254780598

254780598

outer membrane protein

GeneID in NCBI database:8209595Locus tag:CLIBASIA_02425
Protein GI in NCBI database:254780598Protein Accession:YP_003065011.1
Gene range:+(684561, 685178)Protein Length:205aa
Gene description:outer membrane protein
COG prediction:none
KEGG prediction:outer membrane protein
SEED prediction:OmpA-like transmembrane region
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF
cHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccEEEEEEEccccEEEEEEEccccccccccccEEEccccEEEEEEEEEEEEEccEEEEEEEEEEEEEEEEccccccccccccEEEEEccEEEEcccccEEEEEEEEEEEcccccccEEEEEEEEEccc
ccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEccEcccccccccccccccccEEEEcEccccccEEEEEEEEcccccccccccccccccccEEEEEEEEEEccccEEEEEEccEEEEEEEEccccccccccccEEEEcccEEEEEccccEEEEEEEEEEEccccccccccEEEEEEEEc
MQKLFLAVGVSSLALASFCsaqaadpvrrahhggrgvvptiatnryvpirhdfngpyaglsalyngsfgeeahhnaggsifagynvedscimygvegdvrytvpvLADNihslhgiggslrirggyevsdSLLLYATvgpdvaqkyetgkageitpiaiggtagvgvEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF
MQKLFLAVGVSSLALASFCSAQAADPVrrahhggrgvvptiatnryvpiRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRaskyskvegfyntislgvgmkf
MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKageitpiaiggtagvgvevgglseslvARLEYRASKYSKVEGFYNTISLGVGMKF
****FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF
MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF
*QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF
MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF
MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target205 outer membrane protein [Candidatus Liberibacter asiatic
315121798231 outer membrane protein [Candidatus Liberibacter solanac 1 3e-33
190891163211 outer membrane protein [Rhizobium etli CIAT 652] Length 1 3e-14
3914820211 RecName: Full=22 kDa outer membrane protein; Flags: Pre 1 3e-14
327193361211 outer membrane protein [Rhizobium etli CNPAF512] Length 1 1e-13
110634323216 OmpA-like transmembrane region [Mesorhizobium sp. BNC1] 1 2e-13
222085476210 outer membrane protein [Agrobacterium radiobacter K84] 1 6e-13
260469600217 OmpA domain protein transmembrane region-containing pro 1 5e-12
218675314211 outer membrane protein [Rhizobium etli GR56] Length = 2 1 3e-11
241203970211 porin [Rhizobium leguminosarum bv. trifolii WSM1325] Le 1 3e-11
116251355211 ropB outer membrane protein [Rhizobium leguminosarum bv 1 6e-11
>gi|315121798|ref|YP_004062287.1| outer membrane protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 231 Back     alignment and organism information
 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 95/232 (40%), Positives = 132/232 (56%), Gaps = 28/232 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAAD----PVRRAHHG-GRGVVPTIAT-NRYVPIRHDFN 54
           M+K FLAVGVS+L L SF + QAAD    P RR H    RGVVPT+ + NRYV  +    
Sbjct: 1   MKKFFLAVGVSTLTLVSFSAVQAADAVQRPQRRQHASVSRGVVPTVVSANRYVYSQQGIE 60

Query: 55  GPYAGLSALYNGSF-GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD----- 108
           GPYAG+S  +  +F G++ + + GGS+FAGYNV++    YG E D RY+  + +      
Sbjct: 61  GPYAGMSIFHERNFSGKDHNKDIGGSLFAGYNVQEGDFFYGAEADARYSHDIASKEHKAA 120

Query: 109 -----------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI 157
                       ++      GSLR RGGYE++  +++Y TVG     K     A      
Sbjct: 121 RLDQKDDAAVSKMYHAADFSGSLRFRGGYEIAAPVVVYGTVGVAAVHKASKAPADAAASP 180

Query: 158 A----IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF 205
           A    IGGTAG+GVE   L ++++ R+EYRA+KYS V    N +SLG+G++F
Sbjct: 181 AKAFYIGGTAGLGVE-SVLVDNIIGRVEYRATKYSGVSHLQNVVSLGLGIRF 231


