255764497

255764497

ABC transporter permease

GeneID in NCBI database:8209594Locus tag:CLIBASIA_02420
Protein GI in NCBI database:255764497Protein Accession:YP_003065010.2
Gene range:+(685459, 687222)Protein Length:587aa
Gene description:ABC transporter permease
COG prediction:[P] ABC-type anion transport system, duplicated permease component
KEGG prediction:ABC transporter permease; K02050 sulfonate/nitrate/taurine transport system permease protein
SEED prediction:ABC-type anion transport system, duplicated permease component
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM12 TM-Helix
TOPPRED12 TM-Helix
HMMTOP14 TM-Helix
MEMSAT8 TM-Helix
MEMSAT_SVM11 TM-Helix
PHOBIUS13 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------
MFLYNILPPFISRRIFPNIFDLLAFVLVIGIINILLHGIQETTVPRDIVDIVPITLDVHSLPQYASRTTLRMLSAMVISLLFTFVYATLAAKSRRLGMVLVPILDIMQSIPILGFLTFTVVYFMNLYPGKVIGAELAAIFAIFTSQVWNMTFSMYQSLCNIPRDLEEVSRSFRLSGWQKFWYLGVPFSMPGLVWNMMMSMSGGWFFVVASEMIVVGDTVIPLPGIGSYIALAIKEQDLLAILYAMLTMLGVIFLYDQLLFRPMIVWSNKFRLERTTGIYPADSWVLYLFRKTNFLRFIGYSSWNFFSPLSNNVKKLCRTLGVIRFHFPENFLQLCSNQRVSYMLDIFWFCVVCGVAIGIAWQSIGYIVNHFTYQDVLYVIWLGCITMFRVVVLIIIASIIWIPVGIWIGFRPHISSKIQPFAQLLAAFPANVFFPLVVSCVSYYHLNPNLWLSLLMIFGTQWYILFNVIAGASAFPNDFKEVASSFHITGWRWWRYIILPGIFPYYVTGAITACGGAWNASIVSEVASWGHIHLRTTGLGAYIAESTEKGSFPEVVLGVLIMCCFVLALNRFLWHPLYLYGTRCLRL
cHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
mflynilppfisrrifpNIFDLLAFVLVIGIINILLhgiqettvprdivdivpitldvhslpqyasrTTLRMLSAMVISLLFTFVYATLAAKSRRLGMVLVPILdimqsipilgFLTFTVVYFMNLYPGKVIGAELAAIFAIFTSQVWNMTFSMYQSLCNIPRDLEEVSRSFRLSGWQKfwylgvpfsmpglVWNMMMSMSGGWFFVVASEMIVvgdtviplpgigSYIALAIKEQDLLAILYAMLTMLGVIFLydqllfrpmivwsnkfrlerttgiypadswVLYLFRKTNFLRFIGysswnffsplsNNVKKLCRTLgvirfhfpenfLQLCSNQRVSYMLDIFWFCVVCGVAIGIAWQSIGYIVNHFTYQDVLYVIWLGCITMFRVVVLIIIASIiwipvgiwigfrphisskIQPFAQLLAAFPANVFFPLVVSCVSYYHLNPNLWLSLLMIFGTQWYILFNVIagasafpndfkEVASSFHITgwrwwryiilpgifpyyvtGAITACGGAWNASIVSEVASWGHIHLRTTGLGAYIaestekgsfpeVVLGVLIMCCFVLALNRflwhplylygtrclrl
MFLYNILPPFISRRIFPNIFDLLAFVLVIGIINILLHGIQETTVPRDIVDIVPITLDVHSLPQYASRTTLRMLSAMVISLLFTFVYATLAAKSRRLGMVLVPILDIMQSIPILGFLTFTVVYFMNLYPGKVIGAELAAIFAIFTSQVWNMTFSMYQSLCNIPRDLEEVSRSFRLSGWQKFWYLGVPFSMPGLVWNMMMSMSGGWFFVVASEMIVVGDTVIPLPGIGSYIALAIKEQDLLAILYAMLTMLGVIFLYDQLLFRPMIVWSNKFrlerttgiypadswVLYLFRKTNFLRFIGYSSWNFFSPLSNNVKKLCRTLGVIRFHFPENFLQLCSNQRVSYMLDIFWFCVVCGVAIGIAWQSIGYIVNHFTYQDVLYVIWLGCITMFRVVVLIIIASIIWIPVGIWIGFRPHISSKIQPFAQLLAAFPANVFFPLVVSCVSYYHLNPNLWLSLLMIFGTQWYILFNVIAGASAFPNDFKEVASSFHITGWRWWRYIILPGIFPYYVTGAITACGGAWNASIVSEVASWGHIHLRTTGLGAYIAESTEKGSFPEVVLGVLIMCCFVLALNRFLWHPLYLYGTRCLRL
MFLYNILPPFISRRIFPNIFDLLAFVLVIGIINILLHGIQETTVPRDIVDIVPITLDVHSLPQYASRTTLRMLSAMVISLLFTFVYATLAAKSRRLGMVLVPILDIMQSIPILGFLTFTVVYFMNLYPGKVIGAELAAIFAIFTSQVWNMTFSMYQSLCNIPRDLEEVSRSFRLSGWQKFWYLGVPFSMPGLVWNMMMSMSGGWFFVVASEMIVVGDTVIPLPGIGSYIALAIKEQDLLAILYAMLTMLGVIFLYDQLLFRPMIVWSNKFRLERTTGIYPADSWVLYLFRKTNFLRFIGYSSWNFFSPLSNNVKKLCRTLGVIRFHFPENFLQLCSNQRVSYMLDIFWFCVVCGVAIGIAWQSIGYIVNHFTYQDVLYVIWLGCITMFRvvvliiiasiiwipvgiwiGFRPHISSKIQPFAQLLAAFPANVFFPLVVSCVSYYHLNPNLWLSLLMIFGTQWYILFNVIAGASAFPNDFKEVASSFHITGWRWWRYIILPGIFPYYVTGAITACGGAWNASIVSEVASWGHIHLRTTGLGAYIAESTEKGSFPEVVLGVLIMCCFVLALNRFLWHPLYLYGTRCLRL
