254780594

254780594

Glutathione S-transferase domain protein

GeneID in NCBI database:8209591Locus tag:CLIBASIA_02405
Protein GI in NCBI database:254780594Protein Accession:YP_003065007.1
Gene range:-(689683, 690375)Protein Length:230aa
Gene description:Glutathione S-transferase domain protein
COG prediction:[O] Glutathione S-transferase
KEGG prediction:glutathione S-transferase domain protein; K00799 glutathione S-transferase [EC:2.5.1.18]
SEED prediction:Glutathione S-transferase family protein
Pathway involved in KEGG:Glutathione metabolism [PATH:las00480]
Subsystem involved in SEED:Glutathione: Non-redox reactions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MSILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHERVYKLHMTTEQGGGSPDSKVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFRPLLSERIRGLLPVSHYTNLDF
ccEEEEccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHccccccccEEEEccccEEEcHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHHHHHHHcccccHHHcHHHHHHHHHHHHcHHHHHHHHHHHcccccccccccccc
ccEEccccccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHcccccccEEEcccccEEcHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHccccHHHHHHHcccccccccHcccccc
msilyhyplssssRFIRLILSEYefttdmieefpwgkrreflelnpsgtlpvyIDEHMQALCGVFVISEYLDETYGAIAQknrllstdplqRAETRRMIEWFMYQMEQDVTRPLAHERVYKLHmtteqgggspdsKVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYlgeidwdtaPIVKEWYQRmksrpsfrplLSERIrgllpvshytnldf
msilyhyplssssrFIRLILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQALCGVFVISEYLDETYGAIaqknrllstdplqRAETRRMIEWFMYQMEQDVTRPLAHERVYKLHmtteqgggspdskVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKsrpsfrpllserirgllpvshytnldf
MSILYHYPlssssrfirlilsEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHERVYKLHMTTEQGGGSPDSKVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFRPLLSERIRGLLPVSHYTNLDF
MSILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHERVYKLHMTTE********KVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFRPLLSERIRGLLPVSHYTNLDF
MSILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHERVYKLHMT********DSKVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFRPLLSERIRGLLPVSHYTNLDF
MSILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHERVYKLHMTTEQGGGSPDSKVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFRPLLSERIRGLLPVSHYTNLDF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHERVYKLHMTTEQGGGSPDSKVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFRPLLSERIRGLLPVSHYTNLDF
MSILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHERVYKLHMTTEQGGGSPDSKVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFRPLLSERIRGLLPVSHYTNLDF
MSILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHERVYKLHMTTEQGGGSPDSKVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFRPLLSERIRGLLPVSHYTNLDF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target230 Glutathione S-transferase domain protein [Candidatus Li
315121794230 glutathione S-transferase [Candidatus Liberibacter sola 1 1e-113
218460674230 glutathione S-transferase protein [Rhizobium etli Kim 5 1 2e-95
209551887230 glutathione S-transferase domain [Rhizobium leguminosar 1 4e-95
86355966230 glutathione S-transferase protein [Rhizobium etli CFN 4 1 5e-95
190889977230 glutathione S-transferase [Rhizobium etli CIAT 652] Len 1 8e-95
241207264230 glutathione S-transferase domain protein [Rhizobium leg 1 2e-94
116250095230 glutathione S-transferase [Rhizobium leguminosarum bv. 1 3e-94
222084592230 glutathione S-transferase protein [Agrobacterium radiob 1 7e-93
222147274230 glutathione S-transferase [Agrobacterium vitis S4] Leng 1 3e-91
325291727230 Glutathione S-transferase [Agrobacterium sp. H13-3] Len 1 5e-90
>gi|315121794|ref|YP_004062283.1| glutathione S-transferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 230 Back     alignment and organism information
 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 190/230 (82%), Positives = 212/230 (92%)

Query: 1   MSILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQA 60
           MSILYHYP+SSSSRFIRLILSEYEF  DM+EE+PWGKRREFLELNPSGTLPVY+++HM A
Sbjct: 1   MSILYHYPMSSSSRFIRLILSEYEFKPDMVEEYPWGKRREFLELNPSGTLPVYVNDHMHA 60

Query: 61  LCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHERVY 120
           LCG  VISEYLDETYG + +KNRLL  DPLQ+AE RRM+EWFM+QME DVT+PL  ERVY