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190891163|ref|YP_001977705.1| outer membrane protein [Rhizobium etli CIAT 652] Length = 211 Back     alignment and organism information
>gi|3914820|sp|Q52866|ROPB_RHILV RecName: Full=22 kDa outer membrane protein; Flags: Precursor Length = 211 Back     alignment and organism information
>gi|327193361|gb|EGE60264.1| outer membrane protein [Rhizobium etli CNPAF512] Length = 211 Back     alignment and organism information
>gi|110634323|ref|YP_674531.1| OmpA-like transmembrane region [Mesorhizobium sp. BNC1] Length = 216 Back     alignment and organism information
>gi|222085476|ref|YP_002544006.1| outer membrane protein [Agrobacterium radiobacter K84] Length = 210 Back     alignment and organism information
>gi|260469600|ref|ZP_05813765.1| OmpA domain protein transmembrane region-containing protein [Mesorhizobium opportunistum WSM2075] Length = 217 Back     alignment and organism information
>gi|218675314|ref|ZP_03524983.1| outer membrane protein [Rhizobium etli GR56] Length = 211 Back     alignment and organism information
>gi|241203970|ref|YP_002975066.1| porin [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 211 Back     alignment and organism information
>gi|116251355|ref|YP_767193.1| ropB outer membrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 211 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target205 outer membrane protein [Candidatus Liberibacter asiatic
COG3637199 COG3637, COG3637, Opacity protein and related surface a 1e-05
>gnl|CDD|33435 COG3637, COG3637, Opacity protein and related surface antigens [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 205 outer membrane protein [Candidatus Liberibacter asiatic
COG3637199 Opacity protein and related surface antigens [Cell enve 100.0
PRK10808 347 outer membrane protein A; Reviewed 100.0
PRK09408171 ompX outer membrane protein X; Provisional 99.86
pfam06316199 Ail_Lom Enterobacterial Ail/Lom protein. This family co 99.79
PRK10959212 outer membrane protein W; Provisional 99.64
pfam07437180 YfaZ YfaZ precursor. This family contains the precursor 99.42
pfam05736184 OprF OprF membrane domain. This domain represents the p 99.25
pfam10626193 TraO Conjugative transposon protein TraO. This is a fam 95.22
pfam01617279 Surface_Ag_2 Surface antigen. This family includes a nu 91.27
pfam01389175 OmpA_membrane OmpA-like transmembrane domain. The struc 99.96
pfam03922189 OmpW OmpW family. This family includes outer membrane p 99.11
COG3047213 OmpW Outer membrane protein W [Cell envelope biogenesis 99.04
pfam03797265 Autotransporter Autotransporter beta-domain. Secretion 97.86
pfam06629226 MipA MltA-interacting protein MipA. This family consist 97.61
cd00342329 gram_neg_porins Porins form aqueous channels for the di 97.02
pfam03797265 Autotransporter Autotransporter beta-domain. Secretion 96.68
pfam11383273 DUF3187 Protein of unknown function (DUF3187). This fam 95.99
pfam02530378 Porin_2 Porin subfamily. This family consists of porins 99.52
PRK10716437 long-chain fatty acid outer membrane transporter; Provi 98.36
pfam03349415 Toluene_X Outer membrane protein transport protein (OMP 98.28
COG2067440 FadL Long-chain fatty acid transport protein [Lipid met 98.23
PRK10716 437 long-chain fatty acid outer membrane transporter; Provi 98.04
pfam03349415 Toluene_X Outer membrane protein transport protein (OMP 97.76
COG2067440 FadL Long-chain fatty acid transport protein [Lipid met 97.53
TIGR03509649 OMP_MtrB_PioB decaheme-associated outer membrane protei 96.96
TIGR03016431 pepcterm_hypo_1 uncharacterized protein, PEP-CTERM syst 96.55
PRK09980230 ompL outer membrane porin L; Provisional 96.12
pfam00267334 Porin_1 Gram-negative porin. 95.97
PRK09980230 ompL outer membrane porin L; Provisional 95.96
pfam09381280 Porin_OmpG Outer membrane protein G (OmpG). Porins are 95.29
COG3713258 OmpV Outer membrane protein V [Cell envelope biogenesis 95.22
pfam01389175 OmpA_membrane OmpA-like transmembrane domain. The struc 94.78
COG5338 468 Uncharacterized protein conserved in bacteria [Function 94.69
pfam06727337 DUF1207 Protein of unknown function (DUF1207). This fam 93.67
pfam11059297 DUF2860 Protein of unknown function (DUF2860). This bac 92.61
pfam02264399 LamB LamB porin. Maltoporin (LamB protein) forms a trim 90.24
pfam02462126 Opacity Opacity family porin protein. Pathogenic Neisse 99.34
pfam10082380 DUF2320 Uncharacterized protein conserved in bacteria ( 97.63
pfam00267334 Porin_1 Gram-negative porin. 97.6
cd00342329 gram_neg_porins Porins form aqueous channels for the di 97.42
COG3203354 OmpC Outer membrane protein (porin) [Cell envelope biog 97.33
pfam11854 675 DUF3374 Protein of unknown function (DUF3374). This fam 97.26
pfam05420339 BCSC_C Cellulose synthase operon protein C C-terminus ( 96.77
PRK10554373 outer membrane porin protein C; Provisional 96.58
pfam10082380 DUF2320 Uncharacterized protein conserved in bacteria ( 96.54
PRK097521250 adhesin; Provisional 96.09
PRK11528254 hypothetical protein; Provisional 96.03
PRK10993311 outer membrane protease; Reviewed 95.66
PRK13483663 enterobactin receptor protein; Provisional 95.37
PRK12580312 outer membrane protease; Reviewed 94.43
pfam06178218 KdgM Oligogalacturonate-specific porin protein (KdgM). 94.36
COG4625577 Uncharacterized protein with a C-terminal OMP (outer me 94.01
PRK114471158 cellulose synthase subunit BcsC; Provisional 93.64
pfam01278295 Omptin Omptin family. The omptin family is a family of 93.53
pfam04338210 DUF481 Protein of unknown function, DUF481. This family 93.14
PRK10159351 outer membrane phosphoporin protein E; Provisional 93.04
PRK10002362 outer membrane protein F; Provisional 92.09
smart00869261 Autotransporter Autotransporter beta-domain. Secretion 92.03
pfam05275210 CopB Copper resistance protein B precursor (CopB). This 91.8
pfam03502259 Channel_Tsx Nucleoside-specific channel-forming protein 90.92
COG3203 354 OmpC Outer membrane protein (porin) [Cell envelope biog 96.91
pfam11854 675 DUF3374 Protein of unknown function (DUF3374). This fam 96.51
PRK10455161 periplasmic protein; Reviewed 93.94
pfam06551145 DUF1120 Protein of unknown function (DUF1120). This fam 93.25
PRK03757191 hypothetical protein; Provisional 91.8
PRK09934171 putative fimbrial protein; Provisional 90.17
pfam05736184 OprF OprF membrane domain. This domain represents the p 96.59
>COG3637 Opacity protein and related surface antigens [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10808 outer membrane protein A; Reviewed Back     alignment and domain information
>PRK09408 ompX outer membrane protein X; Provisional Back     alignment and domain information
>pfam06316 Ail_Lom Enterobacterial Ail/Lom protein Back     alignment and domain information
>PRK10959 outer membrane protein W; Provisional Back     alignment and domain information
>pfam07437 YfaZ YfaZ precursor Back     alignment and domain information
>pfam05736 OprF OprF membrane domain Back     alignment and domain information
>pfam10626 TraO Conjugative transposon protein TraO Back     alignment and domain information
>pfam01617 Surface_Ag_2 Surface antigen Back     alignment and domain information
>pfam01389 OmpA_membrane OmpA-like transmembrane domain Back     alignment and domain information
>pfam03922 OmpW OmpW family Back     alignment and domain information
>COG3047 OmpW Outer membrane protein W [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam03797 Autotransporter Autotransporter beta-domain Back     alignment and domain information
>pfam06629 MipA MltA-interacting protein MipA Back     alignment and domain information