*******PPFISRRIFPNIFDLLAFVLVIGIINILLHGIQETTVPRDIVDIVPITLDVHSLPQYASRTTLRMLSAMVISLLFTFVYATLAAKSRRLGMVLVPILDIMQSIPILGFLTFTVVYFMNLYPGKVIGAELAAIFAIFTSQVWNMTFSMYQSLCNIPRDLEEVSRSFRLSGWQKFWYLGVPFSMPGLVWNMMMSMSGGWFFVVASEMIVVGDTVIPLPGIGSYIALAIKEQDLLAILYAMLTMLGVIFLYDQLLFRPMIVWSNKFRLERTTGIYPADSWVLYLFRKTNFLRFIGYSSWNFFSPLSNNVKKLCRTLGVIRFHFPENFLQLCSNQRVSYMLDIFWFCVVCGVAIGIAWQSIGYIVNHFTYQDVLYVIWLGCITMFRVVVLIIIASIIWIPVGIWIGFRPHISSKIQPFAQLLAAFPANVFFPLVVSCVSYYHLNPNLWLSLLMIFGTQWYILFNVIAGASAFPNDFKEVASSFHITGWRWWRYIILPGIFPYYVTGAITACGGAWNASIVSEVASWGHIHLRTTGLGAYIAESTEKGSFPEVVLGVLIMCCFVLALNRFLWHPLYLYGTRCLRL
MFLYNILPPFISRRIFPNIFDLLAFVLVIGIINILLHGIQETTVPRDIVDIVPITLDVHSLPQYASRTTLRMLSAMVISLLFTFVYATLAAKSRRLGMVLVPILDIMQSIPILGFLTFTVVYFMNLYPGKVIGAELAAIFAIFTSQVWNMTFSMYQSLCNIPRDLEEVSRSFRLSGWQKFWYLGVPFSMPGLVWNMMMSMSGGWFFVVASEMIVVGDTVIPLPGIGSYIALAIKEQDLLAILYAMLTMLGVIFLYDQLLFRPMIVWSNKFRLERTTGIYPADSWVLYLFRKTNFLRFIGYSSWNFFSPLSNNVKKLCRTLGVIRFHFPENFLQLCSNQRVSYMLDIFWFCVVCGVAIGIAWQSIGYIVNHFTYQDVLYVIWLGCITMFRVVVLIIIASIIWIPVGIWIGFRPHISSKIQPFAQLLAAFPANVFFPLVVSCVSYYHLNPNLWLSLLMIFGTQWYILFNVIAGASAFPNDFKEVASSFHITGWRWWRYIILPGIFPYYVTGAITACGGAWNASIVSEVASWGHIHLRTTGLGAYIAESTEKGSFPEVVLGVLIMCCFVLALNRFLWHPLYLYGTRCLRL
MFLYNILPPFISRRIFPNIFDLLAFVLVIGIINILLHGIQETTVPRDIVDIVPITLDVHSLPQYASRTTLRMLSAMVISLLFTFVYATLAAKSRRLGMVLVPILDIMQSIPILGFLTFTVVYFMNLYPGKVIGAELAAIFAIFTSQVWNMTFSMYQSLCNIPRDLEEVSRSFRLSGWQKFWYLGVPFSMPGLVWNMMMSMSGGWFFVVASEMIVVGDTVIPLPGIGSYIALAIKEQDLLAILYAMLTMLGVIFLYDQLLFRPMIVWSNKFRLERTTGIYPADSWVLYLFRKTNFLRFIGYSSWNFFSPLSNNVKKLCRTLGVI**HFPENFLQLCSNQRVSYMLDIFWFCVVCGVAIGIAWQSIGYIVNHFTYQDVLYVIWLGCITMFRVVVLIIIASIIWIPVGIWIGFRPHISSKIQPFAQLLAAFPANVFFPLVVSCVSYYHLNPNLWLSLLMIFGTQWYILFNVIAGASAFPNDFKEVASSFHITGWRWWRYIILPGIFPYYVTGAITACGGAWNASIVSEVASWGHIHLRTTGLGAYIAESTEKGSFPEVVLGVLIMCCFVLALNRFLWHPLYLYGTRCLR*
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooo
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLYNILPPFISRRIFPNIFDLLAFVLVIGIINILLHGIQETTVPRDIVDIVPITLDVHSLPQYASRTTLRMLSAMVISLLFTFVYATLAAKSRRLGMVLVPILDIMQSIPILGFLTFTVVYFMNLYPGKVIGAELAAIFAIFTSQVWNMTFSMYQSLCNIPRDLEEVSRSFRLSGWQKFWYLGVPFSMPGLVWNMMMSMSGGWFFVVASEMIVVGDTVIPLPGIGSYIALAIKEQDLLAILYAMLTMLGVIFLYDQLLFRPMIVWSNKFRLERTTGIYPADSWVLYLFRKTNFLRFIGYSSWNFFSPLSNNVKKLCRTLGVIRFHFPENFLQLCSNQRVSYMLDIFWFCVVCGVAIGIAWQSIGYIVNHFTYQDVLYVIWLGCITMFRVVVLIIIASIIWIPVGIWIGFRPHISSKIQPFAQLLAAFPANVFFPLVVSCVSYYHLNPNLWLSLLMIFGTQWYILFNVIAGASAFPNDFKEVASSFHITGWRWWRYIILPGIFPYYVTGAITACGGAWNASIVSEVASWGHIHLRTTGLGAYIAESTEKGSFPEVVLGVLIMCCFVLALNRFLWHPLYLYGTRCLRL
MFLYNILPPFISRRIFPNIFDLLAFVLVIGIINILLHGIQETTVPRDIVDIVPITLDVHSLPQYASRTTLRMLSAMVISLLFTFVYATLAAKSRRLGMVLVPILDIMQSIPILGFLTFTVVYFMNLYPGKVIGAELAAIFAIFTSQVWNMTFSMYQSLCNIPRDLEEVSRSFRLSGWQKFWYLGVPFSMPGLVWNMMMSMSGGWFFVVASEMIVVGDTVIPLPGIGSYIALAIKEQDLLAILYAMLTMLGVIFLYDQLLFRPMIVWSNKFRLERTTGIYPADSWVLYLFRKTNFLRFIGYSSWNFFSPLSNNVKKLCRTLGVIRFHFPENFLQLCSNQRVSYMLDIFWFCVVCGVAIGIAWQSIGYIVNHFTYQDVLYVIWLGCITMFRVVVLIIIASIIWIPVGIWIGFRPHISSKIQPFAQLLAAFPANVFFPLVVSCVSYYHLNPNLWLSLLMIFGTQWYILFNVIAGASAFPNDFKEVASSFHITGWRWWRYIILPGIFPYYVTGAITACGGAWNASIVSEVASWGHIHLRTTGLGAYIAESTEKGSFPEVVLGVLIMCCFVLALNRFLWHPLYLYGTRCLRL
MFLYNILPPFISRRIFPNIFDLLAFVLVIGIINILLHGIQETTVPRDIVDIVPITLDVHSLPQYASRTTLRMLSAMVISLLFTFVYATLAAKSRRLGMVLVPILDIMQSIPILGFLTFTVVYFMNLYPGKVIGAELAAIFAIFTSQVWNMTFSMYQSLCNIPRDLEEVSRSFRLSGWQKFWYLGVPFSMPGLVWNMMMSMSGGWFFVVASEMIVVGDTVIPLPGIGSYIALAIKEQDLLAILYAMLTMLGVIFLYDQLLFRPMIVWSNKFRLERTTGIYPADSWVLYLFRKTNFLRFIGYSSWNFFSPLSNNVKKLCRTLGVIRFHFPENFLQLCSNQRVSYMLDIFWFCVVCGVAIGIAWQSIGYIVNHFTYQDVLYVIWLGCITMFRVVVLIIIASIIWIPVGIWIGFRPHISSKIQPFAQLLAAFPANVFFPLVVSCVSYYHLNPNLWLSLLMIFGTQWYILFNVIAGASAFPNDFKEVASSFHITGWRWWRYIILPGIFPYYVTGAITACGGAWNASIVSEVASWGHIHLRTTGLGAYIAESTEKGSFPEVVLGVLIMCCFVLALNRFLWHPLYLYGTRCLRL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target587 ABC transporter permease [Candidatus Liberibacter asiat
254780341281 proline/glycine betaine ABC transporter, permease 0.014
>gi|254780341|ref|YP_003064754.1| proline/glycine betaine ABC transporter, permease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 281 Back     alignment
 Score = 33.1 bits (74), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 69/152 (45%), Gaps = 10/152 (6%)