Sbjct: 61  LCGFVVISEYLDETYGTLTKKNRLLPDDPLQKAEVRRMVEWFMHQMEGDVTKPLVRERVY 120

Query: 121 KLHMTTEQGGGSPDSKVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISI 180
           KLHMT EQGGGSPDSK+LR+AR+NMR+HIKYITWLIKSR+WIAG+H+SYADFAASATISI
Sbjct: 121 KLHMTAEQGGGSPDSKILRVARSNMRQHIKYITWLIKSRAWIAGNHISYADFAASATISI 180

Query: 181 LDYLGEIDWDTAPIVKEWYQRMKSRPSFRPLLSERIRGLLPVSHYTNLDF 230
           LDYLGEIDW+ API+KEWYQR+KSRPSFR LLSERIRGL PV HYTNLDF
Sbjct: 181 LDYLGEIDWNDAPIIKEWYQRIKSRPSFRSLLSERIRGLAPVPHYTNLDF 230


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218460674|ref|ZP_03500765.1| glutathione S-transferase protein [Rhizobium etli Kim 5] Length = 230 Back     alignment and organism information
>gi|209551887|ref|YP_002283804.1| glutathione S-transferase domain [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 230 Back     alignment and organism information
>gi|86355966|ref|YP_467858.1| glutathione S-transferase protein [Rhizobium etli CFN 42] Length = 230 Back     alignment and organism information
>gi|190889977|ref|YP_001976519.1| glutathione S-transferase [Rhizobium etli CIAT 652] Length = 230 Back     alignment and organism information
>gi|241207264|ref|YP_002978360.1| glutathione S-transferase domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 230 Back     alignment and organism information
>gi|116250095|ref|YP_765933.1| glutathione S-transferase [Rhizobium leguminosarum bv. viciae 3841] Length = 230 Back     alignment and organism information
>gi|222084592|ref|YP_002543121.1| glutathione S-transferase protein [Agrobacterium radiobacter K84] Length = 230 Back     alignment and organism information
>gi|222147274|ref|YP_002548231.1| glutathione S-transferase [Agrobacterium vitis S4] Length = 230 Back     alignment and organism information
>gi|325291727|ref|YP_004277591.1| Glutathione S-transferase [Agrobacterium sp. H13-3] Length = 230 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target230 Glutathione S-transferase domain protein [Candidatus Li
KOG0867226 KOG0867, KOG0867, KOG0867, Glutathione S-transferase [P 5e-15
KOG0406231 KOG0406, KOG0406, KOG0406, Glutathione S-transferase [P 5e-08
KOG0868217 KOG0868, KOG0868, KOG0868, Glutathione S-transferase [P 6e-06
KOG4420325 KOG4420, KOG4420, KOG4420, Uncharacterized conserved pr 1e-05
PRK09481211 PRK09481, sspA, stringent starvation protein A; Provisi 7e-05
COG0625211 COG0625, Gst, Glutathione S-transferase [Posttranslatio 5e-27
cd00299100 cd00299, GST_C_family, Glutathione S-transferase (GST) 5e-09
cd03182117 cd03182, GST_C_GTT2_like, GST_C family, Saccharomyces c 6e-04
TIGR01262210 TIGR01262, maiA, maleylacetoacetate isomerase 4e-07
cd0057071 cd00570, GST_N_family, Glutathione S-transferase (GST) 1e-06
cd0305973 cd03059, GST_N_SspA, GST_N family, Stringent starvation 6e-05
cd0304973 cd03049, GST_N_3, GST_N family, unknown subfamily 3; co 0.002
cd0305174 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces c 0.004
cd03177118 cd03177, GST_C_Delta_Epsilon, GST_C family, Class Delta 4e-06
cd03183126 cd03183, GST_C_Theta, GST_C family, Class Theta subfami 3e-05
cd03178113 cd03178, GST_C_Ure2p_like, GST_C family, Ure2p-like sub 8e-05
cd03188114 cd03188, GST_C_Beta, GST_C family, Class Beta subfamily 2e-04
cd03210126 cd03210, GST_C_Pi, GST_C family, Class Pi subfamily; GS 5e-04
pfam0004392 pfam00043, GST_C, Glutathione S-transferase, C-terminal 9e-04
PRK10542201 PRK10542, PRK10542, glutathionine S-transferase; Provis 0.004
>gnl|CDD|36085 KOG0867, KOG0867, KOG0867, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35627 KOG0406, KOG0406, KOG0406, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|36086 KOG0868, KOG0868, KOG0868, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|39621 KOG4420, KOG4420, KOG4420, Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] Back     alignment and domain information
>gnl|CDD|181895 PRK09481, sspA, stringent starvation protein A; Provisional Back     alignment and domain information
>gnl|CDD|30970 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48103 cd00299, GST_C_family, Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|48109 cd03182, GST_C_GTT2_like, GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>gnl|CDD|162274 TIGR01262, maiA, maleylacetoacetate isomerase Back     alignment and domain information
