98.69
PRK06179270 short chain dehydrogenase; Provisional 98.6
PRK08264235 short chain dehydrogenase; Validated 98.55
PRK06196316 oxidoreductase; Provisional 98.48
pfam08659181 KR KR domain. This enzymatic domain is part of bacteria 98.47
PRK05854314 short chain dehydrogenase; Provisional 98.17
PRK07453322 protochlorophyllide oxidoreductase; Validated 98.15
smart00822180 PKS_KR This enzymatic domain is part of bacterial polyk 98.03
PRK06197306 short chain dehydrogenase; Provisional 98.03
KOG1610322 consensus 98.03
COG1028251 FabG Dehydrogenases with different specificities (relat 97.96
KOG1208314 consensus 97.92
pfam00106167 adh_short short chain dehydrogenase. This family contai 97.83
PRK08862227 short chain dehydrogenase; Provisional 97.79
KOG4039238 consensus 97.66
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 95.81
KOG1611249 consensus 94.07
KOG4288283 consensus 98.62
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 98.58
PRK09496 455 trkA potassium transporter peripheral membrane componen 98.55
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 98.4
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 98.38
PRK07417280 arogenate dehydrogenase; Reviewed 98.29
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 98.29
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 98.28
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 98.09
PRK12367250 short chain dehydrogenase; Provisional 98.08
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 98.06
pfam08643296 DUF1776 Fungal family of unknown function (DUF1776). Th 97.98
PRK08655 441 prephenate dehydrogenase; Provisional 97.97
PRK08229341 2-dehydropantoate 2-reductase; Provisional 97.96
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 97.92
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.9
PRK08507275 prephenate dehydrogenase; Validated 97.88
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.81
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 97.79
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 97.76
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Reviewed 97.74
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 97.66
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 97.66
PRK07502307 cyclohexadienyl dehydrogenase; Validated 97.6
KOG1209289 consensus 97.57
PRK03562615 glutathione-regulated potassium-efflux system protein K 97.51
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 97.47
COG2085211 Predicted dinucleotide-binding enzymes [General functio 97.45
PRK07424410 bifunctional sterol desaturase/short chain dehydrogenas 97.44
PRK03659602 glutathione-regulated potassium-efflux system protein K 97.43
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 97.43
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 97.34
PRK07680273 late competence protein ComER; Validated 97.31
PRK06249313 2-dehydropantoate 2-reductase; Provisional 97.3
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 97.26
TIGR01035436 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetra 97.26
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 97.2
pfam0380793 F420_oxidored NADP oxidoreductase coenzyme F420-depende 97.16
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy product 97.09
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.05
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provisional 97.04
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 97.03
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 97.02
PRK06223312 malate dehydrogenase; Reviewed 96.98
PRK06476255 pyrroline-5-carboxylate reductase; Reviewed 96.97
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketide syn 96.96
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.95
PRK06732228 phosphopantothenate--cysteine ligase; Validated 96.94
TIGR02817338 adh_fam_1 zinc-binding alcohol dehydrogenase family pro 96.87
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 96.86
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 96.83
KOG0409327 consensus 96.83
PRK13940414 glutamyl-tRNA reductase; Provisional 96.82
PRK06545357 prephenate dehydrogenase; Validated 96.82
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 96.81
TIGR02114253 coaB_strep phosphopantothenate--cysteine ligase; InterP 96.76
PRK13304265 L-aspartate dehydrogenase; Reviewed 96.71
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 96.69
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 96.6
KOG0023360 consensus 96.6
COG3268382 Uncharacterized conserved protein [Function unknown] 96.56
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is 96.5
PRK05086312 malate dehydrogenase; Provisional 96.45
PRK06720169 hypothetical protein; Provisional 96.44
PRK13771332 putative alcohol dehydrogenase; Provisional 96.4
PRK12439340 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; P 96.36
COG1712255 Predicted dinucleotide-utilizing enzyme [General functi 96.33
PRK03369 487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.32
PTZ00325313 malate dehydrogenase; Provisional 96.24
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 96.22
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 96.19
TIGR02964270 xanthine_xdhC xanthine dehydrogenase accessory protein 96.16
COG3967245 DltE Short-chain dehydrogenase involved in D-alanine es 96.15
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like structu 96.13
COG0039313 Mdh Malate/lactate dehydrogenases [Energy production an 96.13
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 96.1
PRK11199374 tyrA bifunctional chorismate mutase/prephenate dehydrog 96.09
PRK13303265 L-aspartate dehydrogenase; Provisional 96.05
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid tran 96.04
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehydroge 96.04
PRK13984604 putative oxidoreductase; Provisional 96.04
PRK01438 481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.03
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Mal 96.0
KOG2733 423 consensus 95.88
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 95.81
COG0604326 Qor NADPH:quinone reductase and related Zn-dependent ox 95.8
KOG1198347 consensus 95.79
PRK06928275 pyrroline-5-carboxylate reductase; Reviewed 95.79