Query: 63  QYASRTTLRMLSAMVISLLFTFVYATLAAKSRRLGMVLVPILDIMQSIPILGFLTFTVVY 122
           Q  + T   +L +  IS+        LAA   R   ++   LD MQ+IP   +L   +V 
Sbjct: 91  QETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVL 150

Query: 123 F-MNLYPGKVIGAELAAIFAIFTSQVWNMTFSMYQSLCNIPRDLEEVSRSFRLSGWQKFW 181
           F + + PG V       +F+I TS            + + P  L+E + +F  + +Q F 
Sbjct: 151 FGLGMVPGIVA----TIVFSIPTSVRLT-----RLGIISTPPILKEAACAFGATPFQVFR 201

Query: 182 YLGVPFSMPGLVWNMMMSMSGGWFFVVASEMI 213
            + +PF++P +V ++  ++      VV + ++
Sbjct: 202 KVELPFAIPQIVASLTQTIMLSLSMVVVTALV 233

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target587 ABC transporter permease [Candidatus Liberibacter asiat
315121797555 ABC transporter permease [Candidatus Liberibacter solan 1 0.0
146337816577 ABC transporter permease [Bradyrhizobium sp. ORS278] Le 1 0.0
148258661577 ABC transporter permease [Bradyrhizobium sp. BTAi1] Len 1 0.0
148252998585 ABC transporter permease [Bradyrhizobium sp. BTAi1] Len 1 0.0
222106535556 ABC-type anion transport system, duplicated permease co 1 0.0
158424701582 putative ABC transporter nitrate permease [Azorhizobium 1 0.0
167585833584 ABC nitrate/sulfonate/bicarbonate family transporter, i 1 0.0
171321263585 binding-protein-dependent transport systems inner membr 1 0.0
167841086585 ABC transporter, permease protein [Burkholderia thailan 1 0.0
134296585585 binding-protein-dependent transport systems inner membr 1 0.0
>gi|315121797|ref|YP_004062286.1| ABC transporter permease [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 555 Back     alignment and organism information
 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/553 (76%), Positives = 485/553 (87%)

Query: 34  ILLHGIQETTVPRDIVDIVPITLDVHSLPQYASRTTLRMLSAMVISLLFTFVYATLAAKS 93
           +L   +QETTVP DIVDIVPITLDV SLP+YASRTTLRML A+V+SLLFTF+YATLAAKS
Sbjct: 1   MLFRSVQETTVPCDIVDIVPITLDVSSLPKYASRTTLRMLIAIVVSLLFTFIYATLAAKS 60