>gnl|CDD|48493 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|48608 cd03059, GST_N_SspA, GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>gnl|CDD|48598 cd03049, GST_N_3, GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|48600 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>gnl|CDD|48104 cd03177, GST_C_Delta_Epsilon, GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|48110 cd03183, GST_C_Theta, GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>gnl|CDD|48105 cd03178, GST_C_Ure2p_like, GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>gnl|CDD|48115 cd03188, GST_C_Beta, GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>gnl|CDD|48137 cd03210, GST_C_Pi, GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>gnl|CDD|109112 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|182533 PRK10542, PRK10542, glutathionine S-transferase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 230 Glutathione S-transferase domain protein [Candidatus Li
PRK09481211 sspA stringent starvation protein A; Provisional 100.0
PRK13972215 glutathione S-transferase; Provisional 100.0
PRK10357202 predicted glutathione S-transferase; Provisional 100.0
PRK10542201 glutathionine S-transferase; Provisional 100.0
TIGR01262218 maiA maleylacetoacetate isomerase; InterPro: IPR005955 100.0
COG0625211 Gst Glutathione S-transferase [Posttranslational modifi 100.0
PRK11752264 putative glutathione S-transferase YghU; Provisional 100.0
KOG0406231 consensus 100.0
KOG0868217 consensus 100.0
KOG0867226 consensus 100.0
KOG4420325 consensus 99.95
PTZ00057211 glutathione s-transferase; Provisional 99.92
PRK10387210 glutaredoxin 2; Provisional 99.88
KOG1695206 consensus 99.86
KOG1422221 consensus 99.81
KOG3029370 consensus 99.79
KOG4244281 consensus 99.76
TIGR02182212 GRXB Glutaredoxin, GrxB family; InterPro: IPR011901 Glu 99.69
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modification, pr 99.53
COG0435324 ECM4 Predicted glutathione S-transferase [Posttranslati 99.38
KOG2903319 consensus 99.21
TIGR00862237 O-ClC intracellular chloride channel protein; InterPro: 99.06
KOG3028313 consensus 99.03
KOG3027257 consensus 98.98
cd0305973 GST_N_SspA GST_N family, Stringent starvation protein A 99.88
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are c 99.86
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; GSTs a 99.86
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced different 99.83
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; co 99.83
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae 99.83
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; composed of 99.83
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; composed o 99.82
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are 99.82
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; compos 99.81
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are 99.81
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsil 99.8
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; composed of 99.8
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; composed of 99.79
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamily; co 99.79
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae 99.78
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongati 99.76
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase LigE su 99.71
cd0057071 GST_N_family Glutathione S-transferase (GST) family, N- 99.59
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; composed of 99.58
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Channel 99.56
pfam0279872 GST_N Glutathione S-transferase, N-terminal domain. Fun 99.53
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal 99.52
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamil 99.44
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Met 99.43
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E s 99.39
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; compos 98.99
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cyt 98.95
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs a 98.87
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; composed 98.79