>cd00342 gram_neg_porins Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane Back     alignment and domain information
>pfam03797 Autotransporter Autotransporter beta-domain Back     alignment and domain information
>pfam11383 DUF3187 Protein of unknown function (DUF3187) Back     alignment and domain information
>pfam02530 Porin_2 Porin subfamily Back     alignment and domain information
>PRK10716 long-chain fatty acid outer membrane transporter; Provisional Back     alignment and domain information
>pfam03349 Toluene_X Outer membrane protein transport protein (OMPP1/FadL/TodX) Back     alignment and domain information
>COG2067 FadL Long-chain fatty acid transport protein [Lipid metabolism] Back     alignment and domain information
>PRK10716 long-chain fatty acid outer membrane transporter; Provisional Back     alignment and domain information
>pfam03349 Toluene_X Outer membrane protein transport protein (OMPP1/FadL/TodX) Back     alignment and domain information
>COG2067 FadL Long-chain fatty acid transport protein [Lipid metabolism] Back     alignment and domain information
>TIGR03509 OMP_MtrB_PioB decaheme-associated outer membrane protein, MtrB/PioB family Back     alignment and domain information
>TIGR03016 pepcterm_hypo_1 uncharacterized protein, PEP-CTERM system associated Back     alignment and domain information
>PRK09980 ompL outer membrane porin L; Provisional Back     alignment and domain information
>pfam00267 Porin_1 Gram-negative porin Back     alignment and domain information
>PRK09980 ompL outer membrane porin L; Provisional Back     alignment and domain information
>pfam09381 Porin_OmpG Outer membrane protein G (OmpG) Back     alignment and domain information
>COG3713 OmpV Outer membrane protein V [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam01389 OmpA_membrane OmpA-like transmembrane domain Back     alignment and domain information
>COG5338 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam06727 DUF1207 Protein of unknown function (DUF1207) Back     alignment and domain information
>pfam11059 DUF2860 Protein of unknown function (DUF2860) Back     alignment and domain information
>pfam02264 LamB LamB porin Back     alignment and domain information
>pfam02462 Opacity Opacity family porin protein Back     alignment and domain information
>pfam10082 DUF2320 Uncharacterized protein conserved in bacteria (DUF2320) Back     alignment and domain information
>pfam00267 Porin_1 Gram-negative porin Back     alignment and domain information
>cd00342 gram_neg_porins Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane Back     alignment and domain information
>COG3203 OmpC Outer membrane protein (porin) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam11854 DUF3374 Protein of unknown function (DUF3374) Back     alignment and domain information
>pfam05420 BCSC_C Cellulose synthase operon protein C C-terminus (BCSC_C) Back     alignment and domain information
>PRK10554 outer membrane porin protein C; Provisional Back     alignment and domain information
>pfam10082 DUF2320 Uncharacterized protein conserved in bacteria (DUF2320) Back     alignment and domain information
>PRK09752 adhesin; Provisional Back     alignment and domain information
>PRK11528 hypothetical protein; Provisional Back     alignment and domain information
>PRK10993 outer membrane protease; Reviewed Back     alignment and domain information
>PRK13483 enterobactin receptor protein; Provisional Back     alignment and domain information
>PRK12580 outer membrane protease; Reviewed Back     alignment and domain information
>pfam06178 KdgM Oligogalacturonate-specific porin protein (KdgM) Back     alignment and domain information
>COG4625 Uncharacterized protein with a C-terminal OMP (outer membrane protein) domain [Function unknown] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>pfam01278 Omptin Omptin family Back     alignment and domain information
>pfam04338 DUF481 Protein of unknown function, DUF481 Back     alignment and domain information
>PRK10159 outer membrane phosphoporin protein E; Provisional Back     alignment and domain information
>PRK10002 outer membrane protein F; Provisional Back     alignment and domain information
>smart00869 Autotransporter Autotransporter beta-domain Back     alignment and domain information
>pfam05275 CopB Copper resistance protein B precursor (CopB) Back     alignment and domain information
>pfam03502 Channel_Tsx Nucleoside-specific channel-forming protein, Tsx Back     alignment and domain information
>COG3203 OmpC Outer membrane protein (porin) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam11854 DUF3374 Protein of unknown function (DUF3374) Back     alignment and domain information
>PRK10455 periplasmic protein; Reviewed Back     alignment and domain information
>pfam06551 DUF1120 Protein of unknown function (DUF1120) Back     alignment and domain information
>PRK03757 hypothetical protein; Provisional Back     alignment and domain information
>PRK09934 putative fimbrial protein; Provisional Back     alignment and domain information
>pfam05736 OprF OprF membrane domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target205 outer membrane protein [Candidatus Liberibacter asiatic
3nb3_A 346 The Host Outer Membrane Proteins Ompa And Ompc Are 3e-14
2k0l_A216 Nmr Structure Of The Transmembrane Domain Of The Ou 2e-08
1bxw_A172 Outer Membrane Protein A (Ompa) Transmembrane Domai 6e-08
1qjp_A171 High Resolution Structure Of The Outer Membrane Pro 7e-08
1g90_A176 Nmr Solution Structure Of Outer Membrane Protein A 5e-07
2ge4_A177 High-Resolution Solution Structure Of Outer Membran 5e-07
1orm_A148 Nmr Fold Of The Outer Membrane Protein Ompx In Dhpc 0.001
1qj8_A148 Crystal Structure Of The Outer Membrane Protein Omp 0.001
>gi|323462898|pdb|3NB3|A Chain A, The Host Outer Membrane Proteins Ompa And Ompc Are Packed At Specific Sites In The Shigella Phage Sf6 Virion As Structural Components Length = 346 Back     alignment and structure
 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFINNNGPTHENKLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTYSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|218766516|pdb|2K0L|A Chain A, Nmr Structure Of The Transmembrane Domain Of The Outer Membrane Protein A From Klebsiella Pneumoniae In Dhpc Micelles Length = 216 Back     alignment and structure
>gi|4140005|pdb|1BXW|A Chain A, Outer Membrane Protein A (Ompa) Transmembrane Domain Length = 172 Back     alignment and structure
>gi|14278420|pdb|1G90|A Chain A, Nmr Solution Structure Of Outer Membrane Protein A Transmembrane Domain: 10 Conformers Length = 176 Back     alignment and structure
>gi|99032472|pdb|2GE4|A Chain A, High-Resolution Solution Structure Of Outer Membrane Protein A Transmembrane Domain Length = 177 Back     alignment and structure
>gi|30749947|pdb|1ORM|A Chain A, Nmr Fold Of The Outer Membrane Protein Ompx In Dhpc Micelles Length = 148 Back     alignment and structure
>gi|6435772|pdb|1QJ8|A Chain A, Crystal Structure Of The Outer Membrane Protein Ompx From Escherichia Coli Length = 148 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target205 outer membrane protein [Candidatus Liberibacter asiatic
1orm_A148 Outer membrane protein X; OMPX, trosy, DHPC, detergents 9e-10
>1orm_A Outer membrane protein X; OMPX, trosy, DHPC, detergents, lipids, micelles; NMR {Escherichia coli} SCOP: f.4.1.1 PDB: 1q9f_A 1q9g_A 1qj8_A* 1qj9_A Length = 148 Back     alignment and structure
 Score = 58.5 bits (141), Expect = 9e-10
 Identities = 26/133 (19%), Positives = 44/133 (33%), Gaps = 5/133 (3%)