Query: 94  RRLGMVLVPILDIMQSIPILGFLTFTVVYFMNLYPGKVIGAELAAIFAIFTSQVWNMTFS 153
           RRLGMVL+PILDIMQSIPILGFLTFTV+YF++LYPG+VIGAE AAIFAIFTSQVWNMTFS
Sbjct: 61  RRLGMVLIPILDIMQSIPILGFLTFTVIYFISLYPGRVIGAEFAAIFAIFTSQVWNMTFS 120

Query: 154 MYQSLCNIPRDLEEVSRSFRLSGWQKFWYLGVPFSMPGLVWNMMMSMSGGWFFVVASEMI 213
           MYQSLCNIP+DLEEVSRSFRLSGWQKFW L VPFS+PGLVWNMM+SMSGGWFFVVA+EMI
Sbjct: 121 MYQSLCNIPKDLEEVSRSFRLSGWQKFWNLDVPFSIPGLVWNMMISMSGGWFFVVAAEMI 180

Query: 214 VVGDTVIPLPGIGSYIALAIKEQDLLAILYAMLTMLGVIFLYDQLLFRPMIVWSNKFRLE 273
           VVGDTVI LPGIGSY+ALAIKE+ L+++LYAMLTM+GVI LYDQLLFRP+I WSNKFRLE
Sbjct: 181 VVGDTVISLPGIGSYVALAIKERSLVSVLYAMLTMVGVILLYDQLLFRPIIAWSNKFRLE 240

Query: 274 RTTGIYPADSWVLYLFRKTNFLRFIGYSSWNFFSPLSNNVKKLCRTLGVIRFHFPENFLQ 333
           RTT ++ +D WVL LFRKTNFLRF+G+SS+    PLS N  KL R    I+F+FP+N   
Sbjct: 241 RTTAVHSSDPWVLSLFRKTNFLRFLGHSSYKIILPLSCNFNKLYRLFNYIQFYFPDNLGL 300

Query: 334 LCSNQRVSYMLDIFWFCVVCGVAIGIAWQSIGYIVNHFTYQDVLYVIWLGCITMFRVVVL 393
              N+++SY+LDI WF  V  +A+GIAW+S  YI+++  Y D+LYV WLGCITM RVV+L
Sbjct: 301 FSCNKKISYILDIIWFLAVYSIAMGIAWKSFEYIIDNLGYYDILYVFWLGCITMLRVVIL 360

Query: 394 IIIASIIWIPVGIWIGFRPHISSKIQPFAQLLAAFPANVFFPLVVSCVSYYHLNPNLWLS 453
           IIIA+IIW+P+G+WIG RPHI+SKIQPFAQ LAAFP+N+FFPLVVS + YY LNPN+WLS
Sbjct: 361 IIIATIIWVPIGVWIGMRPHIASKIQPFAQFLAAFPSNIFFPLVVSIIFYYDLNPNIWLS 420

Query: 454 LLMIFGTQWYILFNVIAGASAFPNDFKEVASSFHITGWRWWRYIILPGIFPYYVTGAITA 513
            LMI GTQWYILFN+I+G SAFPNDFKEV  SFH+TGW  WRY+ILPGIFP+YVTGAITA
Sbjct: 421 SLMILGTQWYILFNIISGTSAFPNDFKEVVQSFHVTGWYRWRYVILPGIFPFYVTGAITA 480

Query: 514 CGGAWNASIVSEVASWGHIHLRTTGLGAYIAESTEKGSFPEVVLGVLIMCCFVLALNRFL 573
           CGGAWNASIVSEVASWG+I+LR TGLGAYIAESTEKG+FPEV LG+L+MCCFVL LN FL
Sbjct: 481 CGGAWNASIVSEVASWGNIYLRATGLGAYIAESTEKGNFPEVALGILVMCCFVLFLNIFL 540