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cyt 98.57
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monome 98.09
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Me 97.98
TIGR0219679 GlrX_YruB Glutaredoxin-like protein, YruB-family; Inter 97.93
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid s 97.78
COG069580 GrxC Glutaredoxin and related proteins [Posttranslation 97.74
pfam0046260 Glutaredoxin Glutaredoxin. 97.55
PRK1063883 glutaredoxin 3; Provisional 97.43
TIGR0218182 GRX_bact glutaredoxin 3; InterPro: IPR011900 Glutaredox 97.41
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of GRX, 97.38
TIGR0220078 GlrX_actino Glutaredoxin-like protein; InterPro: IPR011 97.31
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, 97.22
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human 97.19
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacter 97.09
TIGR0219079 GlrX-dom Glutaredoxin-family domain; InterPro: IPR01190 96.91
PRK1032981 glutaredoxin-like protein; Provisional 96.62
PRK1120087 grxA glutaredoxin 1; Provisional 96.43
pfam1056871 Tom37 Outer mitochondrial membrane transport complex pr 96.38
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacti 95.75
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 95.58
COG454585 Glutaredoxin-related protein [Posttranslational modific 95.58
TIGR0218085 GRX_euk Glutaredoxin; InterPro: IPR011899 Glutaredoxins 94.86
KOG1752104 consensus 93.97
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a large, 93.69
PRK10824115 hypothetical protein; Provisional 92.07
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH; InterPro: IPR 91.18
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; composed o 99.83
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are 99.77
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongati 99.77
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; co 99.77
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; composed of 99.74
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae 99.72
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsil 99.68
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; compos 99.68
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; composed of 99.66
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; composed of 99.59
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae 99.55
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are c 99.51
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are 99.48
cd03186107 GST_C_SspA GST_N family, Stringent starvation protein A 99.37
cd00299100 GST_C_family Glutathione S-transferase (GST) family, C- 99.17
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; comp 99.16
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; composed of 98.84
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; composed of 98.79
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; composed of 98.74
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; comp 98.71
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of u 98.44
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; composed of 99.5
pfam0004392 GST_C Glutathione S-transferase, C-terminal domain. GST 99.47
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced different 99.24
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cyt 99.11
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; GSTs a 99.09
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cyt 99.03
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs a 98.86
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DH 98.64
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; compos 98.56
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; composed of 98.48
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase LigE su 98.46
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E s 98.31
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metax 98.24
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; composed 98.24
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Channel 98.16
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 98.08
cd03199128 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamil 95.29
pfam04399132 Glutaredoxin2_C Glutaredoxin 2, C terminal domain. Glut 95.03