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 95.76
PRK12814 652 putative NADPH-dependent glutamate synthase small subun 95.71
KOG0172 445 consensus 95.67
pfam01118121 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 95.64
PRK13301267 putative L-aspartate dehydrogenase; Provisional 95.63
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 95.63
TIGR00507286 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The 95.62
PRK12771 560 putative glutamate synthase (NADPH) small subunit; Prov 95.61
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 95.59
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 95.51
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 95.44
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 95.34
PTZ00142 474 6-phosphogluconate dehydrogenase; Provisional 95.17
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.11
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 95.09
PRK05442325 malate dehydrogenase; Provisional 95.04
PRK00421 459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 94.85
KOG1207245 consensus 94.82
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 94.8
KOG1014312 consensus 94.78
PRK13581 524 D-3-phosphoglycerate dehydrogenase; Provisional 94.74
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR sy 94.74
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 94.54
PRK00141 476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.44
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 94.36
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Members 94.14
PRK05562222 precorrin-2 dehydrogenase; Provisional 94.01
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 93.87
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+ 93.86
TIGR01763308 MalateDH_bact malate dehydrogenase, NAD-dependent; Inte 93.7
PTZ00117313 malate dehydrogenase; Provisional 93.69
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 93.2
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 93.08
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 93.02
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino 93.01
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 92.95
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de 92.9
PRK11559295 garR tartronate semialdehyde reductase; Provisional 98.3
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 98.06
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and related bet 97.87
PRK07531 489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 97.58
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Ce 97.51
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 97.23
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.17
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.0
pfam10727111 Rossmann-like Rossmann-like domain. This family of prot 96.88
PRK00257379 erythronate-4-phosphate dehydrogenase; Validated 95.72
TIGR01850361 argC N-acetyl-gamma-glutamyl-phosphate reductase; Inter 95.72
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase; Int 95.66
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-li 92.99
PRK05708305 2-dehydropantoate 2-reductase; Provisional 97.88
PRK12921306 2-dehydropantoate 2-reductase; Provisional 97.77
PRK00711 416 D-amino acid dehydrogenase small subunit; Validated 97.44
PRK09496455 trkA potassium transporter peripheral membrane componen 97.41
PRK00048265 dihydrodipicolinate reductase; Provisional 97.36
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.19
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 96.97
TIGR00872341 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylati 96.96
PRK07588 391 hypothetical protein; Provisional 96.89
PRK06753373 hypothetical protein; Provisional 96.83
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisional 96.79
PRK08309182 short chain dehydrogenase; Provisional 96.6
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 96.54
TIGR00745332 apbA_panE 2-dehydropantoate 2-reductase; InterPro: IPR0 96.5
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohy 96.37
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 96.28
PRK07538 413 hypothetical protein; Provisional 96.26
PRK00436345 argC N-acetyl-gamma-glutamyl-phosphate reductase; Valid 96.25
PRK06436303 glycerate dehydrogenase; Provisional 96.24
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 96.18
PRK09754 400 phenylpropionate dioxygenase ferredoxin reductase subun 96.11
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 96.09
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 96.07
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.04
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.03
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.98
PRK07660283 consensus 95.97
PRK09422338 alcohol dehydrogenase; Provisional 95.9
PRK04965378 nitric oxide reductase; Provisional 95.83
PRK01747 660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 95.78
PRK07045388 putative monooxygenase; Reviewed 95.78
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.77
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Members of 95.74
PRK09117282 consensus 95.74
PRK13512 438 coenzyme A disulfide reductase; Provisional 95.71
PRK11259377 solA N-methyltryptophan oxidase; Provisional 95.7
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 95.7
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 95.65
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 95.62
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 95.62
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.58
PRK08664350 aspartate-semialdehyde dehydrogenase; Reviewed 95.54
PRK08644209 thiamine biosynthesis protein ThiF; Provisional 95.5
PRK05868372 hypothetical protein; Validated 95.46
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 95.45
PRK07208 474 hypothetical protein; Provisional 95.33
pfam01113122 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihyd 95.28
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 95.07
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily of act 95.06
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 95.02
PRK06847375 hypothetical protein; Provisional 94.98
PRK08268 503 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.94