Query: 574 WHPLYLYGTRCLR 586
           W PLY Y  R LR
Sbjct: 541 WRPLYRYSARHLR 553


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|146337816|ref|YP_001202864.1| ABC transporter permease [Bradyrhizobium sp. ORS278] Length = 577 Back     alignment and organism information
>gi|148258661|ref|YP_001243246.1| ABC transporter permease [Bradyrhizobium sp. BTAi1] Length = 577 Back     alignment and organism information
>gi|148252998|ref|YP_001237583.1| ABC transporter permease [Bradyrhizobium sp. BTAi1] Length = 585 Back     alignment and organism information
>gi|222106535|ref|YP_002547326.1| ABC-type anion transport system, duplicated permease component [Agrobacterium vitis S4] Length = 556 Back     alignment and organism information
>gi|158424701|ref|YP_001525993.1| putative ABC transporter nitrate permease [Azorhizobium caulinodans ORS 571] Length = 582 Back     alignment and organism information
>gi|167585833|ref|ZP_02378221.1| ABC nitrate/sulfonate/bicarbonate family transporter, inner membrane subunit [Burkholderia ubonensis Bu] Length = 584 Back     alignment and organism information
>gi|171321263|ref|ZP_02910228.1| binding-protein-dependent transport systems inner membrane component [Burkholderia ambifaria MEX-5] Length = 585 Back     alignment and organism information
>gi|167841086|ref|ZP_02467770.1| ABC transporter, permease protein [Burkholderia thailandensis MSMB43] Length = 585 Back     alignment and organism information
>gi|134296585|ref|YP_001120320.1| binding-protein-dependent transport systems inner membrane component [Burkholderia vietnamiensis G4] Length = 585 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target587 ABC transporter permease [Candidatus Liberibacter asiat
COG0600258 COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate t 8e-14
COG4176290 COG4176, ProW, ABC-type proline/glycine betaine transpo 1e-08
cd06261190 cd06261, TM_PBP2, Transmembrane subunit (TM) found in P 2e-08
COG1174221 COG1174, OpuBB, ABC-type proline/glycine betaine transp 2e-04
PRK11365263 PRK11365, ssuC, alkanesulfonate transporter permease su 0.004
COG0600258 COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate t 2e-12
TIGR01183202 TIGR01183, ntrB, nitrate ABC transporter, permease prot 5e-11
cd06261190 cd06261, TM_PBP2, Transmembrane subunit (TM) found in P 5e-06
pfam00528183 pfam00528, BPD_transp_1, Binding-protein-dependent tran 1e-05
COG1174221 COG1174, OpuBB, ABC-type proline/glycine betaine transp 0.001
PRK10160275 PRK10160, PRK10160, taurine transporter subunit; Provis 0.001
TIGR01183202 TIGR01183, ntrB, nitrate ABC transporter, permease prot 6e-08
pfam00528183 pfam00528, BPD_transp_1, Binding-protein-dependent tran 3e-07
TIGR03416267 TIGR03416, ABC_choXWV_perm, choline ABC transporter, pe 2e-07
PRK10952355 PRK10952, PRK10952, glycine betaine transporter membran 0.001
COG4986523 COG4986, COG4986, ABC-type anion transport system, dupl 1e-122
>gnl|CDD|30945 COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|33916 COG4176, ProW, ABC-type proline/glycine betaine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|119394 cd06261, TM_PBP2, Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>gnl|CDD|31367 COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183100 PRK11365, ssuC, alkanesulfonate transporter permease subunit; Provisional Back     alignment and domain information
>gnl|CDD|30945 COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130251 TIGR01183, ntrB, nitrate ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|119394 cd06261, TM_PBP2, Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>gnl|CDD|144205 pfam00528, BPD_transp_1, Binding-protein-dependent transport system inner membrane component Back     alignment and domain information
>gnl|CDD|31367 COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182276 PRK10160, PRK10160, taurine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|130251 TIGR01183, ntrB, nitrate ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|144205 pfam00528, BPD_transp_1, Binding-protein-dependent transport system inner membrane component Back     alignment and domain information
>gnl|CDD|132457 TIGR03416, ABC_choXWV_perm, choline ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|182861 PRK10952, PRK10952, glycine betaine transporter membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|34591 COG4986, COG4986, ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 587 ABC transporter permease [Candidatus Liberibacter asiat
COG4986523 ABC-type anion transport system, duplicated permease co 100.0
COG1178540 ThiP ABC-type Fe3+ transport system, permease component 100.0
PRK09433536 thiP thiamine transporter membrane protein; Reviewed 100.0
TIGR03262546 PhnU2 putative 2-aminoethylphosphonate ABC transport sy 100.0
COG0600258 TauC ABC-type nitrate/sulfonate/bicarbonate transport s 100.0
PRK10160275 taurine transporter subunit; Provisional 100.0
PRK11365263 ssuC alkanesulfonate transporter permease subunit; Prov 100.0
TIGR03416267 ABC_choXWV_perm choline ABC transporter, permease prote 99.97
PRK10952354 glycine betaine transporter membrane protein; Provision 99.96
COG4176290 ProW ABC-type proline/glycine betaine transport system, 99.94
COG1174221 OpuBB ABC-type proline/glycine betaine transport system 99.92
PRK10971277 sulfate/thiosulfate transporter subunit; Provisional 99.91
PRK10592281 putrescine transporter subunit: membrane component of A 99.89
PRK09421229 modB molybdate ABC transporter permease protein; Review 99.89
TIGR03226312 PhnU 2-aminoethylphosphonate ABC transporter, permease 99.89
TIGR03255272 PhnV 2-aminoethylphosphonate ABC transport system, memb 99.89
PRK11602291 cysW sulfate/thiosulfate transporter permease subunit; 99.88
COG1177267 PotC ABC-type spermidine/putrescine transport system, p 99.88
PRK10782217 DL-methionine transporter permease subunit; Provisional 99.87
PRK09500257 potC spermidine/putrescine ABC transporter membrane pro 99.87
PRK10683317 putrescine transporter subunit: membrane component of A 99.86
PRK09497285 potB spermidine/putrescine ABC transporter membrane pro 99.84
pfam00528183 BPD_transp_1 Binding-protein-dependent transport system 99.83
TIGR01183203 ntrB nitrate ABC transporter, permease protein; InterPr 99.83
TIGR02141212 modB_ABC molybdate ABC transporter, permease protein; I 99.82
COG4149225 ModC ABC-type molybdate transport system, permease comp 99.81
COG0555274 CysU ABC-type sulfate transport system, permease compon 99.81
COG0581292 PstA ABC-type phosphate transport system, permease comp 99.8
TIGR01581226 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR0 99.8
COG0395281 UgpE ABC-type sugar transport system, permease componen 99.79
cd06261190 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic 99.78
PRK11268292 pstA phosphate transporter permease subunit; Provisiona 99.78
COG1176287 PotB ABC-type spermidine/putrescine transport system, p 99.78
PRK10998296 malG maltose transporter permease; Provisional 99.78
PRK10973281 glycerol-3-phosphate transporter membrane protein; Prov 99.77