PRK10853118 hypothetical protein; Provisional 96.99
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamil 96.76
PRK12559131 transcriptional regulator Spx; Provisional 96.73
PRK13344132 spxA transcriptional regulator Spx; Reviewed 96.53
COG1393117 ArsC Arsenate reductase and related proteins, glutaredo 96.29
PRK01655131 spxA transcriptional regulator Spx; Reviewed 96.18
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protei 96.16
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfam 95.02
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfam 94.95
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknown sub 94.62
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; composed 94.06
PRK10026141 arsenate reductase; Provisional 94.06
TIGR01617122 arsC_related conserved hypothetical protein; InterPro: 93.81
pfam03960111 ArsC ArsC family. This family is related to glutaredoxi 90.13
KOG1147 712 consensus 96.42
pfam11801164 Tom37_C Tom37 C-terminal domain. The TOM37 protein is o 90.71
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>PRK13972 glutathione S-transferase; Provisional Back     alignment and domain information
>PRK10357 predicted glutathione S-transferase; Provisional Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase; InterPro: IPR005955 Maleylacetoacetate isomerase is an enzyme of tyrosine and phenylalanine catabolism Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11752 putative glutathione S-transferase YghU; Provisional Back     alignment and domain information
>KOG0406 consensus Back     alignment and domain information
>KOG0868 consensus Back     alignment and domain information
>KOG0867 consensus Back     alignment and domain information
>KOG4420 consensus Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>KOG1695 consensus Back     alignment and domain information
>KOG1422 consensus Back     alignment and domain information
>KOG3029 consensus Back     alignment and domain information
>KOG4244 consensus Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family; InterPro: IPR011901 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2903 consensus Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein; InterPro: IPR002946 Chloride (Cl^-) channels are known to be present in the plasma and intracellular membranes of many cell types Back     alignment and domain information
>KOG3028 consensus Back     alignment and domain information
>KOG3027 consensus Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>pfam02798 GST_N Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family; InterPro: IPR011911 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam00462 Glutaredoxin Glutaredoxin Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>TIGR02181 GRX_bact glutaredoxin 3; InterPro: IPR011900 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein; InterPro: IPR011915 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain; InterPro: IPR011906 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>pfam10568 Tom37 Outer mitochondrial membrane transport complex protein Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin; InterPro: IPR011899 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>KOG1752 consensus Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PRK10824 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH; InterPro: IPR011909 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>pfam00043 GST_C Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>pfam04399 Glutaredoxin2_C Glutaredoxin 2, C terminal domain Back     alignment and domain information
>PRK10853 hypothetical protein; Provisional Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>TIGR01617 arsC_related conserved hypothetical protein; InterPro: IPR006504 These sequences are a part of the Arsenate reductase family of sequences Back     alignment and domain information
>pfam03960 ArsC ArsC family Back     alignment and domain information
>KOG1147 consensus Back     alignment and domain information
>pfam11801 Tom37_C Tom37 C-terminal domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target230 Glutathione S-transferase domain protein [Candidatus Li
1aw9_A216 Structure Of Glutathione S-Transferase Iii In Apo F 2e-25