PRK12475337 thiamine/molybdopterin biosynthesis MoeB-like protein; 94.83
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.72
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 94.66
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 94.65
PRK07236386 hypothetical protein; Provisional 94.56
PRK09564 443 coenzyme A disulfide reductase; Reviewed 94.53
PRK06598348 aspartate-semialdehyde dehydrogenase; Reviewed 94.44
PRK11749460 putative oxidoreductase; Provisional 94.41
PRK01390 457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.41
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 94.4
PRK02472 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.39
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 94.28
pfam00899134 ThiF ThiF family. This family contains a repeated domai 94.28
PRK07608389 hypothetical protein; Provisional 94.22
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 94.2
COG3349 485 Uncharacterized conserved protein [Function unknown] 94.19
PRK08163 396 salicylate hydroxylase; Provisional 94.16
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 94.15
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 94.11
PRK07233 430 hypothetical protein; Provisional 94.07
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid transpor 94.0
COG2130340 Putative NADP-dependent oxidoreductases [General functi 93.96
PRK06475 400 salicylate hydroxylase; Provisional 93.78
PRK03815 401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.6
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 93.59
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 93.56
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.48
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 93.47
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 93.45
PRK07846453 mycothione/glutathione reductase; Reviewed 93.37
PTZ00318 514 NADH dehydrogenase; Provisional 93.35
TIGR02815374 agaS_fam putative sugar isomerase, AgaS family; InterPr 93.34
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 93.3
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biogenesi 93.28
PRK12831464 putative oxidoreductase; Provisional 93.2
PRK13748561 putative mercuric reductase; Provisional 93.18
PRK09126392 hypothetical protein; Provisional 93.14
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 93.02
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 97.36
PRK10669558 putative cation:proton antiport protein; Provisional 97.35
pfam0833848 DUF1731 Domain of unknown function (DUF1731). This doma 96.99
PRK12549284 shikimate 5-dehydrogenase; Reviewed 95.09
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 94.6
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transport an 94.46
PRK13243333 glyoxylate reductase; Reviewed 96.57
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 96.3
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 96.07
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 96.01
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 96.0
PRK07574385 formate dehydrogenase; Provisional 95.96
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 95.86
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 95.82
PRK12480330 D-lactate dehydrogenase; Provisional 95.54
PRK06487317 glycerate dehydrogenase; Provisional 95.37
PRK06932314 glycerate dehydrogenase; Provisional 94.3
KOG0069336 consensus 93.95
PRK10537356 voltage-gated potassium channel; Provisional 95.15
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: IPR005888 The conversion of dTDP-glucose into dTDP-4-keto-6-deoxyglucose by Escherichia coli dTDP-glucose 4,6-dehydratase) takes place in the active site in three steps: dehydrogenation to dTDP-4-ketoglucose, dehydration to dTDP-4-ketoglucose-5,6-ene, and rereduction of C6 to the methyl group Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>TIGR01179 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (5 Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>pfam04321 RmlD_sub_bind RmlD substrate binding domain Back     alignment and domain information
>KOG0747 consensus Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777; InterPro: IPR010099 This entry represents proteins of unknown function including the Escherichia coli YfcH protein Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; InterPro: IPR011912 Lipopolysaccharides (LPS) are glycolipids that consitutes the outer monolayer of the outer membranes of most Gram-negative bacteria Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>KOG1429 consensus Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>KOG1502 consensus Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1371 consensus Back     alignment and domain information
>KOG1430 consensus Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1431 consensus Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368 This family represent GDP-mannose 4,6-dehydratase, also known as GDP-D-mannose dehydratase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: IPR013445 This entry contains CDP-glucose 4,6-dehydratases from a variety of Gram-negative and Gram-positive bacteria Back     alignment and domain information
>KOG3019 consensus Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>KOG1372 consensus Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>pfam01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>pfam02719 Polysacc_synt_2 Polysaccharide biosynthesis protein Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>pfam05368 NmrA NmrA-like family Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain; InterPro: IPR010080 This domain includes the C-terminal domain from the fungal alpha aminoadipate reductase enzyme (also known as aminoadipate semialdehyde dehydrogenase) which is involved in the biosynthesis of lysine , as well as the reductase-containing component of the myxochelin biosynthetic gene cluster, MxcG Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>KOG2865 consensus Back     alignment and domain information
>KOG1221 consensus Back     alignment and domain information
>KOG2774 consensus Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK06483 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07479 consensus Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information