PRK11275319 pstC phosphate transporter permease subunit; Provisiona 99.76
TIGR02139265 permease_CysT sulfate ABC transporter, permease protein 99.73
PRK10999520 malF maltose transporter membrane protein; Provisional 99.73
COG2011222 AbcD ABC-type metal ion transport system, permease comp 99.73
PRK10561280 glycerol-3-phosphate transporter permease; Provisional 99.72
TIGR00974302 3a0107s02c phosphate ABC transporter, permease protein 99.71
COG1175295 UgpA ABC-type sugar transport systems, permease compone 99.7
TIGR00969280 3a0106s02 sulfate ABC transporter, permease protein; In 99.68
COG0573310 PstC ABC-type phosphate transport system, permease comp 99.66
TIGR02138317 phosphate_pstC phosphate ABC transporter, permease prot 99.65
PRK09494219 glnP glutamine ABC transporter permease protein; Review 99.64
COG3833282 MalG ABC-type maltose transport systems, permease compo 99.63
PRK11123238 arginine transporter permease subunit ArtQ; Provisional 99.6
COG0765222 HisM ABC-type amino acid transport system, permease com 99.55
COG3639283 ABC-type phosphate/phosphonate transport system, permea 99.54
COG1173289 DppC ABC-type dipeptide/oligopeptide/nickel transport s 99.51
COG0601317 DppB ABC-type dipeptide/oligopeptide/nickel transport s 99.49
TIGR02140275 permease_CysW sulfate ABC transporter, permease protein 99.48
PRK09881296 ATP-dependent peptide transporter membrane subunit; Pro 99.44
PRK10417272 nikC nickel transporter permease NikC; Provisional 99.35
PRK10352314 nickel transporter permease NikB; Provisional 99.35
PRK10913300 dipeptide transporter; Provisional 99.35
COG4208287 CysW ABC-type sulfate transport system, permease compon 99.34
PRK09471306 oppB oligopeptide transporter permease; Reviewed 99.33
PRK10914339 dipeptide transporter permease DppB; Provisional 99.3
COG4662227 TupA ABC-type tungstate transport system, periplasmic c 99.23
TIGR03004216 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, pe 99.04
TIGR02790258 nickel_nikC nickel ABC transporter, permease subunit Ni 99.03
TIGR01097192 3A0109s02M phosphonate ABC transporter, permease protei 98.99
TIGR02789315 nickel_nikB nickel ABC transporter, permease subunit Ni 98.4
COG4168321 SapB ABC-type antimicrobial peptide transport system, p 98.2
COG4174364 ABC-type uncharacterized transport system, permease com 97.52
COG0600258 TauC ABC-type nitrate/sulfonate/bicarbonate transport s 100.0
PRK10160275 taurine transporter subunit; Provisional 100.0
PRK10952354 glycine betaine transporter membrane protein; Provision 99.97
TIGR03416267 ABC_choXWV_perm choline ABC transporter, permease prote 99.97
COG4176290 ProW ABC-type proline/glycine betaine transport system, 99.97
PRK11602291 cysW sulfate/thiosulfate transporter permease subunit; 99.96
PRK10683317 putrescine transporter subunit: membrane component of A 99.96
COG1176287 PotB ABC-type spermidine/putrescine transport system, p 99.95
PRK09497285 potB spermidine/putrescine ABC transporter membrane pro 99.94
PRK09421229 modB molybdate ABC transporter permease protein; Review 99.94
COG1177267 PotC ABC-type spermidine/putrescine transport system, p 99.93
COG0555274 CysU ABC-type sulfate transport system, permease compon 99.92
TIGR01581226 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR0 99.91
TIGR03255272 PhnV 2-aminoethylphosphonate ABC transport system, memb 99.91
COG1174221 OpuBB ABC-type proline/glycine betaine transport system 99.91
TIGR02139265 permease_CysT sulfate ABC transporter, permease protein 99.89
TIGR00969280 3a0106s02 sulfate ABC transporter, permease protein; In 99.89
COG4149225 ModC ABC-type molybdate transport system, permease comp 99.89
COG0395281 UgpE ABC-type sugar transport system, permease componen 99.89
TIGR03262546 PhnU2 putative 2-aminoethylphosphonate ABC transport sy 99.88
PRK10782217 DL-methionine transporter permease subunit; Provisional 99.87
PRK10998296 malG maltose transporter permease; Provisional 99.87
COG1178540 ThiP ABC-type Fe3+ transport system, permease component 99.87
PRK09433536 thiP thiamine transporter membrane protein; Reviewed 99.87
PRK10561280 glycerol-3-phosphate transporter permease; Provisional 99.87
PRK10973281 glycerol-3-phosphate transporter membrane protein; Prov 99.85
COG1175295 UgpA ABC-type sugar transport systems, permease compone 99.84
PRK11275319 pstC phosphate transporter permease subunit; Provisiona 99.84
TIGR02140275 permease_CysW sulfate ABC transporter, permease protein 99.81
COG4986523 ABC-type anion transport system, duplicated permease co 99.81
COG3639283 ABC-type phosphate/phosphonate transport system, permea 99.8
COG0573310 PstC ABC-type phosphate transport system, permease comp 99.79
COG3833282 MalG ABC-type maltose transport systems, permease compo 99.79
COG2011222 AbcD ABC-type metal ion transport system, permease comp 99.76
TIGR01183203 ntrB nitrate ABC transporter, permease protein; InterPr 99.74
COG4208287 CysW ABC-type sulfate transport system, permease compon 99.69
TIGR01097192 3A0109s02M phosphonate ABC transporter, permease protei 99.67
PRK11123238 arginine transporter permease subunit ArtQ; Provisional 99.63
PRK10999520 malF maltose transporter membrane protein; Provisional 99.57
PRK11122222 artM arginine transporter permease subunit ArtM; Provis 99.57
PRK09471306 oppB oligopeptide transporter permease; Reviewed 99.56
PRK10352314 nickel transporter permease NikB; Provisional 99.52
PRK10914339 dipeptide transporter permease DppB; Provisional 99.5
COG4662227 TupA ABC-type tungstate transport system, periplasmic c 99.48
COG4209309 LplB ABC-type polysaccharide transport system, permease 99.39
COG4215230 ArtQ ABC-type arginine transport system, permease compo 99.36
COG0601317 DppB ABC-type dipeptide/oligopeptide/nickel transport s 99.29
TIGR02790258 nickel_nikC nickel ABC transporter, permease subunit Ni 99.19
TIGR03004216 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, pe 99.11
TIGR01253519 thiP thiamine/thiamine pyrophosphate ABC transporter, p 99.08
TIGR02789315 nickel_nikB nickel ABC transporter, permease subunit Ni 99.0
COG4168321 SapB ABC-type antimicrobial peptide transport system, p 98.8
COG4239341 ABC-type uncharacterized transport system, permease com 98.49
PRK11365263 ssuC alkanesulfonate transporter permease subunit; Prov 100.0
PRK10971277 sulfate/thiosulfate transporter subunit; Provisional 99.97
TIGR03226312 PhnU 2-aminoethylphosphonate ABC transporter, permease 99.96
PRK10592281 putrescine transporter subunit: membrane component of A 99.95
PRK09500257 potC spermidine/putrescine ABC transporter membrane pro 99.94
CHL00187235 cysT sulfate transport protein; Provisional 99.93
cd06261190 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic 99.86
PRK11268292 pstA phosphate transporter permease subunit; Provisiona 99.83
COG0581292 PstA ABC-type phosphate transport system, permease comp 99.82
TIGR02138317 phosphate_pstC phosphate ABC transporter, permease prot 99.78
TIGR00974302 3a0107s02c phosphate ABC transporter, permease protein 99.77