1e6b_A221 Crystal Structure Of A Zeta Class Glutathione S-Tra 2e-24
2vo4_A219 Glutathione Transferase From Glycine Max Length = 2 1e-23
3erf_A233 Crystal Structure Of Gtt2 From Saccharomyces Cerevi 4e-21
1gwc_B230 The Structure Of A Tau Class Glutathione S-Transfer 1e-20
3lyp_A215 Structure Of Stringent Starvation Protein A Homolog 3e-20
1yy7_A213 Crystal Structure Of Stringent Starvation Protein A 3e-20
2cz2_A223 Crystal Structure Of Glutathione Transferase Zeta 1 5e-20
1fw1_A216 Glutathione Transferase ZetaMALEYLACETOACETATE ISOM 2e-19
1eem_A241 Glutathione Transferase From Homo Sapiens Length = 3e-19
2gdr_A202 Crystal Structure Of A Bacterial Glutathione Transf 4e-19
2dsa_A203 Ternary Complex Of Bphk, A Bacterial Gst Length = 2 4e-19
3mdk_A217 Structure Of Stringent Starvation Protein A (Sspa) 9e-19
3m8n_A225 Crystal Structure Of A Possible Gutathione S-Tranfe 2e-18
3lfl_A240 Crystal Structure Of Human Glutathione Transferase 3e-18
3gx0_A215 Crystal Structure Of Gsh-Dependent Disulfide Bond O 5e-18
3lyk_A216 Structure Of Stringent Starvation Protein A Homolog 2e-17
1gnw_A211 Structure Of Glutathione S-Transferase Length = 211 3e-17
3m3m_A210 Crystal Structure Of Glutathione S-Transferase From 4e-17
2jl4_A213 Holo Structure Of Maleyl Pyruvate Isomerase, A Bact 1e-16
2v6k_A214 Structure Of Maleyl Pyruvate Isomerase, A Bacterial 1e-16
2pmt_A203 Glutathione Transferase From Proteus Mirabilis Leng 4e-16
1pn9_A209 Crystal Structure Of An Insect Delta-Class Glutathi 4e-16
1f2e_A201 Structure Of Sphingomonad, Glutathione S-Transferas 7e-16
3lg6_A235 Crystal Structure Of Putative Glutathione Transfera 1e-15
1jlv_A209 Anopheles Dirus Species B Glutathione S-Transferase 2e-15
1oyj_A231 Crystal Structure Solution Of Rice Gst1 (Osgstu1) I 2e-15
2il3_A221 Structures Of An Insect Epsilon-Class Glutathione S 3e-15
1r5a_A218 Glutathione S-Transferase Length = 218 5e-15
1jlw_A219 Anopheles Dirus Species B Glutathione S-Transferase 5e-14
3ein_A209 Delta Class Gst Length = 209 6e-14
3f6d_A219 Crystal Structure Of A Genetically Modified Delta C 7e-14
3g7j_A219 Crystal Structure Of A Genetically Modified Delta C 7e-14
3niv_A222 The Crystal Structure Of Glutathione S-Transferase 1e-13
1bye_A213 Glutathione S-Transferase I From Mais In Complex Wi 2e-13
1axd_A209 Structure Of Glutathione S-Transferase-I Bound With 2e-13
3f6f_A210 Crystal Structure Of Glutathione Transferase Dmgstd 3e-13
1a0f_A201 Crystal Structure Of Glutathione S-Transferase From 4e-13
1jzr_A260 Ure2p In Complex With Glutathione Length = 260 4e-13
1g6w_A261 Crystal Structure Of The Globular Region Of The Pri 5e-13
3c8e_A288 Crystal Structure Analysis Of Yghu From E. Coli Len 8e-13
3cbu_A214 Crystal Structure Of A Putative Glutathione S-Trans 2e-12
1hqo_A258 Crystal Structure Of The Nitrogen Regulation Fragme 4e-12
3lsz_A225 Crystal Structure Of Glutathione S-Transferase From 4e-12
3lq7_A240 Crystal Structure Of Glutathione S-Transferase From 6e-12
1ljr_A244 Glutathione Transferase (Hgst T2-2) From Human Leng 1e-11
1v2a_A210 Glutathione S-Transferase 1-6 From Anopheles Dirus 3e-11
2x64_A207 Glutathione-S-Transferase From Xylella Fastidiosa L 4e-11
2nto_A201 Structure Of The Glutathione Transferase From Ochro 3e-10
2c3q_A247 Human Glutathione-S-Transferase T1-1 W234r Mutant, 7e-10
2pvq_A201 Crystal Structure Of Ochrobactrum Anthropi Glutathi 1e-09
2c3n_A247 Human Glutathione-S-Transferase T1-1, Apo Form Leng 1e-09
3i69_A222 Apo Glutathione Transferase A1-1 Gimf-Helix Mutant 6e-09
1tdi_A222 Crystal Structure Of Hgsta3-3 In Complex With Gluta 3e-08
3lxt_A213 Crystal Structure Of Glutathione S Transferase From 4e-08
1usb_A225 Rational Design Of A Novel Enzyme- Efficient Thioes 5e-08
3ic8_A310 The Crystal Structure Of A Gst-Like Protein From Ps 5e-08
1guh_A221 Structure Determination And Refinement Of Human Alp 6e-08
3ktl_A221 Crystal Structure Of An I71a Human Gsta1-1 Mutant I 7e-08
1xwg_A221 Human Gst A1-1 T68e Mutant Length = 221 8e-08
2r6k_A222 Crystal Structure Of An I71v Hgsta1-1 Mutant In Com 8e-08
1ydk_A222 Crystal Structure Of The I219a Mutant Of Human Glut 9e-08
2vct_A222 Glutathione Transferase A2-2 In Complex With Glutat 1e-07
3lxz_A229 Structure Of Probable Glutathione S-Transferase(Pp0 1e-07
1b48_A221 Crystal Structure Of Mgsta4-4 In Complex With Gsh C 1e-07