Query: 75  NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGI-GGSLRIRGGYEVSDSLL 133
           N  G     Y  E+     GV G   YT      +    +      +     Y ++D   
Sbjct: 19  NKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWAS 78

Query: 134 LYATVGPDVAQ-KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
           +Y  VG    + +       +      G + G G++     E++     Y  S+   V+ 
Sbjct: 79  IYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQF-NPMENVALDFSYEQSRIRSVD- 136

Query: 193 FYNTISLGVGMKF 205
              T   GVG +F
Sbjct: 137 -VGTWIAGVGYRF 148


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target205 outer membrane protein [Candidatus Liberibacter asiatic
1orm_A148 Outer membrane protein X; OMPX, trosy, DHPC, detergents 99.93
1p4t_A155 Outer membrane protein NSPA; beta barrel; HET: CXE; 2.5 99.91
2k0l_A216 Outer membrane protein A; OMPA, trosy, sidechain, DHPC 99.89
1qjp_A171 Outer membrane protein A; HET: C8E; 1.65A {Escherichia 99.89
2jmm_A156 Outer membrane protein A; NMR {Escherichia coli} 99.81
2f1v_A197 Outer membrane protein W; outer membrane protein beta b 99.8
2x55_A293 Coagulase/fibrinolysin; plasminogen activator, transmem 99.07
1uyn_X308 NALP; autotransporter, translocator domain, membrane pr 98.87
3kvn_X632 Esterase ESTA; beta barrel, alpha-beta-alpha motif, cel 98.77
2qom_A285 Serine protease ESPP; outer membrane protein, beta-barr 98.63
3aeh_A308 Hemoglobin-binding protease HBP autotransporter; beta-b 98.57
2fgq_X332 OMP32, outer membrane porin protein 32; malate, outer m 95.63
2qom_A285 Serine protease ESPP; outer membrane protein, beta-barr 95.56
2j1n_A346 Outer membrane protein C; beta-barrel, ION transport, n 98.19
3dwo_X451 Probable outer membrane protein; beta barrel; HET: C8E; 98.15
2zfg_A340 Outer membrane protein F; OMPF porin, ordered waters, I 97.77
3dwn_A427 Long-chain fatty acid transport protein; beta barrel, o 97.65
3bry_A441 TBUX; beta barrel, outer membrane protein, transport pr 97.58
3dwo_X451 Probable outer membrane protein; beta barrel; HET: C8E; 97.47
2f1c_X286 OMPG, outer membrane protein G; beta barrel; HET: C8E; 97.02
3bs0_A439 TODX; beta barrel, outer membrane protein, transport pr 96.19
1uyn_X308 NALP; autotransporter, translocator domain, membrane pr 95.67
3dwn_A427 Long-chain fatty acid transport protein; beta barrel, o 98.06
1pho_A330 Phosphoporin; outer membrane protein; 3.00A {Escherichi 97.93
2fgq_X332 OMP32, outer membrane porin protein 32; malate, outer m 97.78
2por_A301 Porin; HET: C8E; 1.80A {Rhodobacter capsulatus} SCOP: f 97.76
3bs0_A439 TODX; beta barrel, outer membrane protein, transport pr 97.56
1i78_A297 Protease VII; integral outer membrane protein, beta bar 97.34
3a2s_X355 Outer membrane protein II; beta barrel, porin, neisseri 96.96
3prn_A289 Porin; integral membrane protein, pore eyelet mutant; H 96.84
2wjr_A214 Probable N-acetylneuraminic acid outer membrane channel 95.55
1i78_A297 Protease VII; integral outer membrane protein, beta bar 94.74
2o4v_A411 Porin P; outer membrane, phosphate, transport, channel, 94.17
3aeh_A 308 Hemoglobin-binding protease HBP autotransporter; beta-b 96.75
1qjp_A171 Outer membrane protein A; HET: C8E; 1.65A {Escherichia 94.81
>1orm_A Outer membrane protein X; OMPX, trosy, DHPC, detergents, lipids, micelles; NMR {Escherichia coli} SCOP: f.4.1.1 PDB: 1q9f_A 1q9g_A 1qj8_A* 1qj9_A Back     alignment and structure
Probab=99.93  E-value=3.9e-29  Score=166.34  Aligned_cols=141  Identities=21%  Similarity=0.232  Sum_probs=110.7

Q ss_pred             CCCCCCCCCCCCCCCCEEEEEEEEEEECCCEEEEEEEEEEECCCCCCCCCCC-CCCEEEEEEEEEEEEECCCEEEEEEEE
Q ss_conf             2333344667777760268998546404837998451013215556666212-232148999897543127677898854
Q gi|254780598|r   61 SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHS-LHGIGGSLRIRGGYEVSDSLLLYATVG  139 (205)
Q Consensus        61 ~~g~~~~~~~~~~~~~~~G~~~GYn~q~~~~V~G~e~d~~~~~~~~~~~~~~-~~~~~~~~~~r~Gy~~~~~~l~Y~~~G  139 (205)
                      ..||+..+.+.. ++...|+++||+||+++.++|+|+++.+.+......... ......++.++..|+++|++++|+++|
T Consensus         6 ~~Gy~~~d~~~~-~~~~~G~~~gy~y~~~~~~~GvE~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~Y~~~G   84 (148)
T 1orm_A            6 TGGYAQSDAQGQ-MNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVG   84 (148)
T ss_dssp             CCCCCCCCCTTT-CCCCCCCCCCBCCCSSSCSCCCCBCCCCCCCCCCSSSCCSCCSCCCBCCBCCCCCCTTTCCCCCCEE
T ss_pred             EEEEEEECCCCC-CCCCCEEEEEEEEECCCCEEEEEEEEEECCCCCCCCCCCEEEEEEEEEEEEEEEEECCCEEEEEEEE
T ss_conf             803898515677-7764348999718858935999999991247651046742555599998888998278575999988


Q ss_pred             EEEEEEEECCCC-CCCCCCCEEEEEEEEEEEECCCCCEEEEEEEEEEECCCCCCCCEEEEEEEEEEC
Q ss_conf             477644431345-556775204799734661004886799999999750565566226999998539
Q gi|254780598|r  140 PDVAQKYETGKA-GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF  205 (205)
Q Consensus       140 ~a~~~~~~~~~~-~~~~~~~~g~~~G~Gvey~~it~~~~~r~EY~y~df~~~~~~~~~~~~G~~ykF  205 (205)
                      +++.+.+.+... ...+++..+|.+|+|+|| +|++||++|+||+|+++++.+  .|++++||+|||
T Consensus        85 ~a~~~~~~~~~~~~~~s~~~~~~~~G~Gvey-~lt~n~~~~~eY~~~~~~~~d--~~~~~vGv~Y~F  148 (148)
T 1orm_A           85 VGYGKFQTTEYPTYKNDTSDYGFSYGAGLQF-NPMENVALDFSYEQSRIRSVD--VGTWIAGVGYRF  148 (148)
T ss_dssp             CBCCSCSCCSSSSCCCCCCCCCCEECCCCCC-CCSSSCBCCCCCCCCCSSSCC--CCCCCCCCBCCC
T ss_pred             EEEEEEEECCCCCCCCCCCCCCEEEECEEEE-EECCCEEEEEEEEEEECCCCC--EEEEEEEEEEEC
T ss_conf             6478877312554311355211558130899-865887999999997079961--216999989989