PRK09494219 glnP glutamine ABC transporter permease protein; Review 99.66
COG0765222 HisM ABC-type amino acid transport system, permease com 99.57
COG4132282 ABC-type uncharacterized transport system, permease com 99.56
COG1173289 DppC ABC-type dipeptide/oligopeptide/nickel transport s 99.53
PRK10913300 dipeptide transporter; Provisional 99.53
PRK09881296 ATP-dependent peptide transporter membrane subunit; Pro 99.52
PRK10417272 nikC nickel transporter permease NikC; Provisional 99.5
COG4135551 ABC-type uncharacterized transport system, permease com 99.1
COG4171296 SapC ABC-type antimicrobial peptide transport system, p 98.83
COG4590733 ABC-type uncharacterized transport system, permease com 98.4
TIGR02141212 modB_ABC molybdate ABC transporter, permease protein; I 99.89
pfam00528183 BPD_transp_1 Binding-protein-dependent transport system 99.79
COG4174364 ABC-type uncharacterized transport system, permease com 96.91
TIGR01253519 thiP thiamine/thiamine pyrophosphate ABC transporter, p 99.89
COG4135551 ABC-type uncharacterized transport system, permease com 99.72
CHL00187235 cysT sulfate transport protein; Provisional 99.8
PRK11122222 artM arginine transporter permease subunit ArtM; Provis 99.56
COG4215230 ArtQ ABC-type arginine transport system, permease compo 99.21
TIGR03003218 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, pe 98.99
COG4239341 ABC-type uncharacterized transport system, permease com 98.66
COG4171296 SapC ABC-type antimicrobial peptide transport system, p 98.28
COG4132282 ABC-type uncharacterized transport system, permease com 99.04
COG4209309 LplB ABC-type polysaccharide transport system, permease 98.96
COG4590733 ABC-type uncharacterized transport system, permease com 98.78
TIGR03003218 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, pe 98.89
COG4160228 ArtM ABC-type arginine/histidine transport system, perm 98.86
COG4597397 BatB ABC-type amino acid transport system, permease com 98.01
COG4160228 ArtM ABC-type arginine/histidine transport system, perm 98.83
COG4597397 BatB ABC-type amino acid transport system, permease com 98.02
TIGR0172699 HEQRo_perm_3TM amino acid ABC transporter, permease pro 96.44
>COG4986 ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09433 thiP thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein Back     alignment and domain information
>COG0600 TauC ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10160 taurine transporter subunit; Provisional Back     alignment and domain information
>PRK11365 ssuC alkanesulfonate transporter permease subunit; Provisional Back     alignment and domain information
>TIGR03416 ABC_choXWV_perm choline ABC transporter, permease protein Back     alignment and domain information
>PRK10952 glycine betaine transporter membrane protein; Provisional Back     alignment and domain information
>COG4176 ProW ABC-type proline/glycine betaine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1174 OpuBB ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10971 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK10592 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>PRK09421 modB molybdate ABC transporter permease protein; Reviewed Back     alignment and domain information
>TIGR03226 PhnU 2-aminoethylphosphonate ABC transporter, permease protein Back     alignment and domain information
>TIGR03255 PhnV 2-aminoethylphosphonate ABC transport system, membrane component PhnV Back     alignment and domain information
>PRK11602 cysW sulfate/thiosulfate transporter permease subunit; Provisional Back     alignment and domain information
>COG1177 PotC ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10782 DL-methionine transporter permease subunit; Provisional Back     alignment and domain information
>PRK09500 potC spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>PRK10683 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>PRK09497 potB spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>pfam00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component Back     alignment and domain information
>TIGR01183 ntrB nitrate ABC transporter, permease protein; InterPro: IPR005889 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR02141 modB_ABC molybdate ABC transporter, permease protein; InterPro: IPR011867 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4149 ModC ABC-type molybdate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0555 CysU ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0581 PstA ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01581 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR006469 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG0395 UgpE ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06261 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>PRK11268 pstA phosphate transporter permease subunit; Provisional Back     alignment and domain information
>COG1176 PotB ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10998 malG maltose transporter permease; Provisional Back     alignment and domain information
>PRK10973 glycerol-3-phosphate transporter membrane protein; Provisional Back     alignment and domain information
>PRK11275 pstC phosphate transporter permease subunit; Provisional Back     alignment and domain information
>TIGR02139 permease_CysT sulfate ABC transporter, permease protein CysT; InterPro: IPR011865 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK10999 malF maltose transporter membrane protein; Provisional Back     alignment and domain information
>COG2011 AbcD ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10561 glycerol-3-phosphate transporter permease; Provisional Back     alignment and domain information
>TIGR00974 3a0107s02c phosphate ABC transporter, permease protein PstA; InterPro: IPR005672 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>COG1175 UgpA ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00969 3a0106s02 sulfate ABC transporter, permease protein; InterPro: IPR005667 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>COG0573 PstC ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02138 phosphate_pstC phosphate ABC transporter, permease protein PstC; InterPro: IPR011864 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK09494 glnP glutamine ABC transporter permease protein; Reviewed Back     alignment and domain information
>COG3833 MalG ABC-type maltose transport systems, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11123 arginine transporter permease subunit ArtQ; Provisional Back     alignment and domain information
>COG0765 HisM ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>COG3639 ABC-type phosphate/phosphonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1173 DppC ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0601 DppB ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02140 permease_CysW sulfate ABC transporter, permease protein CysW; InterPro: IPR011866 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK09881 ATP-dependent peptide transporter membrane subunit; Provisional Back     alignment and domain information