1f3a_A222 Crystal Structure Of Mgsta1-1 In Complex With Gsh L 1e-07
1pkw_A222 Crystal Structure Of Human Glutathione Transferase 2e-07
1guk_A222 Crystal Structure Of Murine Alpha-Class Gsta4-4 Len 2e-07
>gi|157830114|pdb|1AW9|A Chain A, Structure Of Glutathione S-Transferase Iii In Apo Form Length = 216 Back     alignment and structure
 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 86/226 (38%), Gaps = 16/226 (7%)

Query: 2   SILYHYPLSSSSRFIRLILSEYEFTTDMIEEFP---WGKRREFLELNPSGTLPVYIDEHM 58
             LY  PLS +   +  +L+E     +++         K+ +FL LNP G +P  + +  
Sbjct: 3   LKLYGMPLSPNVVRVATVLNEKGLDFEIVPVDLTTGAHKQPDFLALNPFGQIPALV-DGD 61

Query: 59  QALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHER 118
           + L     I+ Y+   Y +        +    +      +              PL  + 
Sbjct: 62  EVLFESRAINRYIASKYASEGTDLLPATASAAK----LEVWLEVESHHFYPNASPLVFQL 117

Query: 119 VYKLHMTTEQGGGSPDSKVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATI 178
           + +  +     GG+PD+ V+      + + +      +    ++AG   + AD   ++ +
Sbjct: 118 LVRPLL-----GGAPDAAVVDKHAEQLAKVLDVYEAHLARNKYLAGDEFTLADANHASYL 172

Query: 179 SILDYLGEIDW-DTAPIVKEWYQRMKSRPSFRPLLSERIRGLLPVS 223
             L    +       P VK W++ + +RP+F+  ++  I  L P  
Sbjct: 173 LYLSKTPKAGLVAARPHVKAWWEAIVARPAFQKTVA-AIP-LPPPP 216


gi|14719799|pdb|1E6B|A Chain A, Crystal Structure Of A Zeta Class Glutathione S-Transferase From Arabidopsis Thaliana Length = 221 Back     alignment and structure
>gi|215794536|pdb|2VO4|A Chain A, Glutathione Transferase From Glycine Max Length = 219 Back     alignment and structure
gi|261278646|pdb|3ERF|A Chain A, Crystal Structure Of Gtt2 From Saccharomyces Cerevisiae Length = 233 Back     alignment and structure
>gi|291463710|pdb|3LYP|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Pseudomonas Fluorescens Length = 215 Back     alignment and structure
gi|61680862|pdb|1YY7|A Chain A, Crystal Structure Of Stringent Starvation Protein A (Sspa), An Rna Polymerase-Associated Transcription Factor Length = 213 Back     alignment and structure
>gi|88192700|pdb|2CZ2|A Chain A, Crystal Structure Of Glutathione Transferase Zeta 1-1 (Maleylacetoacetate Isomerase) From Mus Musculus (Form-1 Crystal) Length = 223 Back     alignment and structure
>gi|15988159|pdb|1FW1|A Chain A, Glutathione Transferase ZetaMALEYLACETOACETATE ISOMERASE Length = 216 Back     alignment and structure
gi|10120947|pdb|1EEM|A Chain A, Glutathione Transferase From Homo Sapiens Length = 241 Back     alignment and structure
>gi|114794049|pdb|2GDR|A Chain A, Crystal Structure Of A Bacterial Glutathione Transferase Length = 202 Back     alignment and structure
>gi|114793735|pdb|2DSA|A Chain A, Ternary Complex Of Bphk, A Bacterial Gst Length = 203 Back     alignment and structure
>gi|295982541|pdb|3MDK|A Chain A, Structure Of Stringent Starvation Protein A (Sspa) From Pseu Putida Length = 217 Back     alignment and structure
>gi|293652041|pdb|3M8N|A Chain A, Crystal Structure Of A Possible Gutathione S-Tranferase From Rhodopseudomonas Palustris Length = 225 Back     alignment and structure
>gi|312597295|pdb|3LFL|A Chain A, Crystal Structure Of Human Glutathione Transferase Omega 1, Delta 155 Length = 240 Back     alignment and structure
gi|251836956|pdb|3GX0|A Chain A, Crystal Structure Of Gsh-Dependent Disulfide Bond Oxidoreductase Length = 215 Back     alignment and structure
>gi|291463704|pdb|3LYK|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Haemophilus Influenzae Length = 216 Back     alignment and structure
>gi|2554769|pdb|1GNW|A Chain A, Structure Of Glutathione S-Transferase Length = 211 Back     alignment and structure
>gi|291191397|pdb|3M3M|A Chain A, Crystal Structure Of Glutathione S-Transferase From Pseudomonas Fluorescens [pf-5] Length = 210 Back     alignment and structure
>gi|203282219|pdb|2JL4|A Chain A, Holo Structure Of Maleyl Pyruvate Isomerase, A Bacterial Glutathione-S-Transferase In Zeta Class Length = 213 Back     alignment and structure
>gi|194368558|pdb|2V6K|A Chain A, Structure Of Maleyl Pyruvate Isomerase, A Bacterial Glutathione-S-Transferase In Zeta Class, In Complex With Substrate Analogue Dicarboxyethyl Glutathione Length = 214 Back     alignment and structure