>1p4t_A Outer membrane protein NSPA; beta barrel; HET: CXE; 2.55A {Neisseria meningitidis} SCOP: f.4.1.1 Back     alignment and structure
>2k0l_A Outer membrane protein A; OMPA, trosy, sidechain, DHPC micelles; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1qjp_A Outer membrane protein A; HET: C8E; 1.65A {Escherichia coli} SCOP: f.4.1.1 PDB: 1bxw_A* 1g90_A 2ge4_A Back     alignment and structure
>2jmm_A Outer membrane protein A; NMR {Escherichia coli} Back     alignment and structure
>2f1v_A Outer membrane protein W; outer membrane protein beta barrel; 2.70A {Escherichia coli K12} PDB: 2f1t_A Back     alignment and structure
>2x55_A Coagulase/fibrinolysin; plasminogen activator, transmembrane, aspartyl protease, CEL membrane, omptin, protease, hydrolase,; HET: C8E; 1.85A {Yersinia pestis} PDB: 2x56_A* 2x4m_A* Back     alignment and structure
>1uyn_X NALP; autotransporter, translocator domain, membrane protein, outer membrane, beta-domain, beta-barrel; HET: CXE; 2.6A {Neisseria meningitidis} SCOP: f.4.5.1 PDB: 1uyo_X* Back     alignment and structure
>3kvn_X Esterase ESTA; beta barrel, alpha-beta-alpha motif, cell membrane, cell outer membrane, hydrolase, membrane, transmembrane; HET: C8E; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2qom_A Serine protease ESPP; outer membrane protein, beta-barrel, beta-domain, autotransporter, hydrolase, plasmid, secreted, transmembrane; 2.66A {Escherichia coli O157} Back     alignment and structure
>3aeh_A Hemoglobin-binding protease HBP autotransporter; beta-barrel, auto-proteolytic, reaction intermediate, mutant membrane, cell outer membrane; 2.00A {Escherichia coli} Back     alignment and structure
>2fgq_X OMP32, outer membrane porin protein 32; malate, outer membrane protein; HET: BOG; 1.45A {Delftia acidovorans} SCOP: f.4.3.1 PDB: 2fgr_A 1e54_A Back     alignment and structure
>2qom_A Serine protease ESPP; outer membrane protein, beta-barrel, beta-domain, autotransporter, hydrolase, plasmid, secreted, transmembrane; 2.66A {Escherichia coli O157} Back     alignment and structure
>2j1n_A Outer membrane protein C; beta-barrel, ION transport, non-specific porin, general porin, osmoporin, transmembrane transport; HET: D12; 2.0A {Escherichia coli} PDB: 2j4u_P 2zle_D 2ixx_A* 2xe1_A* 2xe2_A* 2ixw_A* 2xe5_A* 2xe3_A* 2xg6_A 1osm_A* Back     alignment and structure
>3dwo_X Probable outer membrane protein; beta barrel; HET: C8E; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>2zfg_A Outer membrane protein F; OMPF porin, ordered waters, ION transport, phage recognition, transmembrane, transport; HET: C8E; 1.59A {Escherichia coli} SCOP: f.4.3.1 PDB: 1opf_A* 2omf_A* 2zld_A 3k19_A 3k1b_A 3hw9_A* 3hwb_A* 1hxx_A 3fyx_A* 1bt9_A 1mpf_A* 1gfq_A* 1gfp_A* 1gfm_A* 1gfo_A* 1hxu_A 1hxt_A* 1gfn_A* Back     alignment and structure
>3dwn_A Long-chain fatty acid transport protein; beta barrel, outer membrane protein, lipid transport, membrane, outer membrane, phage recognition; HET: LDA; 2.50A {Escherichia coli} PDB: 1t16_A* 1t1l_A* 2r4p_A* 2r4n_A* 2r4l_A* 2r4o_A* 2r89_A 2r8a_A* 2r88_A Back     alignment and structure
>3bry_A TBUX; beta barrel, outer membrane protein, transport protein; HET: C8E; 3.20A {Ralstonia pickettii} Back     alignment and structure
>3dwo_X Probable outer membrane protein; beta barrel; HET: C8E; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>2f1c_X OMPG, outer membrane protein G; beta barrel; HET: C8E; 2.30A {Escherichia coli K12} PDB: 2wvp_A* 2jqy_A 2iwv_A* 2iww_A* Back     alignment and structure
>3bs0_A TODX; beta barrel, outer membrane protein, transport protein; HET: C8E; 2.60A {Pseudomonas putida} PDB: 3brz_A* Back     alignment and structure
>1uyn_X NALP; autotransporter, translocator domain, membrane protein, outer membrane, beta-domain, beta-barrel; HET: CXE; 2.6A {Neisseria meningitidis} SCOP: f.4.5.1 PDB: 1uyo_X* Back     alignment and structure
>3dwn_A Long-chain fatty acid transport protein; beta barrel, outer membrane protein, lipid transport, membrane, outer membrane, phage recognition; HET: LDA; 2.50A {Escherichia coli} PDB: 1t16_A* 1t1l_A* 2r4p_A* 2r4n_A* 2r4l_A* 2r4o_A* 2r89_A 2r8a_A* 2r88_A Back     alignment and structure
>1pho_A Phosphoporin; outer membrane protein; 3.00A {Escherichia coli} SCOP: f.4.3.1 Back     alignment and structure
>2fgq_X OMP32, outer membrane porin protein 32; malate, outer membrane protein; HET: BOG; 1.45A {Delftia acidovorans} SCOP: f.4.3.1 PDB: 2fgr_A 1e54_A Back     alignment and structure
>2por_A Porin; HET: C8E; 1.80A {Rhodobacter capsulatus} SCOP: f.4.3.1 PDB: 3por_A* Back     alignment and structure
>3bs0_A TODX; beta barrel, outer membrane protein, transport protein; HET: C8E; 2.60A {Pseudomonas putida} PDB: 3brz_A* Back     alignment and structure
>1i78_A Protease VII; integral outer membrane protein, beta barrel, hydrolase; HET: BOG; 2.60A {Escherichia coli K12} SCOP: f.4.4.1 Back     alignment and structure
>3a2s_X Outer membrane protein II; beta barrel, porin, neisseria mening cell membrane, cell outer membrane, ION transport, membrane transmembrane; HET: SUC LDA; 2.20A {Neisseria meningitidis} PDB: 3a2r_X* 3a2t_X* 3a2u_X* Back     alignment and structure
>3prn_A Porin; integral membrane protein, pore eyelet mutant; HET: C8E; 1.90A {Rhodobacter blasticus} SCOP: f.4.3.1 PDB: 1bh3_A* 1prn_A* 7prn_A* 6prn_A* 5prn_A* 2prn_A* 8prn_A* 1h6s_1 Back     alignment and structure
>2wjr_A Probable N-acetylneuraminic acid outer membrane channel protein NANC; cell membrane, ION transport, transmembrane, porin, transport; HET: EPE; 1.80A {Escherichia coli} PDB: 2wjq_A* Back     alignment and structure
>1i78_A Protease VII; integral outer membrane protein, beta barrel, hydrolase; HET: BOG; 2.60A {Escherichia coli K12} SCOP: f.4.4.1 Back     alignment and structure
>2o4v_A Porin P; outer membrane, phosphate, transport, channel, membrane protein; HET: C8E; 1.94A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3aeh_A Hemoglobin-binding protease HBP autotransporter; beta-barrel, auto-proteolytic, reaction intermediate, mutant membrane, cell outer membrane; 2.00A {Escherichia coli} Back     alignment and structure
>1qjp_A Outer membrane protein A; HET: C8E; 1.65A {Escherichia coli} SCOP: f.4.1.1 PDB: 1bxw_A* 1g90_A 2ge4_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 205 outer membrane protein [Candidatus Liberibacter asiatic
d1qj8a_148 f.4.1.1 (A:) Outer membrane protein X (OMPX) {Escherich 9e-10
d1p4ta_155 f.4.1.1 (A:) Outer membrane protein NspA {Neisseria men 0.001
>d1qj8a_ f.4.1.1 (A:) Outer membrane protein X (OMPX) {Escherichia coli [TaxId: 562]} Length = 148 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Transmembrane beta-barrels
superfamily: OMPA-like
family: Outer membrane protein
domain: Outer membrane protein X (OMPX)
species: Escherichia coli [TaxId: 562]
 Score = 57.3 bits (138), Expect = 9e-10
 Identities = 27/133 (20%), Positives = 44/133 (33%), Gaps = 5/133 (3%)