>PRK10417 nikC nickel transporter permease NikC; Provisional Back     alignment and domain information
>PRK10352 nickel transporter permease NikB; Provisional Back     alignment and domain information
>PRK10913 dipeptide transporter; Provisional Back     alignment and domain information
>COG4208 CysW ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09471 oppB oligopeptide transporter permease; Reviewed Back     alignment and domain information
>PRK10914 dipeptide transporter permease DppB; Provisional Back     alignment and domain information
>COG4662 TupA ABC-type tungstate transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>TIGR03004 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, permease protein EhuC; InterPro: IPR014342 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR02790 nickel_nikC nickel ABC transporter, permease subunit NikC; InterPro: IPR014157 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR01097 3A0109s02M phosphonate ABC transporter, permease protein; InterPro: IPR005769 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>TIGR02789 nickel_nikB nickel ABC transporter, permease subunit NikB; InterPro: IPR014156 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4168 SapB ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Back     alignment and domain information
>COG4174 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG0600 TauC ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10160 taurine transporter subunit; Provisional Back     alignment and domain information
>PRK10952 glycine betaine transporter membrane protein; Provisional Back     alignment and domain information
>TIGR03416 ABC_choXWV_perm choline ABC transporter, permease protein Back     alignment and domain information
>COG4176 ProW ABC-type proline/glycine betaine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11602 cysW sulfate/thiosulfate transporter permease subunit; Provisional Back     alignment and domain information
>PRK10683 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>COG1176 PotB ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09497 potB spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>PRK09421 modB molybdate ABC transporter permease protein; Reviewed Back     alignment and domain information
>COG1177 PotC ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism] Back     alignment and domain information
>COG0555 CysU ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01581 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR006469 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR03255 PhnV 2-aminoethylphosphonate ABC transport system, membrane component PhnV Back     alignment and domain information
>COG1174 OpuBB ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02139 permease_CysT sulfate ABC transporter, permease protein CysT; InterPro: IPR011865 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR00969 3a0106s02 sulfate ABC transporter, permease protein; InterPro: IPR005667 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>COG4149 ModC ABC-type molybdate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0395 UgpE ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein Back     alignment and domain information
>PRK10782 DL-methionine transporter permease subunit; Provisional Back     alignment and domain information
>PRK10998 malG maltose transporter permease; Provisional Back     alignment and domain information
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09433 thiP thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>PRK10561 glycerol-3-phosphate transporter permease; Provisional Back     alignment and domain information
>PRK10973 glycerol-3-phosphate transporter membrane protein; Provisional Back     alignment and domain information
>COG1175 UgpA ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11275 pstC phosphate transporter permease subunit; Provisional Back     alignment and domain information
>TIGR02140 permease_CysW sulfate ABC transporter, permease protein CysW; InterPro: IPR011866 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4986 ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3639 ABC-type phosphate/phosphonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0573 PstC ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3833 MalG ABC-type maltose transport systems, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2011 AbcD ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01183 ntrB nitrate ABC transporter, permease protein; InterPro: IPR005889 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4208 CysW ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01097 3A0109s02M phosphonate ABC transporter, permease protein; InterPro: IPR005769 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>PRK11123 arginine transporter permease subunit ArtQ; Provisional Back     alignment and domain information
>PRK10999 malF maltose transporter membrane protein; Provisional Back     alignment and domain information
>PRK11122 artM arginine transporter permease subunit ArtM; Provisional Back     alignment and domain information
>PRK09471 oppB oligopeptide transporter permease; Reviewed Back     alignment and domain information
>PRK10352 nickel transporter permease NikB; Provisional Back     alignment and domain information
>PRK10914 dipeptide transporter permease DppB; Provisional Back     alignment and domain information
>COG4662 TupA ABC-type tungstate transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>COG4209 LplB ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4215 ArtQ ABC-type arginine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>COG0601 DppB ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02790 nickel_nikC nickel ABC transporter, permease subunit NikC; InterPro: IPR014157 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR03004 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, permease protein EhuC; InterPro: IPR014342 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR01253 thiP thiamine/thiamine pyrophosphate ABC transporter, permease protein; InterPro: IPR005947 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR02789 nickel_nikB nickel ABC transporter, permease subunit NikB; InterPro: IPR014156 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4168 SapB ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Back     alignment and domain information
>COG4239 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PRK11365 ssuC alkanesulfonate transporter permease subunit; Provisional Back     alignment and domain information
>PRK10971 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR03226 PhnU 2-aminoethylphosphonate ABC transporter, permease protein Back     alignment and domain information
>PRK10592 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>PRK09500 potC spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information