gi|4930192|pdb|2PMT|A Chain A, Glutathione Transferase From Proteus Mirabilis Length = 203 Back     alignment and structure
gi|40889323|pdb|1PN9|A Chain A, Crystal Structure Of An Insect Delta-Class Glutathione S- Transferase From A Ddt-Resistant Strain Of The Malaria Vector Anopheles Gambiae Length = 209 Back     alignment and structure
>gi|9257055|pdb|1F2E|A Chain A, Structure Of Sphingomonad, Glutathione S-Transferase Complexed With Glutathione Length = 201 Back     alignment and structure
>gi|284794172|pdb|3LG6|A Chain A, Crystal Structure Of Putative Glutathione Transferase From Coccidioides Immitis Length = 235 Back     alignment and structure
>gi|22218855|pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutathione S-Transferases 1-3 Length = 209 Back     alignment and structure
gi|33357806|pdb|1OYJ|A Chain A, Crystal Structure Solution Of Rice Gst1 (Osgstu1) In Complex With Glutathione. Length = 231 Back     alignment and structure
gi|158428812|pdb|2IL3|A Chain A, Structures Of An Insect Epsilon-Class Glutathione S- Transferase From The Malaria Vector Anopheles Gambiae: Evidence For High Ddt-Detoxifying Activity Length = 221 Back     alignment and structure
>gi|38493021|pdb|1R5A|A Chain A, Glutathione S-Transferase Length = 218 Back     alignment and structure
>gi|22218861|pdb|1JLW|A Chain A, Anopheles Dirus Species B Glutathione S-Transferases 1-4 Length = 219 Back     alignment and structure
gi|257097171|pdb|3EIN|A Chain A, Delta Class Gst Length = 209 Back     alignment and structure
>gi|262118556|pdb|3F6D|A Chain A, Crystal Structure Of A Genetically Modified Delta Class Gst (Adgstd4-4) From Anopheles Dirus, F123a, In Complex With S- Hexyl Glutathione Length = 219 Back     alignment and structure
>gi|288965421|pdb|3G7J|A Chain A, Crystal Structure Of A Genetically Modified Delta Class Gst (Adgstd4-4) From Anopheles Dirus, Y119e, In Complex With S- Hexyl Glutathione Length = 219 Back     alignment and structure
>gi|300508758|pdb|3NIV|A Chain A, The Crystal Structure Of Glutathione S-Transferase From Legionella Pneumophila Length = 222 Back     alignment and structure
>gi|3891705|pdb|1BYE|A Chain A, Glutathione S-Transferase I From Mais In Complex With Atrazine Glutathione Conjugate Length = 213 Back     alignment and structure
>gi|3891607|pdb|1AXD|A Chain A, Structure Of Glutathione S-Transferase-I Bound With The Ligand Lactoylglutathione Length = 209 Back     alignment and structure
gi|262118558|pdb|3F6F|A Chain A, Crystal Structure Of Glutathione Transferase Dmgstd10 From Drosophila Melanogaster Length = 210 Back     alignment and structure
gi|4389382|pdb|1A0F|A Chain A, Crystal Structure Of Glutathione S-Transferase From Escherichia Coli Complexed With Glutathionesulfonic Acid Length = 201 Back     alignment and structure
>gi|18158856|pdb|1JZR|A Chain A, Ure2p In Complex With Glutathione Length = 260 Back     alignment and structure
>gi|13399769|pdb|1G6W|A Chain A, Crystal Structure Of The Globular Region Of The Prion Protein Ure2 From The Yeast Saccaromyces Cerevisiae Length = 261 Back     alignment and structure
gi|224036294|pdb|3C8E|A Chain A, Crystal Structure Analysis Of Yghu From E. Coli Length = 288 Back     alignment and structure
>gi|169404772|pdb|3CBU|A Chain A, Crystal Structure Of A Putative Glutathione S-Transferase (Reut_a1011) From Ralstonia Eutropha Jmp134 At 2.05 A Resolution Length = 214 Back     alignment and structure
>gi|13399967|pdb|1HQO|A Chain A, Crystal Structure Of The Nitrogen Regulation Fragment Of The Yeast Prion Protein Ure2p Length = 258 Back     alignment and structure
>gi|291463690|pdb|3LSZ|A Chain A, Crystal Structure Of Glutathione S-Transferase From Rhodobacter Sphaeroides Length = 225 Back     alignment and structure
>gi|289526959|pdb|3LQ7|A Chain A, Crystal Structure Of Glutathione S-Transferase From Agrobacterium Tumefaciens Str. C58 Length = 240 Back     alignment and structure
gi|4699743|pdb|1LJR|A Chain A, Glutathione Transferase (Hgst T2-2) From Human Length = 244 Back     alignment and structure
>gi|38493127|pdb|1V2A|A Chain A, Glutathione S-Transferase 1-6 From Anopheles Dirus Species B Length = 210 Back     alignment and structure
>gi|290560042|pdb|2X64|A Chain A, Glutathione-S-Transferase From Xylella Fastidiosa Length = 207 Back     alignment and structure