Query: 75  NAGGSIFAGYNVEDSCIMYGVEGDVRYTVP-VLADNIHSLHGIGGSLRIRGGYEVSDSLL 133
           N  G     Y  E+     GV G   YT     A +          +     Y ++D   
Sbjct: 19  NKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWAS 78

Query: 134 LYATVGPDVAQ-KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
           +Y  VG    + +       +      G + G G++     E++     Y  S+   V+ 
Sbjct: 79  IYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQF-NPMENVALDFSYEQSRIRSVD- 136

Query: 193 FYNTISLGVGMKF 205
              T   GVG +F
Sbjct: 137 -VGTWIAGVGYRF 148


>d1p4ta_ f.4.1.1 (A:) Outer membrane protein NspA {Neisseria meningitidis [TaxId: 487]} Length = 155 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target205 outer membrane protein [Candidatus Liberibacter asiatic
d1qj8a_148 Outer membrane protein X (OMPX) {Escherichia coli [TaxI 99.96
d1p4ta_155 Outer membrane protein NspA {Neisseria meningitidis [Ta 99.92
d1qjpa_171 Outer membrane protein A (OMPA) transmembrane domain {E 99.91
d1uynx_299 Translocator domain of NalP {Neisseria meningitidis [Ta 99.0
d1i78a_297 Outer membrane protease OMPT {Escherichia coli [TaxId: 97.48
d1phoa_330 Porin {Escherichia coli, different sequences [TaxId: 56 98.04
d1osma_342 Porin {Klebsiella pneumoniae [TaxId: 573]} 97.99
d1t16a_427 Long-chain fatty acid transport protein FadL {Escherich 97.75
d3prna_289 Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId 97.62
d2fgqx1330 Porin {Comamonas acidovorans [TaxId: 80866]} 97.6
d2pora_301 Porin {Rhodobacter capsulatus [TaxId: 1061]} 97.15
d2zfga1340 Porin {Escherichia coli, different sequences [TaxId: 56 97.88
d1t16a_427 Long-chain fatty acid transport protein FadL {Escherich 97.36
>d1qj8a_ f.4.1.1 (A:) Outer membrane protein X (OMPX) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Transmembrane beta-barrels
superfamily: OMPA-like
family: Outer membrane protein
domain: Outer membrane protein X (OMPX)
species: Escherichia coli [TaxId: 562]
Probab=99.96  E-value=4.4e-29  Score=164.85  Aligned_cols=141  Identities=21%  Similarity=0.231  Sum_probs=113.3

Q ss_pred             CCCCCCCCCCCCCCCCEEEEEEEEEEECCCEEEEEEEEEEECCCCCCC-CCCCCCCEEEEEEEEEEEEECCCEEEEEEEE
Q ss_conf             233334466777776026899854640483799845101321555666-6212232148999897543127677898854
Q gi|254780598|r   61 SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-NIHSLHGIGGSLRIRGGYEVSDSLLLYATVG  139 (205)
Q Consensus        61 ~~g~~~~~~~~~~~~~~~G~~~GYn~q~~~~V~G~e~d~~~~~~~~~~-~~~~~~~~~~~~~~r~Gy~~~~~~l~Y~~~G  139 (205)
                      ..||+..+.+ ..++...|+.+||+||+.++++|+|+++.+.+.+... ..........++.+|..|++++++++|+++|
T Consensus         6 ~~Gy~~~d~~-~~~~~~~G~~lgy~y~~~n~~~gvE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~~~G   84 (148)
T d1qj8a_           6 TGGYAQSDAQ-GQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVG   84 (148)
T ss_dssp             EEEEEEEEET-TTEEEEEEEEEEEEEECTTCSEEEEEEEEEEEEEEECTTSCEEEEEEEEEEEEEEEEEETTEEEEEEEE
T ss_pred             EEEEEEECCC-CCCCCCCEEEEEEEEEECCCEEEEEEEEEEECCCCCCCCCCCCEEEEEEEEEEEEEECCCCEEEEEEEE
T ss_conf             9478962356-778861149999828917917999999998856783046631101588999888897477454989867


Q ss_pred             EEEEEEEECCC-CCCCCCCCEEEEEEEEEEEECCCCCEEEEEEEEEEECCCCCCCCEEEEEEEEEEC
Q ss_conf             47764443134-5556775204799734661004886799999999750565566226999998539
Q gi|254780598|r  140 PDVAQKYETGK-AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF  205 (205)
Q Consensus       140 ~a~~~~~~~~~-~~~~~~~~~g~~~G~Gvey~~it~~~~~r~EY~y~df~~~~~~~~~~~~G~~ykF  205 (205)
                      +++.+.+.+.. ..+.+++..+|.+|+|+|| +|++||++|+||||+++++.+  .|++++|++|||
T Consensus        85 ~a~~~~~~~~~~~~~~~~~~~g~~~G~Gvey-~l~~n~~~~~eY~~~~~~~~d--~~~~~~Gv~YrF  148 (148)
T d1qj8a_          85 VGYGKFQTTEYPTYKNDTSDYGFSYGAGLQF-NPMENVALDFSYEQSRIRSVD--VGTWIAGVGYRF  148 (148)
T ss_dssp             EEEEEEEEEETTTEEEEEEEEEEEEEEEEEE-CSSTTEEEEEEEEEEEETTEE--EEEEEEEEEEEC
T ss_pred             EEEEEEEECCCCCCCCCCCCCCEEEEEEEEE-EECCCEEEEEEEEEEECCCCE--EEEEEEEEEEEC
T ss_conf             7899998413787655645444469621799-806887999999997479943--306999989889



>d1p4ta_ f.4.1.1 (A:) Outer membrane protein NspA {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1uynx_ f.4.5.1 (X:) Translocator domain of NalP {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1i78a_ f.4.4.1 (A:) Outer membrane protease OMPT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1phoa_ f.4.3.1 (A:) Porin {Escherichia coli, different sequences [TaxId: 562]} Back     information, alignment and structure
>d1osma_ f.4.3.1 (A:) Porin {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1t16a_ f.4.3.4 (A:) Long-chain fatty acid transport protein FadL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3prna_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]} Back     information, alignment and structure
>d2fgqx1 f.4.3.1 (X:3-332) Porin {Comamonas acidovorans [TaxId: 80866]} Back     information, alignment and structure
>d2pora_ f.4.3.1 (A:) Porin {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2zfga1 f.4.3.1 (A:1-340) Porin {Escherichia coli, different sequences [TaxId: 562]} Back     information, alignment and structure
>d1t16a_ f.4.3.4 (A:) Long-chain fatty acid transport protein FadL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 205 outer membrane protein [Candidatus Liberibacter as
1orm_A_148 (A:) Outer membrane protein X; OMPX, trosy, DHPC, 2e-07
1qjp_A_171 (A:) Outer membrane protein A; HET: C8E; 1.65A {Es 0.001
>1orm_A (A:) Outer membrane protein X; OMPX, trosy, DHPC, detergents, lipids, micelles; NMR {Escherichia coli}Length = 148 Back     alignment and structure
 Score = 50.0 bits (119), Expect = 2e-07
 Identities = 26/142 (18%), Positives = 45/142 (31%), Gaps = 5/142 (3%)

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGI-GGSLRIRG 124
                +   N  G     Y  E+     GV G   YT      +    +      +    
Sbjct: 10  AQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGP 69

Query: 125 GYEVSDSLLLYATVGPDVAQ-KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYR 183
            Y ++D   +Y  VG    + +       +      G + G G++     E++     Y 
Sbjct: 70  AYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQF-NPMENVALDFSYE 128

Query: 184 ASKYSKVEGFYNTISLGVGMKF 205
            S+   V+    T   GVG +F
Sbjct: 129 QSRIRSVD--VGTWIAGVGYRF 148


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target205 outer membrane protein [Candidatus Liberibacter asiatic
1p4t_A_155 Outer membrane protein NSPA; beta barrel; HET: CXE 99.93
1qjp_A_171 Outer membrane protein A; HET: C8E; 1.65A {Escheri 99.89
1orm_A_148 Outer membrane protein X; OMPX, trosy, DHPC, deter 99.85
2f1v_A_197 Outer membrane protein W; outer membrane protein b 99.85
2k0l_A_216 Outer membrane protein A; OMPA, trosy, sidechain, 99.85
2jmm_A_156 Outer membrane protein A; NMR {Escherichia coli} ( 99.84
1uyn_X_308 NALP; autotransporter, translocator domain, membra 98.86
2qom_A_285 Serine protease ESPP; outer membrane protein, beta 98.8
3kvn_X_322-632311 Esterase ESTA; beta barrel, alpha-beta-alpha motif 98.58
2f1c_X_286 OMPG, outer membrane protein G; beta barrel; HET: 97.44
2qom_A_285 Serine protease ESPP; outer membrane protein, beta 96.06
2wjr_A_214 Probable N-acetylneuraminic acid outer membrane ch 95.33
2f1c_X_286 OMPG, outer membrane protein G; beta barrel; HET: 99.14
2por_A_301 Porin; HET: C8E; 1.80A {Rhodobacter capsulatus} (A 98.06
3prn_A_289 Porin; integral membrane protein, pore eyelet muta 97.93
2j1n_A_346 Outer membrane protein C; beta-barrel, ION transpo 97.92
2wjr_A_214 Probable N-acetylneuraminic acid outer membrane ch 95.81
2o4v_A_411 Porin P; outer membrane, phosphate, transport, cha 95.44
2fgq_X_332 OMP32, outer membrane porin protein 32; malate, ou 94.87
3bry_A_441 TBUX; beta barrel, outer membrane protein, transpo 94.3
2vdf_A_253 OPCA, outer membrane protein; invasin, adhesin, be 92.95
2qtk_A_390 Probable porin; outer membrane protein, beta barre 92.43
3jty_A_402 BENF-like porin; PFL_1329, benzoate transporter, e 92.32
1pho_A_330 Phosphoporin; outer membrane protein; 3.00A {Esche 98.05
1i78_A_297 Protease VII; integral outer membrane protein, bet 97.92
2zfg_A_340 Outer membrane protein F; OMPF porin, ordered wate 97.79
1uyn_X_308 NALP; autotransporter, translocator domain, membra 96.0
2erv_A_150 Hypothetical protein PAER03002360; beta barrel, ou 97.58
2jmm_A_156 Outer membrane protein A; NMR {Escherichia coli} ( 96.69
1qjp_A_171 Outer membrane protein A; HET: C8E; 1.65A {Escheri 96.42
2f1v_A_197 Outer membrane protein W; outer membrane protein b 94.76
2k0l_A_216 Outer membrane protein A; OMPA, trosy, sidechain, 96.02
3kvn_X_322-632 311 Esterase ESTA; beta barrel, alpha-beta-alpha motif 95.81
>1p4t_A (A:) Outer membrane protein NSPA; beta barrel; HET: CXE; 2.55A {Neisseria meningitidis} Back     alignment and structure
Probab=99.93  E-value=4.9e-25  Score=146.06  Aligned_cols=147  Identities=16%  Similarity=0.112  Sum_probs=119.1

Q ss_pred             CCCCCCCCCCCCCCCCCC-CCCCCCEEEEEEEEEEECCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEEEEEEEEECCC
Q ss_conf             421000122333344667-7777602689985464048379984510132155566662122321489998975431276
Q gi|254780598|r   53 FNGPYAGLSALYNGSFGE-EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS  131 (205)
Q Consensus        53 w~G~y~g~~~g~~~~~~~-~~~~~~~~G~~~GYn~q~~~~V~G~e~d~~~~~~~~~~~~~~~~~~~~~~~~r~Gy~~~~~  131 (205)
                      -+++|+|..+|+.....+ +.+++...++.+||+|+.    +++|+++.+...........+. +...+.++..|+++++
T Consensus         3 ~~~~yvg~~~G~~~~~~~~~~~~~~~~g~~~GY~fn~----~~~e~~~~~~~~~~~~~~~~~~-~~~~l~~~~~~~~~~~   77 (155)
T 1p4t_A            3 ASGFYVQADAAHAKASSSLGSAKGFSPRISAGYRIND----LRFAVDYTRYKNYKAPSTDFKL-YSIGASAIYDFDTQSP   77 (155)
T ss_dssp             CEEEEEEEEEEEEEEECSSCEEEEECCEEEEEEEETT----EEEEEEEEEEEESSCCSSCCEE-EEEEEEEEEECCCSSS
T ss_pred             CCCEEEEEECEEEECCCCCCCCCCEEEEEEEEEECCC----EEEEEEEEEECCCCCCCCEEEE-EEEEEEEEEEECCCCC
T ss_conf             7642897864176134766778857489999998079----9999999995354678702578-8999999998436785


Q ss_pred             EEEEEEEEEEEEEEEECCCC-CCCCCCCEEEEEEEEEEEECCCCCEEEEEEEEEEECCCC----CCCCEEEEEEEEEEC
Q ss_conf             77898854477644431345-556775204799734661004886799999999750565----566226999998539
Q gi|254780598|r  132 LLLYATVGPDVAQKYETGKA-GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV----EGFYNTISLGVGMKF  205 (205)
Q Consensus       132 ~l~Y~~~G~a~~~~~~~~~~-~~~~~~~~g~~~G~Gvey~~it~~~~~r~EY~y~df~~~----~~~~~~~~~G~~ykF  205 (205)
                      +.||+++|+++++.+.+... .+.+++..++.+|+|+|| +|+|||++++||||+++++.    +.+.|.+++|++|||
T Consensus        78 ~~~Y~~~G~~~~~~~~~~~~~~~~~~~~~~~~~g~G~~y-~i~~~~~~~~~y~y~~~~~~~~~~~~~~~~~~lGv~Y~F  155 (155)
T 1p4t_A           78 VKPYLGARLSLNRASVDLGGSDSFSQTSIGLGVLTGVSY-AVTPNVDLDAGYRYNYIGKVNTVKNVRSGELSAGVRVKF  155 (155)
T ss_dssp             EEEEEEEEEEEEEEEEEETTEEEECCCEEEEEEEEEEEE-EEETTEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEC
T ss_pred             EEEEEEEEEEEEEEEEECCCCCCCCCCEEEEEEEEEEEE-EECCCEEEEEEEEEEECCCCCCCCCEEEEEEEEEEEEEC
T ss_conf             669999889999998201555655663273147317999-945899999999999766766575200228999999999



>1orm_A (A:) Outer membrane protein X; OMPX, trosy, DHPC, detergents, lipids, micelles; NMR {Escherichia coli} Back     alignment and structure
>2f1v_A (A:) Outer membrane protein W; outer membrane protein beta barrel; 2.70A {Escherichia coli K12} PDB: 2f1t_A Back     alignment and structure
>2k0l_A (A:) Outer membrane protein A; OMPA, trosy, sidechain, DHPC micelles; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2jmm_A (A:) Outer membrane protein A; NMR {Escherichia coli} Back     alignment and structure
>1uyn_X (X:) NALP; autotransporter, translocator domain, membrane protein, outer membrane, beta-domain, beta-barrel; HET: CXE; 2.6A {Neisseria meningitidis} Back     alignment and structure
>2qom_A (A:) Serine protease ESPP; outer membrane protein, beta-barrel, beta-domain, autotransporter, hydrolase, plasmid, secreted, transmembrane; 2.66A {Escherichia coli O157} Back     alignment and structure
>3kvn_X (X:322-632) Esterase ESTA; beta barrel, alpha-beta-alpha motif, cell membrane, cell outer membrane, hydrolase, membrane, transmembrane; HET: C8E; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2f1c_X (X:) OMPG, outer membrane protein G; beta barrel; HET: C8E; 2.30A {Escherichia coli K12} PDB: 2jqy_A 2iwv_A* 2iww_A* Back     alignment and structure
>2qom_A (A:) Serine protease ESPP; outer membrane protein, beta-barrel, beta-domain, autotransporter, hydrolase, plasmid, secreted, transmembrane; 2.66A {Escherichia coli O157} Back     alignment and structure
>2wjr_A (A:) Probable N-acetylneuraminic acid outer membrane channel protein NANC; cell membrane, ION transport, transmembrane, porin, transport; HET: EPE; 1.80A {Escherichia coli} PDB: 2wjq_A* Back     alignment and structure
>2f1c_X (X:) OMPG, outer membrane protein G; beta barrel; HET: C8E; 2.30A {Escherichia coli K12} PDB: 2jqy_A 2iwv_A* 2iww_A* Back     alignment and structure
>2por_A (A:) Porin; HET: C8E; 1.80A {Rhodobacter capsulatus} Back     alignment and structure
>3prn_A (A:) Porin; integral membrane protein, pore eyelet mutant; HET: C8E; 1.90A {Rhodopseudomonas blastica} Back     alignment and structure
>2j1n_A (A:) Outer membrane protein C; beta-barrel, ION transport, non-specific porin, general porin, osmoporin, transmembrane transport; HET: D12; 2.0A {Escherichia coli} PDB: 2j4u_P 2zle_D 2ixx_A* 2ixw_A* 1osm_A* Back     alignment and structure
>2wjr_A (A:) Probable N-acetylneuraminic acid outer membrane channel protein NANC; cell membrane, ION transport, transmembrane, porin, transport; HET: EPE; 1.80A {Escherichia coli} PDB: 2wjq_A* Back     alignment and structure
>2o4v_A (A:) Porin P; outer membrane, phosphate, transport, channel, membrane protein; HET: C8E; 1.94A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2fgq_X (X:) OMP32, outer membrane porin protein 32; malate, outer membrane protein; HET: BOG; 1.45A {Delftia acidovorans} Back     alignment and structure
>3bry_A (A:) TBUX; beta barrel, outer membrane protein, transport protein; HET: C8E; 3.20A {Ralstonia pickettii} Back     alignment and structure
>2vdf_A (A:) OPCA, outer membrane protein; invasin, adhesin, beta barrel; 1.95A {Neisseria meningitidis} Back     alignment and structure
>2qtk_A (A:) Probable porin; outer membrane protein, beta barrel, vanillate transport; HET: C8E; 2.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3jty_A (A:) BENF-like porin; PFL_1329, benzoate transporter, efflux pump, structural genomics, PSI-2, protein structure initiative; HET: LDA; 2.58A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>1pho_A (A:) Phosphoporin; outer membrane protein; 3.00A {Escherichia coli} Back     alignment and structure
>1i78_A (A:) Protease VII; integral outer membrane protein, beta barrel, hydrolase; HET: BOG; 2.60A {Escherichia coli K12} Back     alignment and structure
>2zfg_A (A:) Outer membrane protein F; OMPF porin, ordered waters, ION transport, phage recognition, transmembrane, transport; HET: C8E; 1.59A {Escherichia coli} Back     alignment and structure
>1uyn_X (X:) NALP; autotransporter, translocator domain, membrane protein, outer membrane, beta-domain, beta-barrel; HET: CXE; 2.6A {Neisseria meningitidis} Back     alignment and structure
>2erv_A (A:) Hypothetical protein PAER03002360; beta barrel, outer membrane, enzyme, hydrolase, lipopolysaccharide, membrane protein; HET: CXE; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2jmm_A (A:) Outer membrane protein A; NMR {Escherichia coli} Back     alignment and structure
>1qjp_A (A:) Outer membrane protein A; HET: C8E; 1.65A {Escherichia coli} Back     alignment and structure
>2f1v_A (A:) Outer membrane protein W; outer membrane protein beta barrel; 2.70A {Escherichia coli K12} PDB: 2f1t_A Back     alignment and structure
>2k0l_A (A:) Outer membrane protein A; OMPA, trosy, sidechain, DHPC micelles; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3kvn_X (X:322-632) Esterase ESTA; beta barrel, alpha-beta-alpha motif, cell membrane, cell outer membrane, hydrolase, membrane, transmembrane; HET: C8E; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure